This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
>HWR61437.1 MAG TPA: tetrahydromethanopterin S-methyltransferase subunit E, partial [Clostridia bacterium] | |
ALMGAAATIAGAAEDLESDIGSMSNPNSQVQLAPQMGHLHRMFNKAISGEPVQMGTLAGIAGSVAYVLIG | |
SVHLPVIMSIAAGGFIAALFHTAFATTSYLGRIVGQSQFNQPVFMDVITSHLGPIAAHGFIVTFCIVGLS | |
YLMNTVLQPTHPFPLPLLAVLWGITIGAIGSSTGDVHYGAEREYQTYPFGGGIPVAIHGDITTKAELGAR | |
NSIDVVHFCAKFGGPVTGFCFGLIVFLSFWVTVVFGPTGGVIAGLVIILLLIILNNRIEIFARNSYGPYK | |
E |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/env nextflow | |
params.outdir = 'results' | |
params.all = false | |
workflow { | |
First() | |
First.out.value | Second | |
Second.out.value | Third |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/env nextflow | |
params.outdir = 'results' | |
params.all = false | |
workflow { | |
First() | |
First.out.value | Second | |
Second.out.value | Third |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
process A { | |
input: val(name) | |
output: tuple val(name), path("*") | |
script: "echo hello $name > greeting.${name}.txt" | |
} | |
process B { | |
input: val(name) | |
output: tuple val(name), path("*") | |
script: "echo goodbye $name > farewell.${name}.txt" |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/env nextflow | |
nextflow.enable.dsl=2 | |
nextflow.preview.recursion=true | |
params.input = 'data/*.dat' | |
process ScannerLightly { | |
input: | |
path datfile_accumulator | |
val meta_accumulator |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/env ruby | |
require 'json' | |
require 'optparse' | |
options = {} | |
OptionParser.new do |opt| | |
opt.on('--report FILENAME') { |report| options[:report] = report } | |
end.parse! |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
process A { | |
input: | |
val(i) | |
output: | |
path("output.${i}.txt") | |
"echo hello $i > output.${i}.txt" | |
} |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
class Dog { | |
final String name | |
Dog(String name) { | |
this.name = name | |
} | |
@Override | |
public int hashCode() { | |
return name.hashCode() |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
<!DOCTYPE html> | |
<html xmlns="http://www.w3.org/1999/xhtml"> | |
<head> | |
<meta charset="utf-8" /> | |
<meta http-equiv="Content-Type" content="text/html; charset=utf-8" /> | |
<meta name="generator" content="pandoc" /> |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
##gff-version 3 | |
##sequence-region tig00000000_pilon 14405 1977269 | |
tig00000000_pilon CodingQuarry_v2.0 gene 14405 16426 . - . ID=gene1 | |
tig00000000_pilon CodingQuarry_v2.0 mRNA 14405 16426 . - . ID=mRNA1;Parent=gene1 | |
tig00000000_pilon CodingQuarry_v2.0 CDS 14405 16426 . - 0 Parent=mRNA1 | |
tig00000000_pilon CodingQuarry_v2.0 exon 14405 16426 . - 0 ID=exon1;Parent=mRNA1 | |
### | |
tig00000000_pilon CodingQuarry_v2.0 gene 17153 17833 . - . ID=gene2 | |
tig00000000_pilon CodingQuarry_v2.0 mRNA 17153 17833 . - . ID=mRNA2;Parent=gene2 | |
tig00000000_pilon CodingQuarry_v2.0 CDS 17153 17460 . - 2 ID=CDS1;Parent=mRNA2 |
NewerOlder