This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/perl | |
use warnings; | |
use strict; | |
my $seq ="AGACAAGTCGGACGTTTCATCTGAGGGTTCTTCTGCCTCCGCACTTGGTGCACATCAGACAAGGCAATCA | |
TGGGGGACGCTCAGATGGCAGAGTTTGGAGCAGCAGCTTCTTACCTGCGAAAGTCAGATCGAGAGCGTCT | |
GGAAGCACAAACCCGTCCCTTTGATATGAAAAAGGAGTGTTTTGTGCCTGATCCAGATGAAGAGTATGTA | |
AAAGCTTCAATCGTCAGTCGTGAAGGTGACAAAGTCACTGTACAGACTGAGAAAAGAAAGACTGTAACTG | |
TAAAGGAAGCTGACATTCACCCCCAGAACCCTCCAAAGTTTGATAAAATTGAAGACATGGCAATGTTCAC | |
CTTCCTTCATGAGCCAGCCGTGCTGTTCAACCTCAAAGAGCGCTATGCAGCATGGATGATCTATACCTAC | |
TCAGGACTGTTTTGTGTCACTGTCAACCCCTACAAGTGGCTGCCGGTGTACAATCAGGAGGTGGTTGTAG |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/bin/perl | |
use strict; | |
my %seq; | |
$seq{'AAC35278'} = 'LLIAITYYNEDKVLTARTLHGVMQNPAWQKIVVCLVFDGIDPVLATIGV-VMKKDVDGKE'; | |
$seq{'AnCSMA'} = 'AMCLVTCYSEGEEGIRTTLDSIALTPN-SHKSIVVICDGIIKVLRMMRD-TGSKRHNMAK'; | |
$seq{'AfCHSF'} = 'ALCLVTCYSEGEEGIRTTLDSIAMTPN-SHKTIIVICDGIIKVLRMMRD-TGSKRHNMAK'; | |
$seq{'AAF19527'} = 'AILLVTAYSEGELGIRTTLDSIATTPN-SHKTILVICDGIIKVLGMMKD-RGSKRHNMAK'; | |
$seq{'P30573-1'} = 'TINLVTCYSEDEEGIRITLDSIATTPN-SHKLILVICDGIIKVLDMMSDAQGSKRHNMAK'; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!bin/perl | |
use strict; | |
# number of 3'UTR | |
open(IN, "grep -c 'three_prime' ath_chr1.gff | ") || die $!; | |
while(my $count = <IN>) { | |
open(my $outfh => "UTR.txt") || die $!; | |
print $outfh "$count\n"; | |
} |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/perl -w | |
use strict; | |
foreach (0..8) | |
{ | |
my $line = <>; | |
print "$_ : $line"; | |
} |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
package Temperature; | |
use strict; use warnings; | |
sub f2c { | |
my $f = shift; | |
my $c = (5/9) * ($f - 32); | |
return $c; | |
} | |
sub c2f { | |
my $c = shift; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/perl -w | |
use strict; | |
use warnings; | |
use Bio::DB::Fasta; | |
use Bio::Seq; | |
use Bio::SeqIO; | |
my $file = 'sacharomyces_cerevisiae_S288C.fa'; | |
my $db = Bio::DB::Fasta->new($file); |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/bin/perl -w | |
use strict; | |
use warnings; | |
use Bio::SeqIO; | |
my $seqio = Bio::SeqIO->new(-format=>'fasta',-file=>'ath_sRNA1.fa'); | |
my $adapter='CTGTAGGCACCATCAAT'; | |
open OUT,'>trimmed_seq.fa' or die "Cannot write to a file\n"; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/bin/perl -w | |
#sort sequences into two files according to 5' barcode | |
use strict; | |
use warnings; | |
use Bio::SeqIO; | |
my $file = 'trimmed_seq.fa'; | |
my $in = Bio::SeqIO->new(-format => 'Fasta', |