This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/bim/bash | |
echo "This even allows versioning and forking!" |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
P06865 1 M V | |
P06865 39 L R | |
P06865 58 C Y | |
P06865 127 L R | |
P06865 170 R W | |
P06865 178 R H | |
P06865 210 S F | |
P06865 258 D H | |
P06865 451 L V | |
P06865 482 E K |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
>P06865 | |
MTSSRLWFSLLLAAAFAGRATALWPWPQNFQTSDQRYVLYPNNFQFQYDVSSAAQPGCSV | |
LDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQLPTLESVENYTLTI | |
NDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHY | |
LPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVK | |
EVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEF | |
MSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLL | |
DIVSSYGKGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAPW | |
YLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV | |
AERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVGFCEQEFEQT |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
M1V | |
L39R | |
C58Y | |
L127R | |
R170W | |
R178H | |
S210F | |
D258H | |
L451V | |
E482K |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
###Create base file | |
fetch 2gjx | |
select chainA, chain A | |
select rest, not chainA | |
remove rest | |
select firstDomain, resi 1-166 | |
select secondDomain, not firstDomain | |
remove firstDomain | |
zoom secondDomain |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/bin/bash | |
for i in R178H R178C P183L D207E S293I F434L L451V E482K L484Q E506D; do | |
perl prepForSQRWL2.pl -i 2gjxA_sequence -mut $i > SCWRL_$i.sequence | |
done | |
for i in R178H R178C P183L D207E S293I F434L L451V E482K L484Q E506D; do | |
/opt/SS12-Practical/scwrl4/Scwrl4 -s SCWRL_$i.sequence -i ../2gjxA_secondD.pdb -o SCWRL_$i.pdb &>> SCWRL.log | |
done |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/perl | |
use Getopt::Long; | |
our $opt_f = (); | |
sub usage { | |
printf "Usage: $0 [flags] file...\n"; | |
printf "flags:\n"; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
<TITLE>FOLDX_runscript; | |
<JOBSTART>#; | |
<PDBS>#; | |
<BATCH>list.txt; | |
<COMMANDS>FOLDX_commandfile; | |
<BuildModel>#,individual_list.txt; | |
<END>#; | |
<OPTIONS>FOLDX_optionfile; | |
<Temperature>298; | |
<R>#; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/bin/bash | |
ln -sf /opt/SS12-Practical/foldx/rotabase.txt | |
/opt/SS12-Practical/scripts/repairPDB ../preparation/2gjxA_secondD.pdb > 2gjxA_secondD_repaired.pdb | |
/opt/SS12-Practical/foldx/FoldX.linux64 -runfile run.txt |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
RA178H; | |
RA178C; | |
PA182L; | |
DA207E; | |
SA293I; | |
FA434L; | |
LA451V; | |
EA482K; | |
LA484Q; | |
EA506D; |
OlderNewer