Last active
July 22, 2021 07:09
-
-
Save jtpio/844ab4e85ae84f230cbcb0e56a59c88e to your computer and use it in GitHub Desktop.
JupyterLab Renderers with JupyterLab 3.1.0rc2
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
{ | |
"metadata": { | |
"language_info": { | |
"codemirror_mode": { | |
"name": "python", | |
"version": 3 | |
}, | |
"file_extension": ".py", | |
"mimetype": "text/x-python", | |
"name": "python", | |
"nbconvert_exporter": "python", | |
"pygments_lexer": "ipython3", | |
"version": "3.8" | |
}, | |
"kernelspec": { | |
"name": "python", | |
"display_name": "Pyolite", | |
"language": "python" | |
} | |
}, | |
"nbformat_minor": 4, | |
"nbformat": 4, | |
"cells": [ | |
{ | |
"cell_type": "markdown", | |
"source": [ | |
"# JupyterLab Renderers" | |
], | |
"metadata": {} | |
}, | |
{ | |
"cell_type": "markdown", | |
"source": [ | |
"## FASTA" | |
], | |
"metadata": {} | |
}, | |
{ | |
"cell_type": "code", | |
"source": [ | |
"def Fasta(data=''):\n", | |
" bundle = {}\n", | |
" bundle['application/vnd.fasta.fasta'] = data\n", | |
" bundle['text/plain'] = data\n", | |
" display(bundle, raw=True)\n", | |
"\n", | |
"Fasta(\"\"\">SEQUENCE_1\n", | |
"MTEITAAMVKELRESTGAGMMDCKNALSETNGDFDKAVQLLREKGLGKAAKKADRLAAEG\n", | |
"LVSVKVSDDFTIAAMRPSYLSYEDLDMTFVENEYKALVAELEKENEERRRLKDPNKPEHK\n", | |
"IPQFASRKQLSDAILKEAEEKIKEELKAQGKPEKIWDNIIPGKMNSFIADNSQLDSKLTL\n", | |
"MGQFYVMDDKKTVEQVIAEKEKEFGGKIKIVEFICFEVGEGLEKKTEDFAAEVAAQL\n", | |
">SEQUENCE_2\n", | |
"SATVSEINSETDFVAKNDQFIALTKDTTAHIQSNSLQSVEELHSSTINGVKFEEYLKSQI\n", | |
"ATIGENLVVRRFATLKAGANGVVNGYIHTNGRVGVVIAAACDSAEVASKSRDLLRQICMH\"\"\")" | |
], | |
"metadata": { | |
"trusted": true | |
}, | |
"execution_count": null, | |
"outputs": [] | |
}, | |
{ | |
"cell_type": "markdown", | |
"source": [ | |
"## GeoJSON" | |
], | |
"metadata": {} | |
}, | |
{ | |
"cell_type": "code", | |
"source": [ | |
"def GeoJSON(data):\n", | |
" bundle = {}\n", | |
" bundle['application/geo+json'] = data\n", | |
" bundle['text/plain'] = data\n", | |
" display(bundle, raw=True)\n", | |
" \n", | |
"GeoJSON({\n", | |
" \"type\": \"Feature\",\n", | |
" \"geometry\": {\n", | |
" \"type\": \"Point\",\n", | |
" \"coordinates\": [125.6, 10.1]\n", | |
" },\n", | |
" \"properties\": {\n", | |
" \"name\": \"Dinagat Islands\"\n", | |
" }\n", | |
"})" | |
], | |
"metadata": { | |
"trusted": true | |
}, | |
"execution_count": null, | |
"outputs": [] | |
} | |
] | |
} |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
jupyterlab==3.1.0rc2 | |
jupyterlab-fasta | |
jupyterlab-geojson |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment