This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
pos len size sampleids | |
126877554 -78 1 HG02056 | |
126877706 83 1 HG02056 | |
126877919 -74 1 HG02056 | |
126892069 702 2 "HG02451 HG02717" | |
126892074 696 1 NA18522 | |
126892074 698 1 NA20300 | |
126892074 699 49 "HG02809 HG00741 NA18906 HG01978 HG01192 HG03017 HG01361 HG02723 HG03098 HG02735 HG02698 HG02056 HG03704 HG01496 HG04199 HG01106 HG02602 HG03492 HG02735 NA18747 HG03710 HG00738 NA18960 HG01123 HG03471 HG01346 HG04204 HG01175 HG02809 NA19005 NA18950 HG03927 HG00423 HG02895 NA19012 HG02738 HG00323 HG03704 NA18939 HG02897 NA18946 HG01123 NA18957 NA18990 HG02293 NA19090 NA19074 HG03490 HG03017" | |
126892074 700 18 "HG01978 HG01106 NA20752 HG02056 HG01081 HG03834 HG01071 NA19043 NA19043 NA18953 HG01884 HG01517 HG06807 HG02055 HG01099 HG02602 HG01168 HG02280" | |
126892074 701 1 NA19081 |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
S CYP21A2 * LN:i:495 ng:i:144 nc:i:150 c1:i:144 c2:i:0 pp:Z:CYP21A2 | |
S C4B_2 * LN:i:1744 ng:i:83 nc:i:86 c1:i:47 c2:i:85 pp:Z:C4B_2 | |
S NELFE * LN:i:380 ng:i:29 nc:i:29 c1:i:29 c2:i:0 pp:Z:NELFE | |
S STK19 * LN:i:254 ng:i:125 nc:i:126 c1:i:125 c2:i:0 pp:Z:STK19 | |
S DXO * LN:i:396 ng:i:122 nc:i:123 c1:i:122 c2:i:0 pp:Z:DXO | |
S SKIC2 * LN:i:1246 ng:i:107 nc:i:108 c1:i:107 c2:i:0 pp:Z:SKIC2 | |
S C4A * LN:i:1744 ng:i:63 nc:i:71 c1:i:61 c2:i:71 pp:Z:C4A | |
L CYP21A2 + C4B_2 + 0M ng:i:6 nc:i:6 ad:i:17245 s1:i:2469 s2:i:8012 | |
L CYP21A2 + C4A + 0M ng:i:4 nc:i:4 ad:i:17716 s1:i:2445 s2:i:7862 | |
L CYP21A2 - C4B_2 - 0M ng:i:70 nc:i:70 ad:i:12750 s1:i:2588 s2:i:8134 |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
[ | |
{ | |
"condition": { | |
"dataset": "ensembl_gene", | |
"filters": [ | |
{ | |
"attribute": "disease_diseases_mondo", | |
"nodes": [ | |
"c__0005180" | |
] |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
[ | |
{ | |
"condition": { | |
"dataset": "ensembl_gene", | |
"filters": [ | |
{ | |
"attribute": "disease_diseases_mondo", | |
"nodes": [ | |
"c__0005180" | |
] |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
S CYP21A2 * LN:i:495 ng:i:144 nc:i:150 c1:i:144 c2:i:0 pp:Z:CYP21A2 | |
S C4B_2 * LN:i:1744 ng:i:83 nc:i:86 c1:i:47 c2:i:85 pp:Z:C4B_2 | |
S NELFE * LN:i:380 ng:i:29 nc:i:29 c1:i:29 c2:i:0 pp:Z:NELFE | |
S STK19 * LN:i:254 ng:i:125 nc:i:126 c1:i:125 c2:i:0 pp:Z:STK19 | |
S DXO * LN:i:396 ng:i:122 nc:i:123 c1:i:122 c2:i:0 pp:Z:DXO | |
S SKIC2 * LN:i:1246 ng:i:107 nc:i:108 c1:i:107 c2:i:0 pp:Z:SKIC2 | |
S C4A * LN:i:1744 ng:i:63 nc:i:71 c1:i:61 c2:i:71 pp:Z:C4A | |
L CYP21A2 + C4B_2 + 0M ng:i:6 nc:i:6 ad:i:17245 s1:i:2469 s2:i:8012 | |
L CYP21A2 + C4A + 0M ng:i:4 nc:i:4 ad:i:17716 s1:i:2445 s2:i:7862 | |
L CYP21A2 - C4B_2 - 0M ng:i:70 nc:i:70 ad:i:12750 s1:i:2588 s2:i:8134 |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
OR4F5 | |
AGRN | |
RNF207 | |
TNFRSF25 | |
MASP2 | |
CLCN6 | |
PADI4 | |
GALE | |
FUCA1 | |
RHCE |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
{ | |
"A4GALT": "18149", | |
"ABCG8": "13887", | |
"ABI1": "11320", | |
"ABO": "79", | |
"ACSBG2": "24174", | |
"ADAMTS10": "13201", | |
"ADAMTSL2": "14631", | |
"AFP": "317", | |
"AGL": "321", |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
[ | |
{ | |
"category": "建築家", | |
"type": "JP", | |
"count": 3.69 | |
}, | |
{ | |
"category": "論理学者", | |
"type": "JP", | |
"count": 7.19 |
We can't make this file beautiful and searchable because it's too large.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Species,TaxID,Protein tag sequence | |
Aaosphaeria arxii,1450171,LREIVMTASAKISTPSMQLYPREELSIADCEKFAKSISRLPLSSVLDKVTITEELGQGTAIQQARKFKIRMDFYPAKEYTAEYAIKVRDVAESLEKKFCPRLHKVIRADLKKQQANRSLSTASSASVPQVGQSSGTIEQATTRTADNEGGRDDDESDDGDDDGDATNAKQRGRRAESVEFEAPDEDEEQIIDRIRTEGSDEEDETYGGSPKPSRAASPDQDSDSEDEETVVAREEASDIRRDRILKACGDVYDFRFDDKAGGFCEIYLEYPAEAPKVLMLNHVEATAEFATIHVIPGIKSAQVTTEKVPDPVTGEEVKKVTGIITEGANLVAMQDYPHIVDTNRLFTNDIALMLRLYGVEACRATIVREMHAVFSGH | |
Abies balsamea,90345,LREILMTASKKILTPVMTCPLRKGKTREDAERLAAKLRRIRFADLIQSLDIGIVPFSVSNGHVQTVYKLRIKLYPPAFYPQYSNLSLVDCEKTFRNQYIEVLGKEIDIALKKARKSGQEAVQIVSEPLPMDGSGVTSEDESQVNLNSREQTEDEDEQDDEAEDEGADAQKRKSQGTDVMDYDDENDEDEMSMVENICNEENSLEEDDVDNRSDVHNEAVEDEDIEEENSSKTVKASRSAEKKSNESLKESKKVKKKSKKDKTEATGVIIKGTTFEVHFPVERNTHILLAPIAEKVAKKVFVHSVDNIDRCSVIDYNGDSNVPALQTDGINFKVLWMRSDELDINRLTTNDINAMLEVYGVESARATIVAEVKGVFDSY | |
Abies lasiocarpa,34340,LREILMTASKKILTPVMTCPLRKGKTREDAERLAAKLRRIRFADLIQSLDIGIVPFSVSNGHVQTVYKLRIKLYPPAFYPQYSNLSLVDCEKTFRNQYIEVLGKEIDIALKKARKSGQEAVQIVSEPLPMDGSGVTSEDESQVNLNSREQTEDEDEQDDEAE |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
{ | |
"nodes": [ | |
{"id": "Myriel", "group": "壱"}, | |
{"id": "Napoleon", "group": "壱"}, | |
{"id": "Mlle.Baptistine", "group": "壱"}, | |
{"id": "Mme.Magloire", "group": "壱"}, | |
{"id": "CountessdeLo", "group": "壱"}, | |
{"id": "Geborand", "group": "壱"}, | |
{"id": "Champtercier", "group": "壱"}, | |
{"id": "Cravatte", "group": "壱"}, |
NewerOlder