Created
November 30, 2022 07:03
-
-
Save MonoidMusician/0d7548c6bd6a606110b3c4c7d9c765f8 to your computer and use it in GitHub Desktop.
times in milliseconds, negative numbers for package versions that failed to solve
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
{ | |
"abc-parser@1.1.2": | |
300, | |
"abc-parser@1.2.0": | |
537, | |
"abc-parser@1.2.1": | |
513, | |
"abc-parser@1.3.0": | |
398, | |
"abc-parser@1.4.0": | |
536, | |
"abc-parser@1.5.0": | |
391, | |
"abc-parser@1.6.0": | |
383, | |
"abc-parser@1.6.1": | |
384, | |
"abc-parser@1.6.2": | |
389, | |
"abc-parser@1.7.0": | |
384, | |
"abc-parser@1.8.0": | |
328, | |
"abc-parser@1.9.0": | |
422, | |
"abc-parser@1.9.1": | |
319, | |
"abc-parser@1.9.2": | |
316, | |
"abc-parser@1.9.3": | |
320, | |
"abc-parser@2.0.0": | |
115, | |
"abides@0.0.0": | |
172, | |
"abides@0.0.1": | |
93, | |
"abstract-database@0.0.1": | |
171, | |
"abstract-database@0.0.2": | |
167, | |
"abstract-database@0.0.3": | |
166, | |
"abstract-database@0.0.4": | |
164, | |
"abstract-database@0.0.5": | |
166, | |
"abstract-database@0.0.6": | |
167, | |
"abstract-database@0.0.8": | |
302, | |
"abstract-database@0.0.9": | |
160, | |
"abstract-database@0.0.10": | |
167, | |
"abstract-database@0.0.11": | |
168, | |
"abstract-database@0.0.12": | |
169, | |
"abstract-database@0.0.13": | |
232, | |
"abstract-database@0.0.14": | |
-246, | |
"abstract-database@0.0.15": | |
-336, | |
"abstract-database@0.0.16": | |
-237, | |
"abstract-database@0.0.17": | |
-239, | |
"abstract-database@0.0.18": | |
-238, | |
"abstract-database@0.0.19": | |
-239, | |
"abstract-database@0.0.20": | |
-242, | |
"accounting@0.1.0": | |
59, | |
"accounting@0.2.0": | |
73, | |
"accounting@0.4.0": | |
121, | |
"ace@0.1.0": | |
79, | |
"ace@0.2.0": | |
98, | |
"ace@0.3.0": | |
126, | |
"ace@0.4.0": | |
120, | |
"ace@0.8.0": | |
112, | |
"ace@0.8.1": | |
114, | |
"ace@0.9.0": | |
179, | |
"ace@0.10.0": | |
92, | |
"ace@0.10.1": | |
99, | |
"ace@0.11.0": | |
97, | |
"ace@0.11.1": | |
97, | |
"ace@1.0.0": | |
185, | |
"ace@2.0.0": | |
-208, | |
"ace@3.0.0": | |
411, | |
"ace@4.0.0": | |
518, | |
"ace@5.0.0": | |
194, | |
"ace@6.0.0": | |
192, | |
"ace@7.0.0": | |
200, | |
"ace@7.1.0": | |
300, | |
"ace@8.0.0": | |
141, | |
"ace@9.0.0": | |
115, | |
"ace-halogen@0.1.0": | |
235, | |
"ace-halogen@0.2.0": | |
229, | |
"ace-halogen@0.3.0": | |
199, | |
"ace-halogen@0.4.0": | |
206, | |
"ace-halogen@0.5.0": | |
199, | |
"ace-halogen@0.6.0": | |
329, | |
"ace-halogen@0.7.0": | |
125, | |
"ace-halogen@0.8.0": | |
136, | |
"ace-halogen@0.8.1": | |
136, | |
"ace-halogen@0.9.0": | |
134, | |
"ace-halogen@1.0.0": | |
104, | |
"ace-halogen@2.0.0": | |
102, | |
"ace-halogen@3.0.0": | |
-367, | |
"ace-halogen@4.0.0": | |
-475, | |
"ace-halogen@5.0.0": | |
-518, | |
"ace-halogen@6.0.0": | |
1223, | |
"ace-halogen@7.0.0": | |
883, | |
"ace-halogen-012@0.1.0": | |
230, | |
"ace-halogen-012@0.2.0": | |
308, | |
"ace-halogen-012@0.3.0": | |
190, | |
"ace-halogen-012@0.4.0": | |
197, | |
"ace-halogen-012@0.5.0": | |
200, | |
"ace-halogen-012@0.6.0": | |
200, | |
"ace-halogen-012@0.7.0": | |
137, | |
"ace-halogen-012@0.8.0": | |
135, | |
"ace-halogen-012@0.8.1": | |
135, | |
"ace-halogen-012@0.9.0": | |
257, | |
"ace-halogen-012@1.0.0": | |
91, | |
"ace-halogen-012@2.0.0": | |
109, | |
"ace-halogen-012@3.0.0": | |
-232, | |
"ace-halogen-012@4.0.0": | |
-506, | |
"ace-halogen-012@5.0.0": | |
-525, | |
"ace-halogen-012@6.0.0": | |
1243, | |
"ace-halogen-012@7.0.0": | |
997, | |
"activity-monitor@0.1.0": | |
242, | |
"activity-monitor@0.1.1": | |
249, | |
"activity-monitor@0.1.2": | |
252, | |
"aff@0.1.0": | |
78, | |
"aff@0.2.0": | |
77, | |
"aff@0.2.1": | |
145, | |
"aff@0.3.0": | |
81, | |
"aff@0.4.0": | |
85, | |
"aff@0.5.0": | |
82, | |
"aff@0.5.1": | |
82, | |
"aff@0.5.2": | |
80, | |
"aff@0.5.3": | |
160, | |
"aff@0.5.4": | |
80, | |
"aff@0.5.5": | |
81, | |
"aff@0.5.6": | |
90, | |
"aff@0.6.0": | |
83, | |
"aff@0.7.0": | |
83, | |
"aff@0.8.0": | |
174, | |
"aff@0.9.0": | |
83, | |
"aff@0.9.1": | |
77, | |
"aff@0.9.2": | |
86, | |
"aff@0.10.0": | |
80, | |
"aff@0.10.1": | |
82, | |
"aff@0.11.0": | |
89, | |
"aff@0.11.1": | |
93, | |
"aff@0.11.2": | |
197, | |
"aff@0.11.3": | |
79, | |
"aff@0.12.0": | |
83, | |
"aff@0.13.0": | |
80, | |
"aff@0.13.1": | |
81, | |
"aff@0.14.0": | |
81, | |
"aff@0.14.1": | |
85, | |
"aff@0.14.2": | |
189, | |
"aff@0.15.0": | |
97, | |
"aff@0.16.0": | |
78, | |
"aff@0.16.1": | |
82, | |
"aff@0.16.2": | |
82, | |
"aff@0.17.0": | |
74, | |
"aff@1.0.0": | |
71, | |
"aff@1.1.0": | |
74, | |
"aff@2.0.0": | |
266, | |
"aff@2.0.1": | |
132, | |
"aff@2.0.2": | |
-108, | |
"aff@2.0.3": | |
134, | |
"aff@3.0.0": | |
248, | |
"aff@3.1.0": | |
312, | |
"aff@4.0.0": | |
336, | |
"aff@4.0.1": | |
337, | |
"aff@4.0.2": | |
429, | |
"aff@4.1.0": | |
326, | |
"aff@4.1.1": | |
340, | |
"aff@5.0.0": | |
156, | |
"aff@5.0.1": | |
240, | |
"aff@5.0.2": | |
151, | |
"aff@5.1.0": | |
150, | |
"aff@5.1.1": | |
157, | |
"aff@5.1.2": | |
159, | |
"aff@6.0.0": | |
101, | |
"aff@7.0.0": | |
87, | |
"aff@7.1.0": | |
90, | |
"aff-bus@1.0.0": | |
361, | |
"aff-bus@2.0.0": | |
412, | |
"aff-bus@3.0.0": | |
450, | |
"aff-bus@3.0.1": | |
448, | |
"aff-bus@3.1.0": | |
442, | |
"aff-bus@4.0.0": | |
259, | |
"aff-bus@5.0.0": | |
125, | |
"aff-bus@5.0.1": | |
127, | |
"aff-bus@6.0.0": | |
194, | |
"aff-cache@0.1.0": | |
389, | |
"aff-coroutines@0.1.0": | |
82, | |
"aff-coroutines@0.1.1": | |
87, | |
"aff-coroutines@0.2.0": | |
87, | |
"aff-coroutines@0.2.1": | |
84, | |
"aff-coroutines@0.3.0": | |
177, | |
"aff-coroutines@0.4.0": | |
92, | |
"aff-coroutines@0.4.1": | |
91, | |
"aff-coroutines@0.4.2": | |
90, | |
"aff-coroutines@0.5.0": | |
94, | |
"aff-coroutines@0.6.0": | |
91, | |
"aff-coroutines@0.6.1": | |
91, | |
"aff-coroutines@1.0.0": | |
73, | |
"aff-coroutines@2.0.0": | |
153, | |
"aff-coroutines@3.0.0": | |
84, | |
"aff-coroutines@4.0.0": | |
185, | |
"aff-coroutines@5.0.0": | |
282, | |
"aff-coroutines@6.0.0": | |
310, | |
"aff-coroutines@7.0.0": | |
298, | |
"aff-coroutines@8.0.0": | |
248, | |
"aff-coroutines@9.0.0": | |
109, | |
"aff-free@0.1.0": | |
99, | |
"aff-free@0.1.1": | |
100, | |
"aff-free@0.1.2": | |
98, | |
"aff-free@1.0.0": | |
80, | |
"aff-free@2.0.0": | |
356, | |
"aff-free@3.0.0": | |
350, | |
"aff-future@1.0.0": | |
369, | |
"aff-future@2.0.0": | |
290, | |
"aff-parallel@0.1.0": | |
169, | |
"aff-parallel@0.1.1": | |
170, | |
"aff-promise@0.2.1": | |
72, | |
"aff-promise@0.3.0": | |
195, | |
"aff-promise@0.4.0": | |
283, | |
"aff-promise@0.5.0": | |
387, | |
"aff-promise@0.6.0": | |
445, | |
"aff-promise@0.7.0": | |
443, | |
"aff-promise@1.0.0": | |
457, | |
"aff-promise@2.0.0": | |
273, | |
"aff-promise@2.0.1": | |
278, | |
"aff-promise@2.1.0": | |
280, | |
"aff-promise@3.0.0": | |
221, | |
"aff-promise@4.0.0": | |
98, | |
"aff-reattempt@0.1.0": | |
95, | |
"aff-reattempt@0.2.0": | |
92, | |
"aff-reattempt@0.2.1": | |
90, | |
"aff-reattempt@0.3.0": | |
89, | |
"aff-reattempt@1.0.0": | |
72, | |
"aff-reattempt@2.0.0": | |
182, | |
"aff-reattempt@3.0.0": | |
660, | |
"aff-reattempt@4.0.0": | |
434, | |
"aff-reattempt@5.0.0": | |
276, | |
"aff-retry@1.0.0": | |
349, | |
"aff-retry@1.0.1": | |
351, | |
"aff-retry@1.1.0": | |
352, | |
"aff-retry@1.2.0": | |
211, | |
"aff-retry@1.2.1": | |
427, | |
"aff-retry@2.0.0": | |
90, | |
"aff-throttler@0.0.1": | |
295, | |
"aff-throttler@0.0.2": | |
297, | |
"affjax@0.1.0": | |
-77, | |
"affjax@0.2.0": | |
-84, | |
"affjax@0.2.1": | |
-77, | |
"affjax@0.3.0": | |
-84, | |
"affjax@0.3.1": | |
-170, | |
"affjax@0.3.2": | |
-83, | |
"affjax@0.4.0": | |
108, | |
"affjax@0.5.0": | |
100, | |
"affjax@0.5.1": | |
101, | |
"affjax@0.5.2": | |
106, | |
"affjax@0.5.3": | |
114, | |
"affjax@0.5.4": | |
104, | |
"affjax@0.6.0": | |
240, | |
"affjax@0.7.0": | |
93, | |
"affjax@0.8.0": | |
117, | |
"affjax@0.8.1": | |
113, | |
"affjax@0.9.0": | |
109, | |
"affjax@0.10.0": | |
125, | |
"affjax@0.10.1": | |
126, | |
"affjax@0.10.2": | |
127, | |
"affjax@0.10.3": | |
209, | |
"affjax@0.10.4": | |
123, | |
"affjax@0.11.0": | |
127, | |
"affjax@0.12.0": | |
124, | |
"affjax@0.13.0": | |
121, | |
"affjax@0.13.1": | |
211, | |
"affjax@0.13.2": | |
97, | |
"affjax@1.0.0": | |
76, | |
"affjax@1.1.0": | |
82, | |
"affjax@1.2.0": | |
86, | |
"affjax@2.0.0": | |
-202, | |
"affjax@2.0.1": | |
-197, | |
"affjax@3.0.0": | |
-358, | |
"affjax@3.0.1": | |
-482, | |
"affjax@3.0.2": | |
-362, | |
"affjax@4.0.0": | |
456, | |
"affjax@5.0.0": | |
465, | |
"affjax@6.0.0": | |
324, | |
"affjax@6.0.1": | |
321, | |
"affjax@7.0.0": | |
340, | |
"affjax@7.0.1": | |
441, | |
"affjax@7.0.2": | |
330, | |
"affjax@8.0.0": | |
333, | |
"affjax@9.0.0": | |
325, | |
"affjax@9.0.1": | |
322, | |
"affjax@10.0.0": | |
323, | |
"affjax@10.1.0": | |
328, | |
"affjax@11.0.0": | |
408, | |
"affjax@12.0.0": | |
130, | |
"affjax@13.0.0": | |
120, | |
"affjax-algebra@0.1.0": | |
134, | |
"affjax-algebra@1.0.0": | |
101, | |
"affjax-algebra@2.0.0": | |
-410, | |
"affjax-algebra@3.0.0": | |
-601, | |
"affjax-algebra@4.0.0": | |
906, | |
"affjax-algebra@5.0.0": | |
833, | |
"affjax-node@1.0.0": | |
140, | |
"affjax-web@1.0.0": | |
141, | |
"airconsole@0.1.0": | |
144, | |
"airconsole@0.1.1": | |
76, | |
"airconsole@0.2.0": | |
63, | |
"airconsole@0.3.0": | |
402, | |
"airconsole@0.3.1": | |
378, | |
"airconsole-controls@0.1.0": | |
453, | |
"airconsole-controls@0.1.1": | |
492, | |
"airconsole-controls@0.1.2": | |
598, | |
"airconsole-view-manager@0.1.0": | |
56, | |
"airconsole-view-manager@0.1.1": | |
73, | |
"airconsole-view-manager@0.1.2": | |
529, | |
"airconsole-view-manager@0.1.3": | |
517, | |
"alert@0.0.1": | |
57, | |
"alert@0.0.2": | |
77, | |
"alert@0.0.3": | |
61, | |
"alexa@0.0.1": | |
534, | |
"alexa@0.0.2": | |
355, | |
"alexa@0.0.3": | |
363, | |
"alexa@0.0.4": | |
366, | |
"alexa@0.0.5": | |
368, | |
"alexa@0.0.6": | |
370, | |
"alexa@0.1.0": | |
453, | |
"alexa@0.1.1": | |
568, | |
"alexa@0.1.2": | |
433, | |
"alexa@0.1.3": | |
443, | |
"alexa@0.1.4": | |
448, | |
"alexa@0.2.0": | |
453, | |
"alexa@0.3.0": | |
450, | |
"alexa@0.4.0": | |
219, | |
"alexa@0.4.1": | |
297, | |
"alexa@0.4.3": | |
236, | |
"almost@0.0.1": | |
47, | |
"almost@0.0.2": | |
74, | |
"alphasucc@0.1.0": | |
60, | |
"amazons@1.0.0": | |
186, | |
"amazons@1.0.1": | |
175, | |
"amqp@1.0.0": | |
585, | |
"angle@0.1.0": | |
122, | |
"annoy@0.0.1": | |
377, | |
"annoy@0.1.0": | |
328, | |
"annoy@0.1.1": | |
321, | |
"ansi@0.1.3": | |
67, | |
"ansi@1.0.0": | |
69, | |
"ansi@2.0.0": | |
81, | |
"ansi@3.0.0": | |
440, | |
"ansi@4.0.0": | |
318, | |
"ansi@5.0.0": | |
120, | |
"ansi@6.0.0": | |
94, | |
"ansi@6.1.0": | |
94, | |
"ansi@7.0.0": | |
87, | |
"apexcharts@0.4.1": | |
184, | |
"api-helpers@0.1.0": | |
99, | |
"api-helpers@0.11.0": | |
715, | |
"api-helpers@1.0.0": | |
73, | |
"api-helpers@1.1.0": | |
-398, | |
"api-helpers@1.2.0": | |
-398, | |
"api-helpers@1.2.1": | |
-395, | |
"api-helpers@1.2.2": | |
-400, | |
"api-helpers@1.2.3": | |
-398, | |
"applicative-lists@0.1.0": | |
157, | |
"apply-algebra@0.1.0": | |
45, | |
"apply-algebra@0.2.0": | |
80, | |
"argonaut@0.0.6": | |
-91, | |
"argonaut@0.1.0": | |
-83, | |
"argonaut@0.1.1": | |
-90, | |
"argonaut@0.1.2": | |
-85, | |
"argonaut@0.2.0": | |
-143, | |
"argonaut@0.2.1": | |
-79, | |
"argonaut@0.2.2": | |
-86, | |
"argonaut@0.2.3": | |
-81, | |
"argonaut@0.2.4": | |
-80, | |
"argonaut@0.2.5": | |
-165, | |
"argonaut@0.2.6": | |
-78, | |
"argonaut@0.2.7": | |
-67, | |
"argonaut@0.2.8": | |
-81, | |
"argonaut@0.2.9": | |
-85, | |
"argonaut@0.2.10": | |
-80, | |
"argonaut@0.2.11": | |
-85, | |
"argonaut@0.3.0": | |
-81, | |
"argonaut@0.4.0": | |
188, | |
"argonaut@0.5.0": | |
86, | |
"argonaut@0.6.0": | |
91, | |
"argonaut@0.8.0": | |
-92, | |
"argonaut@0.9.0": | |
-125, | |
"argonaut@0.10.0": | |
156, | |
"argonaut@0.11.0": | |
168, | |
"argonaut@0.12.0": | |
158, | |
"argonaut@1.0.0": | |
167, | |
"argonaut@2.0.0": | |
422, | |
"argonaut@3.0.0": | |
543, | |
"argonaut@3.1.0": | |
833, | |
"argonaut@4.0.0": | |
317, | |
"argonaut@4.0.1": | |
317, | |
"argonaut@5.0.0": | |
366, | |
"argonaut@6.0.0": | |
552, | |
"argonaut@7.0.0": | |
340, | |
"argonaut@8.0.0": | |
129, | |
"argonaut@9.0.0": | |
119, | |
"argonaut-aeson-generic@0.1.0": | |
723, | |
"argonaut-aeson-generic@0.2.0": | |
408, | |
"argonaut-aeson-generic@0.3.0": | |
413, | |
"argonaut-codecs@0.1.0": | |
84, | |
"argonaut-codecs@0.2.0": | |
179, | |
"argonaut-codecs@0.3.0": | |
88, | |
"argonaut-codecs@0.4.0": | |
108, | |
"argonaut-codecs@0.4.1": | |
101, | |
"argonaut-codecs@0.5.0": | |
102, | |
"argonaut-codecs@0.5.1": | |
205, | |
"argonaut-codecs@0.5.2": | |
85, | |
"argonaut-codecs@0.6.0": | |
103, | |
"argonaut-codecs@0.6.1": | |
100, | |
"argonaut-codecs@1.0.0": | |
79, | |
"argonaut-codecs@1.1.0": | |
77, | |
"argonaut-codecs@2.0.0": | |
238, | |
"argonaut-codecs@2.1.0": | |
293, | |
"argonaut-codecs@3.0.0": | |
239, | |
"argonaut-codecs@3.0.1": | |
308, | |
"argonaut-codecs@3.1.0": | |
310, | |
"argonaut-codecs@3.2.0": | |
443, | |
"argonaut-codecs@3.3.0": | |
311, | |
"argonaut-codecs@4.0.0": | |
171, | |
"argonaut-codecs@4.0.1": | |
168, | |
"argonaut-codecs@4.0.2": | |
264, | |
"argonaut-codecs@5.0.0": | |
142, | |
"argonaut-codecs@5.1.0": | |
153, | |
"argonaut-codecs@5.1.1": | |
163, | |
"argonaut-codecs@5.1.2": | |
162, | |
"argonaut-codecs@5.1.3": | |
194, | |
"argonaut-codecs@6.0.0": | |
263, | |
"argonaut-codecs@6.0.1": | |
173, | |
"argonaut-codecs@6.0.2": | |
166, | |
"argonaut-codecs@6.1.0": | |
181, | |
"argonaut-codecs@7.0.0": | |
147, | |
"argonaut-codecs@8.0.0": | |
111, | |
"argonaut-codecs@8.1.0": | |
114, | |
"argonaut-codecs@9.0.0": | |
103, | |
"argonaut-codecs@9.1.0": | |
213, | |
"argonaut-core@0.1.0": | |
66, | |
"argonaut-core@0.2.0": | |
77, | |
"argonaut-core@0.2.1": | |
91, | |
"argonaut-core@0.2.2": | |
87, | |
"argonaut-core@0.2.3": | |
87, | |
"argonaut-core@1.0.0": | |
76, | |
"argonaut-core@1.1.0": | |
79, | |
"argonaut-core@2.0.0": | |
293, | |
"argonaut-core@2.0.1": | |
155, | |
"argonaut-core@3.0.0": | |
269, | |
"argonaut-core@3.1.0": | |
205, | |
"argonaut-core@3.1.1": | |
265, | |
"argonaut-core@4.0.0": | |
140, | |
"argonaut-core@4.0.1": | |
137, | |
"argonaut-core@5.0.0": | |
224, | |
"argonaut-core@5.0.1": | |
130, | |
"argonaut-core@5.0.2": | |
142, | |
"argonaut-core@5.1.0": | |
138, | |
"argonaut-core@6.0.0": | |
104, | |
"argonaut-core@7.0.0": | |
194, | |
"argonaut-generic@1.0.0": | |
952, | |
"argonaut-generic@1.1.0": | |
368, | |
"argonaut-generic@1.2.0": | |
371, | |
"argonaut-generic@2.0.0": | |
207, | |
"argonaut-generic@2.1.0": | |
228, | |
"argonaut-generic@3.0.0": | |
227, | |
"argonaut-generic@4.0.0": | |
341, | |
"argonaut-generic@5.0.0": | |
220, | |
"argonaut-generic@6.0.0": | |
198, | |
"argonaut-generic@7.0.0": | |
128, | |
"argonaut-generic@7.0.1": | |
130, | |
"argonaut-generic@8.0.0": | |
113, | |
"argonaut-generic-codecs@1.0.0": | |
76, | |
"argonaut-generic-codecs@2.0.0": | |
162, | |
"argonaut-generic-codecs@3.0.0": | |
70, | |
"argonaut-generic-codecs@3.0.1": | |
65, | |
"argonaut-generic-codecs@4.0.0": | |
195, | |
"argonaut-generic-codecs@5.0.0": | |
181, | |
"argonaut-generic-codecs@5.1.0": | |
172, | |
"argonaut-generic-codecs@5.2.0": | |
173, | |
"argonaut-generic-codecs@6.0.0": | |
384, | |
"argonaut-generic-codecs@6.0.1": | |
265, | |
"argonaut-generic-codecs@6.0.2": | |
275, | |
"argonaut-generic-codecs@6.0.3": | |
240, | |
"argonaut-generic-codecs@6.0.4": | |
455, | |
"argonaut-traversals@0.2.0": | |
103, | |
"argonaut-traversals@0.3.0": | |
211, | |
"argonaut-traversals@0.4.0": | |
122, | |
"argonaut-traversals@0.5.0": | |
123, | |
"argonaut-traversals@0.6.0": | |
134, | |
"argonaut-traversals@0.7.0": | |
130, | |
"argonaut-traversals@1.0.0": | |
86, | |
"argonaut-traversals@2.0.0": | |
351, | |
"argonaut-traversals@2.0.1": | |
-420, | |
"argonaut-traversals@3.0.0": | |
626, | |
"argonaut-traversals@3.1.0": | |
447, | |
"argonaut-traversals@4.0.0": | |
241, | |
"argonaut-traversals@4.0.1": | |
239, | |
"argonaut-traversals@4.1.0": | |
235, | |
"argonaut-traversals@5.0.0": | |
257, | |
"argonaut-traversals@6.0.0": | |
378, | |
"argonaut-traversals@7.0.0": | |
284, | |
"argonaut-traversals@8.0.0": | |
255, | |
"argonaut-traversals@9.0.0": | |
108, | |
"argonaut-traversals@10.0.0": | |
98, | |
"argparse-basic@1.0.0": | |
116, | |
"argparse-basic@2.0.0": | |
90, | |
"array-builder@0.1.2": | |
84, | |
"array-search@0.2.0": | |
271, | |
"array-search@0.3.0": | |
58, | |
"array-search@0.3.1": | |
75, | |
"array-views@0.0.1": | |
101, | |
"array-views@0.0.2": | |
102, | |
"arraybuffer@2.0.0": | |
57, | |
"arraybuffer@3.0.0": | |
82, | |
"arraybuffer@4.0.0": | |
70, | |
"arraybuffer@5.0.0": | |
142, | |
"arraybuffer@5.0.1": | |
60, | |
"arraybuffer@6.0.0": | |
87, | |
"arraybuffer@7.0.0": | |
472, | |
"arraybuffer@7.1.0": | |
2137, | |
"arraybuffer@8.0.0": | |
675, | |
"arraybuffer@8.0.2": | |
544, | |
"arraybuffer@8.0.3": | |
196, | |
"arraybuffer@9.0.0": | |
646, | |
"arraybuffer@10.0.0": | |
196, | |
"arraybuffer@10.0.1": | |
175, | |
"arraybuffer@10.0.2": | |
177, | |
"arraybuffer@11.0.0": | |
-243, | |
"arraybuffer@11.0.1": | |
196, | |
"arraybuffer@11.0.2": | |
82, | |
"arraybuffer@11.0.3": | |
95, | |
"arraybuffer@12.0.0": | |
95, | |
"arraybuffer@13.0.0": | |
91, | |
"arraybuffer-builder@1.0.0": | |
270, | |
"arraybuffer-builder@1.1.0": | |
360, | |
"arraybuffer-builder@2.0.0": | |
95, | |
"arraybuffer-builder@2.1.0": | |
95, | |
"arraybuffer-builder@3.0.0": | |
97, | |
"arraybuffer-builder@3.0.1": | |
92, | |
"arraybuffer-class@0.0.0": | |
275, | |
"arraybuffer-class@0.1.0": | |
236, | |
"arraybuffer-class@0.2.0": | |
233, | |
"arraybuffer-class@0.2.1": | |
374, | |
"arraybuffer-class@0.2.2": | |
221, | |
"arraybuffer-class@0.2.3": | |
230, | |
"arraybuffer-class@0.2.4": | |
-424, | |
"arraybuffer-class@0.2.5": | |
-420, | |
"arraybuffer-class@0.2.6": | |
-428, | |
"arraybuffer-types@0.2.0": | |
56, | |
"arraybuffer-types@1.0.0": | |
141, | |
"arraybuffer-types@2.0.0": | |
59, | |
"arraybuffer-types@3.0.0": | |
62, | |
"arraybuffer-types@3.0.1": | |
67, | |
"arraybuffer-types@3.0.2": | |
65, | |
"arrays@0.2.0": | |
68, | |
"arrays@0.2.1": | |
69, | |
"arrays@0.3.0": | |
69, | |
"arrays@0.3.1": | |
93, | |
"arrays@0.3.2": | |
112, | |
"arrays@0.3.3": | |
44, | |
"arrays@0.3.4": | |
72, | |
"arrays@0.3.5": | |
67, | |
"arrays@0.3.6": | |
69, | |
"arrays@0.3.7": | |
69, | |
"arrays@0.4.0": | |
83, | |
"arrays@0.4.1": | |
90, | |
"arrays@0.4.2": | |
137, | |
"arrays@0.4.3": | |
74, | |
"arrays@0.4.4": | |
79, | |
"arrays@0.4.5": | |
73, | |
"arrays@1.0.0": | |
67, | |
"arrays@1.1.0": | |
73, | |
"arrays@2.0.0": | |
90, | |
"arrays@3.0.0": | |
161, | |
"arrays@3.0.1": | |
66, | |
"arrays@3.1.0": | |
84, | |
"arrays@3.2.0": | |
81, | |
"arrays@3.2.1": | |
84, | |
"arrays@4.0.0": | |
100, | |
"arrays@4.0.1": | |
95, | |
"arrays@4.1.0": | |
174, | |
"arrays@4.1.1": | |
89, | |
"arrays@4.1.2": | |
102, | |
"arrays@4.2.0": | |
99, | |
"arrays@4.2.1": | |
96, | |
"arrays@4.2.2": | |
94, | |
"arrays@4.3.0": | |
182, | |
"arrays@4.4.0": | |
88, | |
"arrays@5.0.0": | |
71, | |
"arrays@5.1.0": | |
89, | |
"arrays@5.1.1": | |
79, | |
"arrays@5.2.0": | |
84, | |
"arrays@5.2.1": | |
84, | |
"arrays@5.3.0": | |
84, | |
"arrays@5.3.1": | |
162, | |
"arrays@6.0.0": | |
76, | |
"arrays@6.0.1": | |
68, | |
"arrays@7.0.0": | |
81, | |
"arrays@7.1.0": | |
80, | |
"arrays-zipper@1.0.0": | |
86, | |
"arrays-zipper@1.0.1": | |
340, | |
"arrays-zipper@1.1.0": | |
327, | |
"arrays-zipper@1.1.1": | |
264, | |
"arrays-zipper@2.0.0": | |
3945, | |
"arrays-zipper@2.0.1": | |
97, | |
"arrows@0.2.0": | |
68, | |
"arrows@0.3.0": | |
74, | |
"arrows@0.4.0": | |
74, | |
"arrows@0.5.0": | |
78, | |
"arrows@0.6.0": | |
127, | |
"arrows@0.6.1": | |
73, | |
"arrows@0.6.2": | |
50, | |
"ask@1.0.0": | |
69, | |
"aspen@0.0.1": | |
86, | |
"assert@0.1.0": | |
64, | |
"assert@0.1.1": | |
67, | |
"assert@1.0.0": | |
71, | |
"assert@2.0.0": | |
72, | |
"assert@3.0.0": | |
133, | |
"assert@3.1.0": | |
50, | |
"assert@4.0.0": | |
68, | |
"assert@4.1.0": | |
65, | |
"assert@5.0.0": | |
78, | |
"assert@6.0.0": | |
64, | |
"assert-multiple@0.2.0": | |
229, | |
"assert-multiple@0.2.1": | |
76, | |
"assertion-error@0.1.0": | |
92, | |
"assertion-error@0.1.1": | |
112, | |
"assertion-error@0.1.2": | |
43, | |
"assertion-error@0.1.3": | |
69, | |
"assertion-error@0.1.4": | |
69, | |
"assertion-error@0.1.5": | |
67, | |
"assertions-deepdiff@0.1.0": | |
-464, | |
"asyncstorage-free@0.1.0": | |
473, | |
"asyncstorage-free@0.1.1": | |
581, | |
"atomic-react@0.0.2": | |
50, | |
"atomic-react@0.0.3": | |
57, | |
"atomic-react@0.0.4": | |
74, | |
"atomic-react@0.0.5": | |
60, | |
"atomic-react@0.1.0": | |
75, | |
"atomic-react@0.1.1": | |
66, | |
"atomic-react@0.1.2": | |
71, | |
"atomic-react@0.2.0": | |
91, | |
"atomic-react@0.3.0": | |
169, | |
"atomic-react@0.4.0": | |
91, | |
"atomic-react@0.4.1": | |
111, | |
"atomic-react@0.4.2": | |
109, | |
"atomic-react@0.4.3": | |
107, | |
"atomic-react@0.5.0": | |
111, | |
"atomic-react@0.6.0": | |
69, | |
"atomic-react@0.7.0": | |
62, | |
"atomic-react@0.7.1": | |
129, | |
"atomic-react@1.0.0": | |
46, | |
"atomic-react@1.1.0": | |
61, | |
"audiograph@0.2.0": | |
783, | |
"audiograph@0.2.1": | |
725, | |
"aui@0.1.0": | |
-725, | |
"aui@0.1.1": | |
-635, | |
"autocomplete@1.0.3": | |
-103, | |
"autocomplete@1.0.4": | |
-120, | |
"autocomplete@1.1.0": | |
-117, | |
"autocomplete@1.1.1": | |
-112, | |
"autocomplete@1.2.0": | |
-111, | |
"autocomplete@1.2.1": | |
-111, | |
"autocomplete@1.2.2": | |
-227, | |
"autocomplete@1.3.0": | |
-92, | |
"autocomplete@1.3.1": | |
-97, | |
"autocomplete@2.0.0": | |
-109, | |
"autocomplete@2.1.0": | |
-105, | |
"autocomplete@3.0.0": | |
-449, | |
"autocomplete@4.0.0": | |
537, | |
"autocomplete@4.0.1": | |
643, | |
"autocomplete@5.0.0": | |
271, | |
"autocomplete@5.0.1": | |
273, | |
"autocomplete@6.0.0": | |
283, | |
"automata@0.1.0": | |
76, | |
"automata@0.2.0": | |
105, | |
"avar@1.0.0": | |
78, | |
"avar@1.0.1": | |
83, | |
"avar@2.0.0": | |
166, | |
"avar@2.0.1": | |
72, | |
"avar@3.0.0": | |
224, | |
"avar@4.0.0": | |
121, | |
"avar@5.0.0": | |
108, | |
"aws-acm@0.0.1": | |
586, | |
"aws-acm@0.0.2": | |
658, | |
"aws-acm@0.0.3": | |
556, | |
"aws-acm@0.1.1": | |
594, | |
"aws-acm@0.1.2": | |
734, | |
"aws-acm@0.2.1": | |
551, | |
"aws-acm@0.3.1": | |
559, | |
"aws-alexaforbusiness@0.0.1": | |
573, | |
"aws-alexaforbusiness@0.0.2": | |
568, | |
"aws-alexaforbusiness@0.0.3": | |
567, | |
"aws-alexaforbusiness@0.1.1": | |
570, | |
"aws-alexaforbusiness@0.1.2": | |
726, | |
"aws-alexaforbusiness@0.2.1": | |
547, | |
"aws-alexaforbusiness@0.3.1": | |
553, | |
"aws-apigateway@0.0.1": | |
565, | |
"aws-apigateway@0.0.2": | |
573, | |
"aws-apigateway@0.0.3": | |
570, | |
"aws-apigateway@0.1.1": | |
568, | |
"aws-apigateway@0.1.2": | |
706, | |
"aws-apigateway@0.2.1": | |
549, | |
"aws-apigateway@0.3.1": | |
547, | |
"aws-applicationautoscaling@0.0.1": | |
565, | |
"aws-applicationautoscaling@0.0.2": | |
571, | |
"aws-applicationautoscaling@0.0.3": | |
567, | |
"aws-applicationautoscaling@0.1.1": | |
574, | |
"aws-applicationautoscaling@0.1.2": | |
675, | |
"aws-applicationautoscaling@0.2.1": | |
547, | |
"aws-applicationautoscaling@0.3.1": | |
546, | |
"aws-appstream@0.0.1": | |
564, | |
"aws-appstream@0.0.2": | |
566, | |
"aws-appstream@0.0.3": | |
572, | |
"aws-appstream@0.1.1": | |
566, | |
"aws-appstream@0.1.2": | |
690, | |
"aws-appstream@0.2.1": | |
558, | |
"aws-appstream@0.3.1": | |
546, | |
"aws-appsync@0.0.1": | |
564, | |
"aws-appsync@0.0.2": | |
564, | |
"aws-appsync@0.0.3": | |
565, | |
"aws-appsync@0.1.1": | |
564, | |
"aws-appsync@0.1.2": | |
682, | |
"aws-appsync@0.2.1": | |
556, | |
"aws-appsync@0.3.1": | |
547, | |
"aws-athena@0.0.1": | |
561, | |
"aws-athena@0.0.2": | |
569, | |
"aws-athena@0.0.3": | |
570, | |
"aws-athena@0.1.1": | |
566, | |
"aws-athena@0.1.2": | |
684, | |
"aws-athena@0.2.1": | |
555, | |
"aws-athena@0.3.1": | |
544, | |
"aws-autoscaling@0.0.1": | |
564, | |
"aws-autoscaling@0.0.2": | |
570, | |
"aws-autoscaling@0.0.3": | |
570, | |
"aws-autoscaling@0.1.1": | |
567, | |
"aws-autoscaling@0.1.2": | |
683, | |
"aws-autoscaling@0.2.1": | |
551, | |
"aws-autoscaling@0.3.1": | |
550, | |
"aws-autoscalingplans@0.0.1": | |
560, | |
"aws-autoscalingplans@0.0.2": | |
562, | |
"aws-autoscalingplans@0.0.3": | |
575, | |
"aws-autoscalingplans@0.1.1": | |
578, | |
"aws-autoscalingplans@0.1.2": | |
685, | |
"aws-autoscalingplans@0.2.1": | |
555, | |
"aws-autoscalingplans@0.3.1": | |
545, | |
"aws-batch@0.0.1": | |
567, | |
"aws-batch@0.0.2": | |
561, | |
"aws-batch@0.0.3": | |
570, | |
"aws-batch@0.1.1": | |
566, | |
"aws-batch@0.1.2": | |
696, | |
"aws-batch@0.2.1": | |
548, | |
"aws-batch@0.3.1": | |
542, | |
"aws-budgets@0.0.1": | |
568, | |
"aws-budgets@0.0.2": | |
565, | |
"aws-budgets@0.0.3": | |
566, | |
"aws-budgets@0.1.1": | |
577, | |
"aws-budgets@0.1.2": | |
685, | |
"aws-budgets@0.2.1": | |
550, | |
"aws-budgets@0.3.1": | |
549, | |
"aws-cloud9@0.0.1": | |
565, | |
"aws-cloud9@0.0.2": | |
563, | |
"aws-cloud9@0.0.3": | |
565, | |
"aws-cloud9@0.1.1": | |
566, | |
"aws-cloud9@0.1.2": | |
687, | |
"aws-cloud9@0.2.1": | |
561, | |
"aws-cloud9@0.3.1": | |
543, | |
"aws-clouddirectory@0.0.1": | |
562, | |
"aws-clouddirectory@0.0.2": | |
567, | |
"aws-clouddirectory@0.0.3": | |
575, | |
"aws-clouddirectory@0.1.1": | |
568, | |
"aws-clouddirectory@0.1.2": | |
688, | |
"aws-clouddirectory@0.2.1": | |
551, | |
"aws-clouddirectory@0.3.1": | |
548, | |
"aws-cloudformation@0.0.1": | |
564, | |
"aws-cloudformation@0.0.2": | |
567, | |
"aws-cloudformation@0.0.3": | |
567, | |
"aws-cloudformation@0.1.1": | |
568, | |
"aws-cloudformation@0.1.2": | |
682, | |
"aws-cloudformation@0.2.1": | |
547, | |
"aws-cloudformation@0.3.1": | |
543, | |
"aws-cloudfront@0.0.1": | |
562, | |
"aws-cloudfront@0.0.2": | |
580, | |
"aws-cloudfront@0.0.3": | |
567, | |
"aws-cloudfront@0.1.1": | |
566, | |
"aws-cloudfront@0.1.2": | |
697, | |
"aws-cloudfront@0.2.1": | |
556, | |
"aws-cloudfront@0.3.1": | |
544, | |
"aws-cloudhsm@0.0.1": | |
563, | |
"aws-cloudhsm@0.0.2": | |
564, | |
"aws-cloudhsm@0.0.3": | |
567, | |
"aws-cloudhsm@0.1.1": | |
571, | |
"aws-cloudhsm@0.1.2": | |
686, | |
"aws-cloudhsm@0.2.1": | |
556, | |
"aws-cloudhsm@0.3.1": | |
551, | |
"aws-cloudhsmv2@0.0.1": | |
568, | |
"aws-cloudhsmv2@0.0.2": | |
571, | |
"aws-cloudhsmv2@0.0.3": | |
568, | |
"aws-cloudhsmv2@0.1.1": | |
569, | |
"aws-cloudhsmv2@0.1.2": | |
694, | |
"aws-cloudhsmv2@0.2.1": | |
551, | |
"aws-cloudhsmv2@0.3.1": | |
545, | |
"aws-cloudsearch@0.0.1": | |
562, | |
"aws-cloudsearch@0.0.2": | |
563, | |
"aws-cloudsearch@0.0.3": | |
570, | |
"aws-cloudsearch@0.1.1": | |
566, | |
"aws-cloudsearch@0.1.2": | |
682, | |
"aws-cloudsearch@0.2.1": | |
555, | |
"aws-cloudsearch@0.3.1": | |
553, | |
"aws-cloudsearchdomain@0.0.1": | |
560, | |
"aws-cloudsearchdomain@0.0.2": | |
561, | |
"aws-cloudsearchdomain@0.0.3": | |
563, | |
"aws-cloudsearchdomain@0.1.1": | |
567, | |
"aws-cloudsearchdomain@0.1.2": | |
679, | |
"aws-cloudsearchdomain@0.2.1": | |
549, | |
"aws-cloudsearchdomain@0.3.1": | |
542, | |
"aws-cloudtrail@0.0.1": | |
558, | |
"aws-cloudtrail@0.0.2": | |
570, | |
"aws-cloudtrail@0.0.3": | |
564, | |
"aws-cloudtrail@0.1.1": | |
565, | |
"aws-cloudtrail@0.1.2": | |
689, | |
"aws-cloudtrail@0.2.1": | |
550, | |
"aws-cloudtrail@0.3.1": | |
542, | |
"aws-cloudwatch@0.0.1": | |
562, | |
"aws-cloudwatch@0.0.2": | |
563, | |
"aws-cloudwatch@0.0.3": | |
583, | |
"aws-cloudwatch@0.1.1": | |
567, | |
"aws-cloudwatch@0.1.2": | |
689, | |
"aws-cloudwatch@0.2.1": | |
547, | |
"aws-cloudwatch@0.3.1": | |
541, | |
"aws-cloudwatchevents@0.0.1": | |
562, | |
"aws-cloudwatchevents@0.0.2": | |
561, | |
"aws-cloudwatchevents@0.0.3": | |
564, | |
"aws-cloudwatchevents@0.1.1": | |
561, | |
"aws-cloudwatchevents@0.1.2": | |
677, | |
"aws-cloudwatchevents@0.2.1": | |
549, | |
"aws-cloudwatchevents@0.3.1": | |
542, | |
"aws-cloudwatchlogs@0.0.1": | |
573, | |
"aws-cloudwatchlogs@0.0.2": | |
562, | |
"aws-cloudwatchlogs@0.0.3": | |
565, | |
"aws-cloudwatchlogs@0.1.1": | |
570, | |
"aws-cloudwatchlogs@0.1.2": | |
681, | |
"aws-cloudwatchlogs@0.2.1": | |
556, | |
"aws-cloudwatchlogs@0.3.1": | |
542, | |
"aws-codebuild@0.0.1": | |
559, | |
"aws-codebuild@0.0.2": | |
568, | |
"aws-codebuild@0.0.3": | |
565, | |
"aws-codebuild@0.1.1": | |
564, | |
"aws-codebuild@0.1.2": | |
687, | |
"aws-codebuild@0.2.1": | |
551, | |
"aws-codebuild@0.3.1": | |
542, | |
"aws-codecommit@0.0.1": | |
560, | |
"aws-codecommit@0.0.2": | |
562, | |
"aws-codecommit@0.0.3": | |
575, | |
"aws-codecommit@0.1.1": | |
565, | |
"aws-codecommit@0.1.2": | |
686, | |
"aws-codecommit@0.2.1": | |
548, | |
"aws-codecommit@0.3.1": | |
546, | |
"aws-codedeploy@0.0.1": | |
562, | |
"aws-codedeploy@0.0.2": | |
564, | |
"aws-codedeploy@0.0.3": | |
576, | |
"aws-codedeploy@0.1.1": | |
566, | |
"aws-codedeploy@0.1.2": | |
683, | |
"aws-codedeploy@0.2.1": | |
556, | |
"aws-codedeploy@0.3.1": | |
547, | |
"aws-codepipeline@0.0.1": | |
560, | |
"aws-codepipeline@0.0.2": | |
569, | |
"aws-codepipeline@0.0.3": | |
568, | |
"aws-codepipeline@0.1.1": | |
567, | |
"aws-codepipeline@0.1.2": | |
689, | |
"aws-codepipeline@0.2.1": | |
547, | |
"aws-codepipeline@0.3.1": | |
537, | |
"aws-codestar@0.0.1": | |
563, | |
"aws-codestar@0.0.2": | |
563, | |
"aws-codestar@0.0.3": | |
569, | |
"aws-codestar@0.1.1": | |
567, | |
"aws-codestar@0.1.2": | |
688, | |
"aws-codestar@0.2.1": | |
552, | |
"aws-codestar@0.3.1": | |
543, | |
"aws-cognitoidentity@0.0.1": | |
585, | |
"aws-cognitoidentity@0.0.2": | |
569, | |
"aws-cognitoidentity@0.0.3": | |
572, | |
"aws-cognitoidentity@0.1.1": | |
567, | |
"aws-cognitoidentity@0.1.2": | |
687, | |
"aws-cognitoidentity@0.2.1": | |
548, | |
"aws-cognitoidentity@0.3.1": | |
539, | |
"aws-cognitoidentityserviceprovider@0.0.1": | |
565, | |
"aws-cognitoidentityserviceprovider@0.0.2": | |
563, | |
"aws-cognitoidentityserviceprovider@0.0.3": | |
566, | |
"aws-cognitoidentityserviceprovider@0.1.1": | |
579, | |
"aws-cognitoidentityserviceprovider@0.1.2": | |
684, | |
"aws-cognitoidentityserviceprovider@0.2.1": | |
558, | |
"aws-cognitoidentityserviceprovider@0.3.1": | |
538, | |
"aws-cognitosync@0.0.1": | |
559, | |
"aws-cognitosync@0.0.2": | |
564, | |
"aws-cognitosync@0.0.3": | |
573, | |
"aws-cognitosync@0.1.1": | |
572, | |
"aws-cognitosync@0.1.2": | |
690, | |
"aws-cognitosync@0.2.1": | |
551, | |
"aws-cognitosync@0.3.1": | |
539, | |
"aws-comprehend@0.0.1": | |
565, | |
"aws-comprehend@0.0.2": | |
564, | |
"aws-comprehend@0.0.3": | |
563, | |
"aws-comprehend@0.1.1": | |
573, | |
"aws-comprehend@0.1.2": | |
707, | |
"aws-comprehend@0.2.1": | |
553, | |
"aws-comprehend@0.3.1": | |
552, | |
"aws-configservice@0.0.1": | |
592, | |
"aws-configservice@0.0.2": | |
584, | |
"aws-configservice@0.0.3": | |
567, | |
"aws-configservice@0.1.1": | |
566, | |
"aws-configservice@0.1.2": | |
685, | |
"aws-configservice@0.2.1": | |
553, | |
"aws-configservice@0.3.1": | |
539, | |
"aws-costexplorer@0.0.1": | |
569, | |
"aws-costexplorer@0.0.2": | |
570, | |
"aws-costexplorer@0.0.3": | |
567, | |
"aws-costexplorer@0.1.1": | |
566, | |
"aws-costexplorer@0.1.2": | |
681, | |
"aws-costexplorer@0.2.1": | |
549, | |
"aws-costexplorer@0.3.1": | |
539, | |
"aws-cur@0.0.1": | |
564, | |
"aws-cur@0.0.2": | |
562, | |
"aws-cur@0.0.3": | |
571, | |
"aws-cur@0.1.1": | |
567, | |
"aws-cur@0.1.2": | |
682, | |
"aws-cur@0.2.1": | |
553, | |
"aws-cur@0.3.1": | |
541, | |
"aws-datapipeline@0.0.1": | |
563, | |
"aws-datapipeline@0.0.2": | |
564, | |
"aws-datapipeline@0.0.3": | |
561, | |
"aws-datapipeline@0.1.1": | |
570, | |
"aws-datapipeline@0.1.2": | |
683, | |
"aws-datapipeline@0.2.1": | |
555, | |
"aws-datapipeline@0.3.1": | |
543, | |
"aws-dax@0.0.1": | |
574, | |
"aws-dax@0.0.2": | |
562, | |
"aws-dax@0.0.3": | |
561, | |
"aws-dax@0.1.1": | |
567, | |
"aws-dax@0.1.2": | |
684, | |
"aws-dax@0.2.1": | |
550, | |
"aws-dax@0.3.1": | |
543, | |
"aws-devicefarm@0.0.1": | |
557, | |
"aws-devicefarm@0.0.2": | |
561, | |
"aws-devicefarm@0.0.3": | |
571, | |
"aws-devicefarm@0.1.1": | |
566, | |
"aws-devicefarm@0.1.2": | |
685, | |
"aws-devicefarm@0.2.1": | |
552, | |
"aws-devicefarm@0.3.1": | |
539, | |
"aws-directconnect@0.0.1": | |
569, | |
"aws-directconnect@0.0.2": | |
559, | |
"aws-directconnect@0.0.3": | |
559, | |
"aws-directconnect@0.1.1": | |
568, | |
"aws-directconnect@0.1.2": | |
676, | |
"aws-directconnect@0.2.1": | |
549, | |
"aws-directconnect@0.3.1": | |
540, | |
"aws-directoryservice@0.0.1": | |
556, | |
"aws-directoryservice@0.0.2": | |
561, | |
"aws-directoryservice@0.0.3": | |
568, | |
"aws-directoryservice@0.1.1": | |
602, | |
"aws-directoryservice@0.1.2": | |
682, | |
"aws-directoryservice@0.2.1": | |
551, | |
"aws-directoryservice@0.3.1": | |
543, | |
"aws-discovery@0.0.1": | |
559, | |
"aws-discovery@0.0.2": | |
567, | |
"aws-discovery@0.0.3": | |
560, | |
"aws-discovery@0.1.1": | |
570, | |
"aws-discovery@0.1.2": | |
681, | |
"aws-discovery@0.2.1": | |
551, | |
"aws-discovery@0.3.1": | |
537, | |
"aws-dms@0.0.1": | |
560, | |
"aws-dms@0.0.2": | |
563, | |
"aws-dms@0.0.3": | |
562, | |
"aws-dms@0.1.1": | |
570, | |
"aws-dms@0.1.2": | |
682, | |
"aws-dms@0.2.1": | |
554, | |
"aws-dms@0.3.1": | |
541, | |
"aws-dynamodb@0.0.1": | |
560, | |
"aws-dynamodb@0.0.2": | |
561, | |
"aws-dynamodb@0.0.3": | |
561, | |
"aws-dynamodb@0.1.1": | |
567, | |
"aws-dynamodb@0.1.2": | |
687, | |
"aws-dynamodb@0.2.1": | |
548, | |
"aws-dynamodb@0.3.1": | |
541, | |
"aws-dynamodbstreams@0.0.1": | |
564, | |
"aws-dynamodbstreams@0.0.2": | |
562, | |
"aws-dynamodbstreams@0.0.3": | |
561, | |
"aws-dynamodbstreams@0.1.1": | |
567, | |
"aws-dynamodbstreams@0.1.2": | |
679, | |
"aws-dynamodbstreams@0.2.1": | |
553, | |
"aws-dynamodbstreams@0.3.1": | |
545, | |
"aws-ec2@0.0.1": | |
559, | |
"aws-ec2@0.0.2": | |
569, | |
"aws-ec2@0.0.3": | |
568, | |
"aws-ec2@0.1.1": | |
563, | |
"aws-ec2@0.1.2": | |
688, | |
"aws-ec2@0.2.1": | |
555, | |
"aws-ec2@0.3.1": | |
536, | |
"aws-ecr@0.0.1": | |
559, | |
"aws-ecr@0.0.2": | |
567, | |
"aws-ecr@0.0.3": | |
562, | |
"aws-ecr@0.1.1": | |
576, | |
"aws-ecr@0.1.2": | |
679, | |
"aws-ecr@0.2.1": | |
549, | |
"aws-ecr@0.3.1": | |
541, | |
"aws-ecs@0.0.1": | |
558, | |
"aws-ecs@0.0.2": | |
564, | |
"aws-ecs@0.0.3": | |
571, | |
"aws-ecs@0.1.1": | |
564, | |
"aws-ecs@0.1.2": | |
690, | |
"aws-ecs@0.2.1": | |
546, | |
"aws-ecs@0.3.1": | |
539, | |
"aws-efs@0.0.1": | |
556, | |
"aws-efs@0.0.2": | |
559, | |
"aws-efs@0.0.3": | |
564, | |
"aws-efs@0.1.1": | |
565, | |
"aws-efs@0.1.2": | |
671, | |
"aws-efs@0.2.1": | |
548, | |
"aws-efs@0.3.1": | |
538, | |
"aws-elasticache@0.0.1": | |
557, | |
"aws-elasticache@0.0.2": | |
560, | |
"aws-elasticache@0.1.1": | |
563, | |
"aws-elasticache@0.1.2": | |
563, | |
"aws-elasticache@0.2.1": | |
671, | |
"aws-elasticache@0.3.1": | |
538, | |
"aws-elasticbeanstalk@0.0.1": | |
547, | |
"aws-elasticbeanstalk@0.0.2": | |
559, | |
"aws-elasticbeanstalk@0.1.1": | |
570, | |
"aws-elasticbeanstalk@0.1.2": | |
564, | |
"aws-elasticbeanstalk@0.2.1": | |
564, | |
"aws-elasticbeanstalk@0.3.1": | |
673, | |
"aws-elastictranscoder@0.0.1": | |
553, | |
"aws-elastictranscoder@0.0.2": | |
550, | |
"aws-elastictranscoder@0.1.1": | |
561, | |
"aws-elastictranscoder@0.1.2": | |
563, | |
"aws-elastictranscoder@0.2.1": | |
562, | |
"aws-elastictranscoder@0.3.1": | |
566, | |
"aws-elb@0.0.1": | |
681, | |
"aws-elb@0.0.2": | |
552, | |
"aws-elb@0.1.1": | |
551, | |
"aws-elb@0.1.2": | |
560, | |
"aws-elb@0.2.1": | |
563, | |
"aws-elb@0.3.1": | |
557, | |
"aws-elbv2@0.0.1": | |
562, | |
"aws-elbv2@0.0.2": | |
687, | |
"aws-elbv2@0.1.1": | |
554, | |
"aws-elbv2@0.1.2": | |
546, | |
"aws-elbv2@0.2.1": | |
562, | |
"aws-elbv2@0.3.1": | |
551, | |
"aws-emr@0.0.1": | |
560, | |
"aws-emr@0.0.2": | |
563, | |
"aws-emr@0.1.1": | |
685, | |
"aws-emr@0.1.2": | |
546, | |
"aws-emr@0.2.1": | |
555, | |
"aws-emr@0.3.1": | |
547, | |
"aws-encryption-sdk@0.1.0": | |
455, | |
"aws-encryption-sdk@0.2.0": | |
-350, | |
"aws-es@0.0.1": | |
569, | |
"aws-es@0.0.2": | |
689, | |
"aws-es@0.1.1": | |
550, | |
"aws-es@0.1.2": | |
547, | |
"aws-es@0.2.1": | |
557, | |
"aws-es@0.3.1": | |
555, | |
"aws-firehose@0.0.1": | |
564, | |
"aws-firehose@0.0.2": | |
568, | |
"aws-firehose@0.1.1": | |
693, | |
"aws-firehose@0.1.2": | |
553, | |
"aws-firehose@0.2.1": | |
549, | |
"aws-firehose@0.3.1": | |
564, | |
"aws-gamelift@0.0.1": | |
562, | |
"aws-gamelift@0.0.2": | |
564, | |
"aws-gamelift@0.1.1": | |
565, | |
"aws-gamelift@0.1.2": | |
679, | |
"aws-gamelift@0.2.1": | |
553, | |
"aws-gamelift@0.3.1": | |
534, | |
"aws-glacier@0.0.1": | |
561, | |
"aws-glacier@0.0.2": | |
559, | |
"aws-glacier@0.1.1": | |
631, | |
"aws-glacier@0.1.2": | |
569, | |
"aws-glacier@0.2.1": | |
673, | |
"aws-glacier@0.3.1": | |
535, | |
"aws-glue@0.0.1": | |
548, | |
"aws-glue@0.0.2": | |
561, | |
"aws-glue@0.1.1": | |
561, | |
"aws-glue@0.1.2": | |
561, | |
"aws-glue@0.2.1": | |
565, | |
"aws-glue@0.3.1": | |
682, | |
"aws-greengrass@0.0.1": | |
556, | |
"aws-greengrass@0.0.2": | |
550, | |
"aws-greengrass@0.1.1": | |
562, | |
"aws-greengrass@0.1.2": | |
560, | |
"aws-greengrass@0.2.1": | |
563, | |
"aws-greengrass@0.3.1": | |
553, | |
"aws-guardduty@0.0.1": | |
679, | |
"aws-guardduty@0.0.2": | |
558, | |
"aws-guardduty@0.1.1": | |
552, | |
"aws-guardduty@0.1.2": | |
562, | |
"aws-guardduty@0.2.1": | |
573, | |
"aws-guardduty@0.3.1": | |
563, | |
"aws-health@0.0.1": | |
565, | |
"aws-health@0.0.2": | |
683, | |
"aws-health@0.1.1": | |
553, | |
"aws-health@0.1.2": | |
545, | |
"aws-health@0.2.1": | |
571, | |
"aws-health@0.3.1": | |
550, | |
"aws-iam@0.0.1": | |
570, | |
"aws-iam@0.0.2": | |
564, | |
"aws-iam@0.1.1": | |
681, | |
"aws-iam@0.1.2": | |
548, | |
"aws-iam@0.2.1": | |
547, | |
"aws-iam@0.3.1": | |
553, | |
"aws-importexport@0.0.1": | |
563, | |
"aws-importexport@0.0.2": | |
561, | |
"aws-importexport@0.1.1": | |
565, | |
"aws-importexport@0.1.2": | |
683, | |
"aws-importexport@0.2.1": | |
553, | |
"aws-importexport@0.3.1": | |
534, | |
"aws-inspector@0.0.1": | |
561, | |
"aws-inspector@0.0.2": | |
563, | |
"aws-inspector@0.1.1": | |
561, | |
"aws-inspector@0.1.2": | |
567, | |
"aws-inspector@0.2.1": | |
684, | |
"aws-inspector@0.3.1": | |
549, | |
"aws-iot@0.0.1": | |
550, | |
"aws-iot@0.0.2": | |
558, | |
"aws-iot@0.1.1": | |
562, | |
"aws-iot@0.1.2": | |
561, | |
"aws-iot@0.2.1": | |
571, | |
"aws-iot@0.3.1": | |
669, | |
"aws-iotdata@0.0.1": | |
549, | |
"aws-iotdata@0.0.2": | |
544, | |
"aws-iotdata@0.1.1": | |
560, | |
"aws-iotdata@0.1.2": | |
566, | |
"aws-iotdata@0.2.1": | |
563, | |
"aws-iotdata@0.3.1": | |
551, | |
"aws-iotjobsdataplane@0.0.1": | |
679, | |
"aws-iotjobsdataplane@0.0.2": | |
551, | |
"aws-iotjobsdataplane@0.1.1": | |
550, | |
"aws-iotjobsdataplane@0.1.2": | |
560, | |
"aws-iotjobsdataplane@0.2.1": | |
562, | |
"aws-iotjobsdataplane@0.3.1": | |
559, | |
"aws-kinesis@0.0.1": | |
564, | |
"aws-kinesis@0.0.2": | |
679, | |
"aws-kinesis@0.1.1": | |
553, | |
"aws-kinesis@0.1.2": | |
546, | |
"aws-kinesis@0.2.1": | |
562, | |
"aws-kinesis@0.3.1": | |
550, | |
"aws-kinesisanalytics@0.0.1": | |
570, | |
"aws-kinesisanalytics@0.0.2": | |
565, | |
"aws-kinesisanalytics@0.1.1": | |
691, | |
"aws-kinesisanalytics@0.1.2": | |
550, | |
"aws-kinesisanalytics@0.2.1": | |
546, | |
"aws-kinesisanalytics@0.3.1": | |
562, | |
"aws-kinesisvideo@0.0.1": | |
562, | |
"aws-kinesisvideo@0.0.2": | |
566, | |
"aws-kinesisvideo@0.1.1": | |
573, | |
"aws-kinesisvideo@0.1.2": | |
681, | |
"aws-kinesisvideo@0.2.1": | |
550, | |
"aws-kinesisvideo@0.3.1": | |
543, | |
"aws-kinesisvideoarchivedmedia@0.0.1": | |
560, | |
"aws-kinesisvideoarchivedmedia@0.0.2": | |
561, | |
"aws-kinesisvideoarchivedmedia@0.1.1": | |
564, | |
"aws-kinesisvideoarchivedmedia@0.1.2": | |
571, | |
"aws-kinesisvideoarchivedmedia@0.2.1": | |
680, | |
"aws-kinesisvideoarchivedmedia@0.3.1": | |
541, | |
"aws-kinesisvideomedia@0.0.1": | |
547, | |
"aws-kinesisvideomedia@0.0.2": | |
565, | |
"aws-kinesisvideomedia@0.1.1": | |
562, | |
"aws-kinesisvideomedia@0.1.2": | |
564, | |
"aws-kinesisvideomedia@0.2.1": | |
570, | |
"aws-kinesisvideomedia@0.3.1": | |
679, | |
"aws-kms@0.0.1": | |
548, | |
"aws-kms@0.0.2": | |
550, | |
"aws-kms@0.1.1": | |
566, | |
"aws-kms@0.1.2": | |
562, | |
"aws-kms@0.2.1": | |
570, | |
"aws-kms@0.3.1": | |
553, | |
"aws-lambda@0.0.1": | |
682, | |
"aws-lambda@0.0.2": | |
553, | |
"aws-lambda@0.1.1": | |
547, | |
"aws-lambda@0.1.2": | |
560, | |
"aws-lambda@0.2.1": | |
561, | |
"aws-lambda@0.3.1": | |
556, | |
"aws-lambda-express@1.0.0": | |
591, | |
"aws-lambda-express@1.0.1": | |
709, | |
"aws-lambda-express@1.0.2": | |
567, | |
"aws-lambda-express@2.0.0": | |
505, | |
"aws-lexmodelbuildingservice@0.0.1": | |
563, | |
"aws-lexmodelbuildingservice@0.0.2": | |
560, | |
"aws-lexmodelbuildingservice@0.1.1": | |
562, | |
"aws-lexmodelbuildingservice@0.1.2": | |
564, | |
"aws-lexmodelbuildingservice@0.2.1": | |
702, | |
"aws-lexmodelbuildingservice@0.3.1": | |
541, | |
"aws-lexruntime@0.0.1": | |
549, | |
"aws-lexruntime@0.0.2": | |
560, | |
"aws-lexruntime@0.1.1": | |
562, | |
"aws-lexruntime@0.1.2": | |
560, | |
"aws-lexruntime@0.2.1": | |
565, | |
"aws-lexruntime@0.3.1": | |
692, | |
"aws-lightsail@0.0.1": | |
553, | |
"aws-lightsail@0.0.2": | |
551, | |
"aws-lightsail@0.1.1": | |
567, | |
"aws-lightsail@0.1.2": | |
565, | |
"aws-lightsail@0.2.1": | |
570, | |
"aws-lightsail@0.3.1": | |
653, | |
"aws-machinelearning@0.0.1": | |
550, | |
"aws-machinelearning@0.1.1": | |
548, | |
"aws-machinelearning@0.1.2": | |
559, | |
"aws-machinelearning@0.2.1": | |
565, | |
"aws-machinelearning@0.3.1": | |
556, | |
"aws-marketplacecommerceanalytics@0.0.1": | |
573, | |
"aws-marketplacecommerceanalytics@0.1.1": | |
681, | |
"aws-marketplacecommerceanalytics@0.1.2": | |
583, | |
"aws-marketplacecommerceanalytics@0.2.1": | |
550, | |
"aws-marketplacecommerceanalytics@0.3.1": | |
553, | |
"aws-marketplaceentitlementservice@0.0.1": | |
564, | |
"aws-marketplaceentitlementservice@0.1.1": | |
564, | |
"aws-marketplaceentitlementservice@0.1.2": | |
565, | |
"aws-marketplaceentitlementservice@0.2.1": | |
681, | |
"aws-marketplaceentitlementservice@0.3.1": | |
542, | |
"aws-marketplacemetering@0.0.1": | |
547, | |
"aws-marketplacemetering@0.1.1": | |
560, | |
"aws-marketplacemetering@0.1.2": | |
561, | |
"aws-marketplacemetering@0.2.1": | |
562, | |
"aws-marketplacemetering@0.3.1": | |
555, | |
"aws-mediaconvert@0.0.1": | |
689, | |
"aws-mediaconvert@0.1.1": | |
552, | |
"aws-mediaconvert@0.1.2": | |
555, | |
"aws-mediaconvert@0.2.1": | |
561, | |
"aws-mediaconvert@0.3.1": | |
549, | |
"aws-medialive@0.0.1": | |
563, | |
"aws-medialive@0.1.1": | |
569, | |
"aws-medialive@0.1.2": | |
688, | |
"aws-medialive@0.2.1": | |
553, | |
"aws-medialive@0.3.1": | |
539, | |
"aws-mediapackage@0.0.1": | |
561, | |
"aws-mediapackage@0.1.1": | |
566, | |
"aws-mediapackage@0.1.2": | |
564, | |
"aws-mediapackage@0.2.1": | |
569, | |
"aws-mediapackage@0.3.1": | |
680, | |
"aws-mediastore@0.0.1": | |
554, | |
"aws-mediastore@0.1.1": | |
544, | |
"aws-mediastore@0.1.2": | |
562, | |
"aws-mediastore@0.2.1": | |
560, | |
"aws-mediastore@0.3.1": | |
552, | |
"aws-mediastoredata@0.0.1": | |
576, | |
"aws-mediastoredata@0.1.1": | |
671, | |
"aws-mediastoredata@0.1.2": | |
556, | |
"aws-mediastoredata@0.2.1": | |
548, | |
"aws-mediastoredata@0.3.1": | |
551, | |
"aws-migrationhub@0.0.1": | |
564, | |
"aws-migrationhub@0.1.1": | |
568, | |
"aws-migrationhub@0.1.2": | |
564, | |
"aws-migrationhub@0.2.1": | |
690, | |
"aws-migrationhub@0.3.1": | |
547, | |
"aws-mobile@0.0.1": | |
554, | |
"aws-mobile@0.1.1": | |
562, | |
"aws-mobile@0.1.2": | |
563, | |
"aws-mobile@0.2.1": | |
564, | |
"aws-mobile@0.3.1": | |
556, | |
"aws-mobileanalytics@0.0.1": | |
692, | |
"aws-mobileanalytics@0.1.1": | |
552, | |
"aws-mobileanalytics@0.1.2": | |
556, | |
"aws-mobileanalytics@0.2.1": | |
564, | |
"aws-mobileanalytics@0.3.1": | |
553, | |
"aws-mq@0.0.1": | |
565, | |
"aws-mq@0.1.1": | |
566, | |
"aws-mq@0.1.2": | |
692, | |
"aws-mq@0.2.1": | |
560, | |
"aws-mq@0.3.1": | |
534, | |
"aws-mturk@0.0.1": | |
564, | |
"aws-mturk@0.1.1": | |
565, | |
"aws-mturk@0.1.2": | |
568, | |
"aws-mturk@0.2.1": | |
566, | |
"aws-mturk@0.3.1": | |
677, | |
"aws-opsworks@0.0.1": | |
561, | |
"aws-opsworks@0.1.1": | |
546, | |
"aws-opsworks@0.1.2": | |
570, | |
"aws-opsworks@0.2.1": | |
577, | |
"aws-opsworks@0.3.1": | |
562, | |
"aws-opsworkscm@0.0.1": | |
567, | |
"aws-opsworkscm@0.1.1": | |
681, | |
"aws-opsworkscm@0.1.2": | |
552, | |
"aws-opsworkscm@0.2.1": | |
543, | |
"aws-opsworkscm@0.3.1": | |
550, | |
"aws-organizations@0.0.1": | |
563, | |
"aws-organizations@0.1.1": | |
567, | |
"aws-organizations@0.1.2": | |
565, | |
"aws-organizations@0.2.1": | |
697, | |
"aws-organizations@0.3.1": | |
543, | |
"aws-pinpoint@0.0.1": | |
549, | |
"aws-pinpoint@0.1.1": | |
561, | |
"aws-pinpoint@0.1.2": | |
561, | |
"aws-pinpoint@0.2.1": | |
565, | |
"aws-pinpoint@0.3.1": | |
555, | |
"aws-polly@0.0.1": | |
688, | |
"aws-polly@0.1.1": | |
554, | |
"aws-polly@0.1.2": | |
549, | |
"aws-polly@0.2.1": | |
561, | |
"aws-polly@0.3.1": | |
550, | |
"aws-pricing@0.0.1": | |
565, | |
"aws-pricing@0.1.1": | |
566, | |
"aws-pricing@0.1.2": | |
678, | |
"aws-pricing@0.2.1": | |
562, | |
"aws-pricing@0.3.1": | |
536, | |
"aws-rds@0.0.1": | |
567, | |
"aws-rds@0.1.1": | |
565, | |
"aws-rds@0.1.2": | |
566, | |
"aws-rds@0.2.1": | |
568, | |
"aws-rds@0.3.1": | |
708, | |
"aws-redshift@0.0.1": | |
554, | |
"aws-redshift@0.1.1": | |
558, | |
"aws-redshift@0.1.2": | |
563, | |
"aws-redshift@0.2.1": | |
562, | |
"aws-redshift@0.3.1": | |
559, | |
"aws-rekognition@0.0.1": | |
563, | |
"aws-rekognition@0.1.1": | |
683, | |
"aws-rekognition@0.1.2": | |
556, | |
"aws-rekognition@0.2.1": | |
545, | |
"aws-rekognition@0.3.1": | |
553, | |
"aws-request@0.0.1": | |
486, | |
"aws-request@0.0.2": | |
493, | |
"aws-request@0.0.5": | |
444, | |
"aws-request@0.0.6": | |
566, | |
"aws-request@0.0.7": | |
431, | |
"aws-request@0.0.24": | |
427, | |
"aws-request@0.0.25": | |
439, | |
"aws-request@0.0.26": | |
440, | |
"aws-request@0.0.28": | |
442, | |
"aws-request@0.0.30": | |
441, | |
"aws-request@0.1.0": | |
559, | |
"aws-request@0.1.1": | |
437, | |
"aws-request@0.1.2": | |
421, | |
"aws-request@0.1.3": | |
440, | |
"aws-request@0.1.4": | |
441, | |
"aws-request@0.1.5": | |
442, | |
"aws-request@0.2.1": | |
449, | |
"aws-request@0.2.2": | |
552, | |
"aws-request@0.3.1": | |
429, | |
"aws-request@0.3.2": | |
416, | |
"aws-resourcegroups@0.0.1": | |
561, | |
"aws-resourcegroups@0.1.1": | |
562, | |
"aws-resourcegroups@0.1.2": | |
570, | |
"aws-resourcegroups@0.2.1": | |
566, | |
"aws-resourcegroups@0.3.1": | |
682, | |
"aws-resourcegroupstaggingapi@0.0.1": | |
554, | |
"aws-resourcegroupstaggingapi@0.1.1": | |
544, | |
"aws-resourcegroupstaggingapi@0.1.2": | |
558, | |
"aws-resourcegroupstaggingapi@0.2.1": | |
562, | |
"aws-resourcegroupstaggingapi@0.3.1": | |
555, | |
"aws-route53@0.0.1": | |
566, | |
"aws-route53@0.1.1": | |
682, | |
"aws-route53@0.1.2": | |
558, | |
"aws-route53@0.2.1": | |
546, | |
"aws-route53@0.3.1": | |
551, | |
"aws-route53domains@0.0.1": | |
562, | |
"aws-route53domains@0.1.1": | |
568, | |
"aws-route53domains@0.1.2": | |
565, | |
"aws-route53domains@0.2.1": | |
682, | |
"aws-route53domains@0.3.1": | |
540, | |
"aws-s3@0.0.1": | |
544, | |
"aws-s3@0.1.1": | |
569, | |
"aws-s3@0.1.2": | |
567, | |
"aws-s3@0.2.1": | |
563, | |
"aws-s3@0.3.1": | |
554, | |
"aws-sagemaker@0.0.1": | |
679, | |
"aws-sagemaker@0.1.1": | |
552, | |
"aws-sagemaker@0.1.2": | |
552, | |
"aws-sagemaker@0.2.1": | |
566, | |
"aws-sagemaker@0.3.1": | |
560, | |
"aws-sagemakerruntime@0.0.1": | |
568, | |
"aws-sagemakerruntime@0.1.1": | |
566, | |
"aws-sagemakerruntime@0.1.2": | |
713, | |
"aws-sagemakerruntime@0.2.1": | |
566, | |
"aws-sagemakerruntime@0.3.1": | |
538, | |
"aws-sdk@0.0.37": | |
484, | |
"aws-sdk@0.0.39": | |
480, | |
"aws-sdk@0.0.42": | |
482, | |
"aws-sdk@0.0.50": | |
482, | |
"aws-sdk@0.0.52": | |
601, | |
"aws-sdk-basic@0.1.0": | |
352, | |
"aws-sdk-basic@0.1.1": | |
330, | |
"aws-sdk-basic@0.2.0": | |
350, | |
"aws-sdk-basic@0.2.1": | |
351, | |
"aws-sdk-basic@0.10.0": | |
448, | |
"aws-sdk-basic@0.11.0": | |
441, | |
"aws-sdk-basic@0.12.1": | |
542, | |
"aws-sdk-basic@0.13.0": | |
435, | |
"aws-sdk-basic@0.14.0": | |
414, | |
"aws-sdk-basic@0.14.1": | |
431, | |
"aws-sdk-basic@0.15.0": | |
868, | |
"aws-sdk-basic@0.15.1": | |
871, | |
"aws-sdk-basic@0.15.2": | |
-474, | |
"aws-sdk-basic@0.16.0": | |
-585, | |
"aws-sdk-basic@0.16.1": | |
-452, | |
"aws-sdk-basic@0.16.2": | |
-462, | |
"aws-serverlessapplicationrepository@0.0.1": | |
574, | |
"aws-serverlessapplicationrepository@0.1.1": | |
572, | |
"aws-serverlessapplicationrepository@0.1.2": | |
567, | |
"aws-serverlessapplicationrepository@0.2.1": | |
669, | |
"aws-serverlessapplicationrepository@0.3.1": | |
539, | |
"aws-servicecatalog@0.0.1": | |
561, | |
"aws-servicecatalog@0.1.1": | |
563, | |
"aws-servicecatalog@0.1.2": | |
563, | |
"aws-servicecatalog@0.2.1": | |
687, | |
"aws-servicecatalog@0.3.1": | |
537, | |
"aws-servicediscovery@0.0.1": | |
552, | |
"aws-servicediscovery@0.1.1": | |
572, | |
"aws-servicediscovery@0.1.2": | |
562, | |
"aws-servicediscovery@0.2.1": | |
567, | |
"aws-servicediscovery@0.3.1": | |
689, | |
"aws-ses@0.0.1": | |
546, | |
"aws-ses@0.1.1": | |
551, | |
"aws-ses@0.1.2": | |
561, | |
"aws-ses@0.2.1": | |
564, | |
"aws-ses@0.3.1": | |
554, | |
"aws-shield@0.0.1": | |
682, | |
"aws-shield@0.1.1": | |
555, | |
"aws-shield@0.1.2": | |
549, | |
"aws-shield@0.2.1": | |
559, | |
"aws-shield@0.3.1": | |
553, | |
"aws-simpledb@0.0.1": | |
565, | |
"aws-simpledb@0.1.1": | |
573, | |
"aws-simpledb@0.1.2": | |
681, | |
"aws-simpledb@0.2.1": | |
551, | |
"aws-simpledb@0.3.1": | |
544, | |
"aws-sms@0.0.1": | |
561, | |
"aws-sms@0.1.1": | |
568, | |
"aws-sms@0.1.2": | |
562, | |
"aws-sms@0.2.1": | |
566, | |
"aws-sms@0.3.1": | |
677, | |
"aws-snowball@0.0.1": | |
551, | |
"aws-snowball@0.1.1": | |
543, | |
"aws-snowball@0.1.2": | |
562, | |
"aws-snowball@0.2.1": | |
582, | |
"aws-snowball@0.3.1": | |
557, | |
"aws-sns@0.0.1": | |
579, | |
"aws-sns@0.1.1": | |
688, | |
"aws-sns@0.1.2": | |
556, | |
"aws-sns@0.2.1": | |
551, | |
"aws-sns@0.3.1": | |
558, | |
"aws-sqs@0.0.1": | |
565, | |
"aws-sqs@0.1.1": | |
568, | |
"aws-sqs@0.1.2": | |
574, | |
"aws-sqs@0.2.1": | |
687, | |
"aws-sqs@0.3.1": | |
541, | |
"aws-ssm@0.0.1": | |
547, | |
"aws-ssm@0.1.1": | |
559, | |
"aws-ssm@0.1.2": | |
565, | |
"aws-ssm@0.2.1": | |
567, | |
"aws-ssm@0.3.1": | |
554, | |
"aws-stepfunctions@0.0.1": | |
684, | |
"aws-stepfunctions@0.1.1": | |
547, | |
"aws-stepfunctions@0.1.2": | |
543, | |
"aws-stepfunctions@0.2.1": | |
561, | |
"aws-stepfunctions@0.3.1": | |
552, | |
"aws-storagegateway@0.0.1": | |
564, | |
"aws-storagegateway@0.1.1": | |
569, | |
"aws-storagegateway@0.1.2": | |
699, | |
"aws-storagegateway@0.2.1": | |
561, | |
"aws-storagegateway@0.3.1": | |
532, | |
"aws-sts@0.0.1": | |
559, | |
"aws-sts@0.1.1": | |
568, | |
"aws-sts@0.1.2": | |
564, | |
"aws-sts@0.2.1": | |
566, | |
"aws-sts@0.3.1": | |
680, | |
"aws-support@0.0.1": | |
603, | |
"aws-support@0.1.1": | |
546, | |
"aws-support@0.1.2": | |
565, | |
"aws-support@0.2.1": | |
567, | |
"aws-support@0.3.1": | |
555, | |
"aws-swf@0.0.1": | |
567, | |
"aws-swf@0.1.1": | |
665, | |
"aws-swf@0.1.2": | |
554, | |
"aws-swf@0.2.1": | |
554, | |
"aws-swf@0.3.1": | |
551, | |
"aws-transcribeservice@0.0.1": | |
562, | |
"aws-transcribeservice@0.1.1": | |
565, | |
"aws-transcribeservice@0.1.2": | |
566, | |
"aws-transcribeservice@0.2.1": | |
681, | |
"aws-transcribeservice@0.3.1": | |
543, | |
"aws-translate@0.0.1": | |
542, | |
"aws-translate@0.1.1": | |
560, | |
"aws-translate@0.1.2": | |
561, | |
"aws-translate@0.2.1": | |
564, | |
"aws-translate@0.3.1": | |
556, | |
"aws-waf@0.0.1": | |
680, | |
"aws-waf@0.1.1": | |
557, | |
"aws-waf@0.1.2": | |
552, | |
"aws-waf@0.2.1": | |
585, | |
"aws-waf@0.3.1": | |
554, | |
"aws-wafregional@0.0.1": | |
575, | |
"aws-wafregional@0.1.1": | |
568, | |
"aws-wafregional@0.1.2": | |
683, | |
"aws-wafregional@0.2.1": | |
550, | |
"aws-wafregional@0.3.1": | |
537, | |
"aws-workdocs@0.0.1": | |
562, | |
"aws-workdocs@0.1.1": | |
560, | |
"aws-workdocs@0.1.2": | |
567, | |
"aws-workdocs@0.2.1": | |
566, | |
"aws-workdocs@0.3.1": | |
669, | |
"aws-workmail@0.0.1": | |
551, | |
"aws-workmail@0.1.1": | |
544, | |
"aws-workmail@0.1.2": | |
557, | |
"aws-workmail@0.2.1": | |
568, | |
"aws-workmail@0.3.1": | |
556, | |
"aws-workspaces@0.0.1": | |
563, | |
"aws-workspaces@0.1.1": | |
680, | |
"aws-workspaces@0.1.2": | |
554, | |
"aws-workspaces@0.2.1": | |
543, | |
"aws-workspaces@0.3.1": | |
549, | |
"aws-xray@0.0.1": | |
566, | |
"aws-xray@0.1.1": | |
568, | |
"aws-xray@0.1.2": | |
566, | |
"aws-xray@0.2.1": | |
684, | |
"aws-xray@0.3.1": | |
546, | |
"axios@0.0.1": | |
375, | |
"axios@1.0.2": | |
388, | |
"axios@1.1.0": | |
396, | |
"axios@1.1.1": | |
398, | |
"axios@1.1.2": | |
397, | |
"b64@0.0.1": | |
78, | |
"b64@0.0.2": | |
187, | |
"b64@0.0.3": | |
168, | |
"b64@0.0.4": | |
155, | |
"b64@0.0.5": | |
105, | |
"b64@0.0.6": | |
102, | |
"b64@0.0.7": | |
102, | |
"b64@0.0.8": | |
167, | |
"barbies@1.0.0": | |
66, | |
"barbies@1.0.1": | |
78, | |
"barlow-lens@0.1.0": | |
-205, | |
"barlow-lens@0.1.1": | |
-195, | |
"barlow-lens@0.2.0": | |
-193, | |
"barlow-lens@0.3.0": | |
205, | |
"barlow-lens@0.4.0": | |
139, | |
"barlow-lens@0.5.0": | |
97, | |
"barlow-lens@0.6.0": | |
204, | |
"barlow-lens@0.7.0": | |
111, | |
"barlow-lens@0.7.1": | |
108, | |
"barlow-lens@0.7.2": | |
114, | |
"barlow-lens@0.8.0": | |
108, | |
"barlow-lens@0.9.0": | |
200, | |
"base@0.1.0": | |
60, | |
"base@0.2.0": | |
58, | |
"base@0.2.1": | |
76, | |
"base@1.0.0": | |
75, | |
"base-rationals@0.1.0": | |
160, | |
"base-rationals@0.1.1": | |
148, | |
"base-rationals@0.1.2": | |
144, | |
"base58@0.0.3": | |
145, | |
"base64-2@0.0.0": | |
45, | |
"base64-2@0.0.1": | |
50, | |
"base64-2@0.0.2": | |
79, | |
"base64-2@1.0.0": | |
68, | |
"base64-2@1.0.1": | |
75, | |
"base64-2@2.0.0": | |
76, | |
"base64-2@2.0.1": | |
112, | |
"base64-codec@0.9.1": | |
747, | |
"base64-codec@0.9.2": | |
2381, | |
"base64-codec@0.10.0": | |
56, | |
"base64-codec@0.10.1": | |
136, | |
"base64-codec@0.10.2": | |
48, | |
"base64-codec@0.10.3": | |
53, | |
"base64-codec@0.11.0": | |
61, | |
"base64-codec@1.0.0": | |
68, | |
"basic-auth@0.0.1": | |
336, | |
"basic-auth@1.0.0": | |
286, | |
"basic-auth@1.0.1": | |
284, | |
"basic-auth@1.0.2": | |
377, | |
"basic-auth@1.0.3": | |
285, | |
"basic-auth@2.0.0": | |
177, | |
"basic-auth@2.1.0": | |
181, | |
"basic-auth@3.0.0": | |
147, | |
"basic-auth@3.0.1": | |
137, | |
"batteries@0.1.0": | |
171, | |
"batteries@0.2.0": | |
80, | |
"batteries@0.2.1": | |
77, | |
"batteries@0.2.4": | |
91, | |
"batteries@0.2.5": | |
99, | |
"batteries@0.3.0": | |
97, | |
"batteries@0.4.0": | |
170, | |
"batteries@0.5.0": | |
91, | |
"batteries@0.5.1": | |
70, | |
"batteries@0.5.2": | |
75, | |
"batteries@0.5.3": | |
89, | |
"batteries@0.5.4": | |
-84, | |
"batteries@0.6.0": | |
-80, | |
"batteries@0.7.0": | |
-242, | |
"batteries-core@0.0.2": | |
549, | |
"batteries-core@0.0.3": | |
432, | |
"batteries-core@0.0.5": | |
428, | |
"batteries-core@0.0.6": | |
448, | |
"batteries-core@0.2.0": | |
151, | |
"bbcode-parser@0.1.0": | |
-158, | |
"behaviors@0.1.0": | |
64, | |
"behaviors@1.0.0": | |
74, | |
"behaviors@1.0.1": | |
136, | |
"behaviors@1.0.2": | |
74, | |
"behaviors@2.0.0": | |
58, | |
"behaviors@3.0.0": | |
75, | |
"behaviors@4.0.0": | |
622, | |
"behaviors@5.0.0": | |
570, | |
"behaviors@5.1.0": | |
697, | |
"behaviors@5.2.0": | |
543, | |
"behaviors@6.0.0": | |
217, | |
"behaviors@6.0.1": | |
232, | |
"behaviors@6.1.0": | |
235, | |
"behaviors@6.2.0": | |
236, | |
"behaviors@6.3.0": | |
236, | |
"behaviors@7.0.0": | |
382, | |
"behaviors@8.0.0": | |
240, | |
"bench@0.0.1": | |
43, | |
"bench@0.0.2": | |
59, | |
"bench@0.0.3": | |
68, | |
"bench@1.0.0": | |
67, | |
"benchmark@0.1.0": | |
189, | |
"benchotron@3.0.5": | |
213, | |
"benchotron@4.0.0": | |
80, | |
"benchotron@5.0.0": | |
534, | |
"benchotron@6.0.0": | |
534, | |
"benchotron@7.0.0": | |
352, | |
"benchotron@7.0.1": | |
347, | |
"bf-gun@0.0.32": | |
259, | |
"bf-gun@0.0.33": | |
343, | |
"bf-gun@0.0.34": | |
245, | |
"bf-gun@0.0.35": | |
245, | |
"bf-gun@0.0.36": | |
255, | |
"bf-gun@0.1.0": | |
255, | |
"bf-gun@0.2.0": | |
361, | |
"bibimbap@0.1.0": | |
84, | |
"bifunctors@0.0.1": | |
-41, | |
"bifunctors@0.0.2": | |
-75, | |
"bifunctors@0.0.3": | |
-71, | |
"bifunctors@0.0.4": | |
69, | |
"bifunctors@0.0.5": | |
68, | |
"bifunctors@0.0.6": | |
76, | |
"bifunctors@0.1.0": | |
127, | |
"bifunctors@0.2.0": | |
56, | |
"bifunctors@0.3.0": | |
71, | |
"bifunctors@0.3.1": | |
76, | |
"bifunctors@0.4.0": | |
59, | |
"bifunctors@1.0.0": | |
132, | |
"bifunctors@2.0.0": | |
50, | |
"bifunctors@3.0.0": | |
51, | |
"bifunctors@4.0.0": | |
55, | |
"bifunctors@5.0.0": | |
80, | |
"bifunctors@6.0.0": | |
73, | |
"bigints@0.2.2": | |
73, | |
"bigints@1.0.0": | |
73, | |
"bigints@1.0.1": | |
131, | |
"bigints@2.0.0": | |
63, | |
"bigints@3.0.0": | |
70, | |
"bigints@3.1.0": | |
65, | |
"bigints@3.2.0": | |
607, | |
"bigints@3.3.0": | |
66, | |
"bigints@3.4.0": | |
68, | |
"bigints@3.5.0": | |
144, | |
"bigints@4.0.0": | |
206, | |
"bigints@5.0.0": | |
2105, | |
"bigints@6.0.0": | |
79, | |
"bigints@7.0.0": | |
86, | |
"bigints@7.0.1": | |
89, | |
"bignumber@1.0.0": | |
103, | |
"bignumber@1.0.1": | |
215, | |
"binary@0.0.1": | |
107, | |
"binary@0.0.2": | |
96, | |
"binary@0.0.3": | |
107, | |
"binary@0.0.4": | |
112, | |
"binary@0.0.5": | |
114, | |
"binary@0.0.6": | |
112, | |
"binary@0.0.7": | |
115, | |
"binary@0.0.8": | |
225, | |
"binary@0.0.9": | |
96, | |
"binary@0.0.10": | |
97, | |
"binary@0.0.11": | |
107, | |
"binary@0.0.12": | |
112, | |
"binary@0.0.13": | |
110, | |
"binary@0.0.14": | |
112, | |
"binary@0.0.15": | |
193, | |
"binary@0.0.16": | |
100, | |
"binary@0.0.17": | |
93, | |
"binary@0.0.18": | |
107, | |
"binary@0.0.19": | |
116, | |
"binary@0.0.20": | |
111, | |
"binary@0.0.21": | |
111, | |
"binary@0.1.0": | |
115, | |
"binary@0.1.1": | |
188, | |
"binary@0.2.0": | |
151, | |
"binary@0.2.1": | |
127, | |
"binary@0.2.2": | |
127, | |
"binary@0.2.3": | |
141, | |
"binary@0.2.4": | |
141, | |
"binary@0.2.5": | |
139, | |
"binary@0.2.6": | |
142, | |
"binary@0.2.7": | |
255, | |
"binary@0.2.8": | |
128, | |
"binary@0.2.9": | |
124, | |
"binary-integers@0.0.1": | |
112, | |
"binary-integers@0.0.2": | |
122, | |
"binary-integers@0.0.3": | |
122, | |
"bingsu@0.1.0": | |
324, | |
"bingsu@0.2.0": | |
321, | |
"bip39@0.0.1": | |
125, | |
"bip39@0.0.2": | |
77, | |
"bip39@1.0.0": | |
47, | |
"bip39@1.0.1": | |
63, | |
"birds@1.0.0": | |
183, | |
"birds@1.0.1": | |
168, | |
"birds@1.0.2": | |
161, | |
"birds@1.0.3": | |
240, | |
"birds@1.0.4": | |
145, | |
"biscotti-cookie@0.1.0": | |
313, | |
"biscotti-cookie@0.2.0": | |
335, | |
"biscotti-cookie@0.3.0": | |
153, | |
"biscotti-session@0.1.0": | |
507, | |
"biscotti-session@0.1.1": | |
598, | |
"biscotti-session@0.1.2": | |
400, | |
"biscotti-session@0.2.0": | |
196, | |
"bismuth@0.1.0": | |
173, | |
"bismuth@0.2.0": | |
171, | |
"bismuth@0.3.0": | |
172, | |
"bismuth@0.3.1": | |
264, | |
"black-scholes@0.1.0": | |
39, | |
"black-scholes@0.1.1": | |
54, | |
"bolson@0.0.0": | |
-134, | |
"bolson@0.0.1": | |
-135, | |
"bolson@0.0.2": | |
-137, | |
"bolson@0.0.3": | |
-217, | |
"bolson@0.0.4": | |
-118, | |
"bolson@0.0.5": | |
-127, | |
"bolson@0.0.6": | |
187, | |
"bolson@0.0.7": | |
-123, | |
"bolson@0.0.8": | |
-126, | |
"bolson@0.0.9": | |
220, | |
"bolson@0.1.0": | |
119, | |
"bolson@0.1.1": | |
124, | |
"bolson@0.3.1": | |
111, | |
"bonjiri@0.1.0": | |
185, | |
"bonjiri@0.2.0": | |
183, | |
"bonjiri@0.3.0": | |
185, | |
"bonjiri@0.4.0": | |
182, | |
"bonjiri@0.5.0": | |
305, | |
"bonjiri@0.6.0": | |
167, | |
"bonjiri@0.7.0": | |
164, | |
"bonsai@0.1.0": | |
358, | |
"bonsai@0.2.0": | |
388, | |
"bonsai@0.3.0": | |
387, | |
"bonsai@0.4.0": | |
371, | |
"bonsai@0.5.0": | |
451, | |
"bonsai@0.6.0": | |
300, | |
"boolean-eq@0.1.0": | |
43, | |
"boolean-eq@0.1.1": | |
62, | |
"boolean-eq@0.2.0": | |
77, | |
"boolean-eq@0.3.0": | |
77, | |
"boomboom@0.1.0": | |
175, | |
"boomboom@0.1.1": | |
170, | |
"boomboom@0.2.0": | |
280, | |
"boomboom@0.2.1": | |
150, | |
"boomboom@0.2.3": | |
155, | |
"boomboom@0.2.6": | |
181, | |
"boomboom@0.2.8": | |
163, | |
"boomboom@0.2.10": | |
168, | |
"boomboom@0.4.0": | |
163, | |
"boomboom@0.4.1": | |
287, | |
"boomboom@0.4.2": | |
153, | |
"boomboom@0.4.3": | |
148, | |
"boomboom@0.4.4": | |
157, | |
"boomboom@0.4.5": | |
165, | |
"boomerang@0.0.2": | |
79, | |
"boomerang@0.0.3": | |
82, | |
"boomerang@0.0.4": | |
84, | |
"boomerang@0.0.5": | |
184, | |
"boomerang@0.0.6": | |
74, | |
"boomerang@0.0.7": | |
64, | |
"boomerang@0.0.8": | |
84, | |
"boomerang@0.0.9": | |
89, | |
"boomerang@0.0.10": | |
85, | |
"boomerang@0.0.11": | |
88, | |
"boomerang@0.0.12": | |
185, | |
"boomerang@0.0.13": | |
81, | |
"boomerang@0.0.14": | |
80, | |
"boomerang@1.0.0": | |
72, | |
"boomerang@1.0.1": | |
75, | |
"boomerang@1.1.0": | |
75, | |
"boomerang@1.1.1": | |
79, | |
"boomerang@1.2.0": | |
434, | |
"boomerang@1.2.1": | |
256, | |
"boomerang@1.3.0": | |
-333, | |
"boomerang@1.4.0": | |
203, | |
"boomerang@1.5.0": | |
202, | |
"boomerang@1.5.1": | |
202, | |
"boomerang@1.6.0": | |
292, | |
"boomerang@1.7.0": | |
200, | |
"boomerang@1.8.0": | |
200, | |
"boomerang@1.8.1": | |
209, | |
"bound@0.1.0": | |
128, | |
"bound@0.2.0": | |
204, | |
"bound@0.3.0": | |
125, | |
"bound@0.4.0": | |
111, | |
"bound@0.5.0": | |
232, | |
"bouzuya-http-method@0.1.0": | |
65, | |
"bouzuya-http-method@0.2.0": | |
75, | |
"bouzuya-http-method@0.2.1": | |
63, | |
"bouzuya-http-status-code@0.1.0": | |
71, | |
"bower-json@0.0.1": | |
259, | |
"bower-json@0.1.0": | |
182, | |
"bower-json@1.0.0": | |
171, | |
"bower-json@2.0.0": | |
151, | |
"bower-json@3.0.0": | |
114, | |
"boxes@1.0.0": | |
142, | |
"boxes@1.0.1": | |
145, | |
"boxes@1.0.2": | |
142, | |
"boxes@2.0.0": | |
269, | |
"boxes@2.0.1": | |
139, | |
"boxes@2.0.2": | |
86, | |
"boxes@2.1.0": | |
87, | |
"bq@0.1.0": | |
252, | |
"bq@0.1.1": | |
238, | |
"bq@0.1.2": | |
239, | |
"bq@0.1.3": | |
237, | |
"bq@0.1.4": | |
323, | |
"bq@0.1.5": | |
225, | |
"browser-cookies@0.0.1": | |
199, | |
"browser-sniffer@0.0.0": | |
59, | |
"browserfeatures@0.1.0": | |
91, | |
"browserfeatures@0.2.0": | |
161, | |
"browserfeatures@0.2.1": | |
-79, | |
"browserfeatures@0.2.2": | |
-78, | |
"browserfeatures@0.3.0": | |
77, | |
"browserfeatures@0.4.0": | |
106, | |
"browserfeatures@0.4.1": | |
103, | |
"browserfeatures@0.4.2": | |
104, | |
"browserfeatures@1.0.0": | |
175, | |
"browserfeatures@2.0.0": | |
-207, | |
"browserfeatures@3.0.0": | |
440, | |
"browserfeatures@4.0.0": | |
693, | |
"browserfeatures@5.0.0": | |
689, | |
"bucketchain@0.1.0": | |
279, | |
"bucketchain@0.1.1": | |
363, | |
"bucketchain@0.1.2": | |
342, | |
"bucketchain@0.2.0": | |
263, | |
"bucketchain@0.2.1": | |
355, | |
"bucketchain@0.2.2": | |
268, | |
"bucketchain@0.2.3": | |
269, | |
"bucketchain@0.2.4": | |
291, | |
"bucketchain@0.2.5": | |
293, | |
"bucketchain@0.2.6": | |
285, | |
"bucketchain@0.2.7": | |
280, | |
"bucketchain@0.2.8": | |
286, | |
"bucketchain@0.2.9": | |
395, | |
"bucketchain@0.2.10": | |
267, | |
"bucketchain@0.2.11": | |
266, | |
"bucketchain@0.2.12": | |
300, | |
"bucketchain@0.3.0": | |
281, | |
"bucketchain@0.4.0": | |
166, | |
"bucketchain@1.0.0": | |
270, | |
"bucketchain@1.0.1": | |
127, | |
"bucketchain-basic-auth@0.1.0": | |
516, | |
"bucketchain-basic-auth@0.2.0": | |
476, | |
"bucketchain-basic-auth@0.3.0": | |
220, | |
"bucketchain-basic-auth@1.0.0": | |
188, | |
"bucketchain-basic-auth@1.0.1": | |
155, | |
"bucketchain-conditional@0.1.0": | |
547, | |
"bucketchain-conditional@0.2.0": | |
622, | |
"bucketchain-conditional@0.3.0": | |
183, | |
"bucketchain-conditional@1.0.0": | |
146, | |
"bucketchain-conditional@1.0.1": | |
138, | |
"bucketchain-cors@0.1.0": | |
488, | |
"bucketchain-cors@0.2.0": | |
598, | |
"bucketchain-cors@0.3.0": | |
469, | |
"bucketchain-cors@0.4.0": | |
200, | |
"bucketchain-cors@1.0.0": | |
173, | |
"bucketchain-cors@1.0.1": | |
186, | |
"bucketchain-csrf@0.1.0": | |
523, | |
"bucketchain-csrf@0.2.0": | |
476, | |
"bucketchain-csrf@0.3.0": | |
214, | |
"bucketchain-csrf@1.0.0": | |
270, | |
"bucketchain-csrf@1.0.1": | |
131, | |
"bucketchain-header-utils@0.1.0": | |
481, | |
"bucketchain-header-utils@0.2.0": | |
468, | |
"bucketchain-header-utils@0.3.0": | |
469, | |
"bucketchain-header-utils@0.4.0": | |
299, | |
"bucketchain-header-utils@1.0.0": | |
164, | |
"bucketchain-header-utils@1.0.1": | |
129, | |
"bucketchain-health@0.1.0": | |
499, | |
"bucketchain-health@0.2.0": | |
471, | |
"bucketchain-health@0.3.0": | |
210, | |
"bucketchain-health@1.0.0": | |
178, | |
"bucketchain-health@1.0.1": | |
145, | |
"bucketchain-history-api-fallback@0.1.0": | |
617, | |
"bucketchain-history-api-fallback@0.2.0": | |
463, | |
"bucketchain-history-api-fallback@0.3.0": | |
453, | |
"bucketchain-history-api-fallback@0.4.0": | |
210, | |
"bucketchain-history-api-fallback@1.0.0": | |
177, | |
"bucketchain-history-api-fallback@1.0.1": | |
145, | |
"bucketchain-logger@0.1.0": | |
628, | |
"bucketchain-logger@0.1.1": | |
468, | |
"bucketchain-logger@0.2.0": | |
450, | |
"bucketchain-logger@0.3.0": | |
417, | |
"bucketchain-logger@0.4.0": | |
189, | |
"bucketchain-logger@1.0.0": | |
154, | |
"bucketchain-logger@1.0.1": | |
133, | |
"bucketchain-secure@0.1.0": | |
613, | |
"bucketchain-secure@0.2.0": | |
211, | |
"bucketchain-secure@1.0.0": | |
155, | |
"bucketchain-secure@1.0.1": | |
137, | |
"bucketchain-simple-api@0.1.0": | |
502, | |
"bucketchain-simple-api@0.1.1": | |
496, | |
"bucketchain-simple-api@0.1.2": | |
492, | |
"bucketchain-simple-api@0.1.3": | |
597, | |
"bucketchain-simple-api@0.2.0": | |
476, | |
"bucketchain-simple-api@0.3.0": | |
450, | |
"bucketchain-simple-api@0.4.0": | |
423, | |
"bucketchain-simple-api@0.4.1": | |
415, | |
"bucketchain-simple-api@0.4.2": | |
378, | |
"bucketchain-simple-api@0.5.0": | |
346, | |
"bucketchain-simple-api@0.5.1": | |
446, | |
"bucketchain-simple-api@1.0.0": | |
339, | |
"bucketchain-simple-api@2.0.0": | |
330, | |
"bucketchain-simple-api@2.1.0": | |
333, | |
"bucketchain-simple-api@3.0.0": | |
349, | |
"bucketchain-simple-api@4.0.0": | |
211, | |
"bucketchain-simple-api@5.0.0": | |
164, | |
"bucketchain-simple-api@5.0.1": | |
164, | |
"bucketchain-sslify@0.1.0": | |
612, | |
"bucketchain-sslify@0.1.1": | |
490, | |
"bucketchain-sslify@0.2.0": | |
449, | |
"bucketchain-sslify@0.3.0": | |
208, | |
"bucketchain-sslify@1.0.0": | |
171, | |
"bucketchain-sslify@1.0.1": | |
142, | |
"bucketchain-static@0.1.0": | |
660, | |
"bucketchain-static@0.2.0": | |
497, | |
"bucketchain-static@0.3.0": | |
494, | |
"bucketchain-static@0.4.0": | |
198, | |
"bucketchain-static@1.0.0": | |
167, | |
"bucketchain-static@1.0.1": | |
138, | |
"bulma@1.0.0": | |
63, | |
"bulma@1.0.1": | |
124, | |
"bulma@1.1.0": | |
48, | |
"bulma@2.0.0": | |
120, | |
"byte-codec@0.0.0": | |
129, | |
"byte-codec@0.0.1": | |
461, | |
"bytestrings@0.0.1": | |
69, | |
"bytestrings@0.0.2": | |
70, | |
"bytestrings@0.0.3": | |
256, | |
"bytestrings@1.0.0": | |
147, | |
"bytestrings@1.0.1": | |
145, | |
"bytestrings@1.1.0": | |
153, | |
"bytestrings@1.2.0": | |
159, | |
"bytestrings@2.0.0": | |
163, | |
"bytestrings@2.1.0": | |
160, | |
"bytestrings@2.2.0": | |
247, | |
"bytestrings@2.3.0": | |
149, | |
"bytestrings@3.0.0": | |
262, | |
"bytestrings@3.0.1": | |
276, | |
"bytestrings@4.0.0": | |
331, | |
"bytestrings@4.0.1": | |
420, | |
"bytestrings@5.0.0": | |
319, | |
"bytestrings@5.0.1": | |
319, | |
"bytestrings@5.0.2": | |
322, | |
"bytestrings@6.0.0": | |
321, | |
"bytestrings@7.0.0": | |
179, | |
"bytestrings@8.0.0": | |
183, | |
"c3@0.1.0": | |
55, | |
"c3@0.1.1": | |
137, | |
"call-by-name@1.0.0": | |
64, | |
"call-by-name@2.0.0": | |
66, | |
"call-by-name@3.0.0": | |
94, | |
"call-by-name@4.0.0": | |
78, | |
"call-by-name@4.0.1": | |
76, | |
"calpis@0.1.0": | |
272, | |
"calpis@0.2.0": | |
166, | |
"camanjs@0.0.1": | |
166, | |
"camanjs@0.0.2": | |
170, | |
"camanjs@0.0.3": | |
186, | |
"camanjs@0.0.4": | |
185, | |
"camanjs@0.0.5": | |
188, | |
"camanjs@0.0.6": | |
188, | |
"canvas@0.1.0": | |
114, | |
"canvas@0.1.1": | |
58, | |
"canvas@0.1.2": | |
45, | |
"canvas@0.1.3": | |
55, | |
"canvas@0.1.4": | |
71, | |
"canvas@0.1.5": | |
66, | |
"canvas@0.1.6": | |
69, | |
"canvas@0.2.0": | |
67, | |
"canvas@0.3.0": | |
115, | |
"canvas@0.3.1": | |
50, | |
"canvas@0.3.2": | |
54, | |
"canvas@0.3.3": | |
66, | |
"canvas@0.3.4": | |
89, | |
"canvas@0.3.5": | |
67, | |
"canvas@0.4.0": | |
123, | |
"canvas@0.5.0": | |
54, | |
"canvas@0.5.1": | |
55, | |
"canvas@0.5.2": | |
81, | |
"canvas@0.5.3": | |
70, | |
"canvas@0.5.4": | |
140, | |
"canvas@1.0.0": | |
50, | |
"canvas@2.0.0": | |
78, | |
"canvas@3.0.0": | |
75, | |
"canvas@3.1.0": | |
87, | |
"canvas@3.2.0": | |
77, | |
"canvas@3.3.0": | |
79, | |
"canvas@4.0.0": | |
140, | |
"canvas@5.0.0": | |
55, | |
"canvas@6.0.0": | |
54, | |
"canvas-action@1.0.0": | |
245, | |
"canvas-action@1.0.1": | |
223, | |
"canvas-action@1.0.2": | |
220, | |
"canvas-action@2.0.0": | |
202, | |
"canvas-action@2.0.1": | |
292, | |
"canvas-action@3.0.0": | |
266, | |
"canvas-action@3.0.1": | |
252, | |
"canvas-action@3.0.3": | |
273, | |
"canvas-action@3.0.4": | |
272, | |
"canvas-action@4.0.0": | |
275, | |
"canvas-action@4.0.1": | |
361, | |
"canvas-action@5.0.0": | |
245, | |
"canvas-action@5.0.1": | |
253, | |
"canvas-action@6.0.1": | |
254, | |
"canvas-action@7.0.0": | |
128, | |
"canvas-action@8.0.0": | |
125, | |
"canvas-action@9.0.0": | |
197, | |
"canvas-geometry@1.0.0": | |
281, | |
"canvas-geometry@1.0.1": | |
250, | |
"canvas-geometry@1.0.2": | |
257, | |
"canvas-geometry@2.0.0": | |
266, | |
"carpenter@1.0.0": | |
73, | |
"carpenter@1.1.0": | |
75, | |
"carpenter@1.1.1": | |
77, | |
"carpenter@1.1.2": | |
151, | |
"carpenter@1.2.0": | |
107, | |
"carpenter@2.0.0": | |
61, | |
"carpenter@2.0.1": | |
61, | |
"carpenter@2.1.0": | |
83, | |
"carpenter@2.2.0": | |
77, | |
"carpenter@2.2.1": | |
74, | |
"carpenter@2.3.0": | |
77, | |
"carpenter-router@0.1.0": | |
-336, | |
"carpenter-router@0.1.1": | |
61, | |
"carpenter-router@0.1.2": | |
70, | |
"carpenter-router@0.1.3": | |
88, | |
"carpenter-router@1.0.0": | |
-238, | |
"cartesian@1.0.1": | |
66, | |
"cartesian@1.0.2": | |
100, | |
"cartesian@1.0.4": | |
109, | |
"cartesian@1.0.5": | |
51, | |
"cartesian@1.0.6": | |
50, | |
"case-insensitive@1.0.0": | |
72, | |
"cast@0.1.0": | |
76, | |
"catenable-lists@0.1.0": | |
80, | |
"catenable-lists@0.1.1": | |
83, | |
"catenable-lists@1.0.0": | |
71, | |
"catenable-lists@1.0.1": | |
140, | |
"catenable-lists@1.1.0": | |
63, | |
"catenable-lists@2.0.0": | |
96, | |
"catenable-lists@3.0.0": | |
153, | |
"catenable-lists@3.0.1": | |
137, | |
"catenable-lists@4.0.0": | |
188, | |
"catenable-lists@5.0.0": | |
176, | |
"catenable-lists@5.0.1": | |
99, | |
"catenable-lists@6.0.0": | |
66, | |
"catenable-lists@6.0.1": | |
77, | |
"catenable-lists@7.0.0": | |
78, | |
"causal-graphs@0.0.1": | |
142, | |
"causal-graphs@0.1.0": | |
136, | |
"causal-graphs@0.2.0": | |
139, | |
"causal-graphs@0.3.0": | |
236, | |
"causal-graphs@0.4.0": | |
128, | |
"causal-graphs@0.4.1": | |
118, | |
"chai@0.0.3": | |
44, | |
"chalk@0.0.1": | |
72, | |
"chalk@0.0.2": | |
67, | |
"chalk@0.0.3": | |
66, | |
"chalk@0.0.4": | |
68, | |
"chalky@0.1.0": | |
73, | |
"chalky@0.2.0": | |
122, | |
"chalky@1.0.0": | |
45, | |
"chalky@2.0.0": | |
49, | |
"channel@0.1.0": | |
292, | |
"channel@0.1.1": | |
248, | |
"channel@0.2.0": | |
245, | |
"channel@1.0.0": | |
128, | |
"channel-stream@0.1.0": | |
307, | |
"channel-stream@1.0.0": | |
253, | |
"chanpon@0.1.0": | |
663, | |
"chanpon@0.2.0": | |
626, | |
"chanpon@1.0.0": | |
305, | |
"chanterelle@0.1.2": | |
1077, | |
"chanterelle@0.2.0": | |
1062, | |
"chanterelle@0.4.0": | |
958, | |
"chanterelle@0.5.0": | |
815, | |
"chanterelle@0.6.0": | |
812, | |
"chanterelle@0.7.0": | |
-831, | |
"chanterelle@0.8.0": | |
-847, | |
"chanterelle@0.8.1": | |
-861, | |
"chanterelle@0.8.2": | |
-950, | |
"chanterelle@0.8.3": | |
-821, | |
"chanterelle@0.8.4": | |
-822, | |
"chanterelle@0.8.5": | |
-820, | |
"chanterelle@0.9.0": | |
931, | |
"chanterelle@0.9.1": | |
1029, | |
"chanterelle@0.10.0": | |
845, | |
"chanterelle@0.11.0": | |
851, | |
"chanterelle@0.12.0": | |
870, | |
"chanterelle@0.13.0": | |
879, | |
"chanterelle@4.0.0": | |
-567, | |
"chanterelle@4.1.0": | |
-650, | |
"chanterelle@5.0.0": | |
-354, | |
"chanterelle@5.1.0": | |
-354, | |
"chanterelle@5.1.2": | |
-365, | |
"chanterelle@5.1.3": | |
-371, | |
"chanterelle@6.0.0": | |
-363, | |
"chapagetti@0.1.0": | |
445, | |
"chapagetti@1.0.0": | |
304, | |
"charm@0.3.0": | |
92, | |
"charm@0.3.1": | |
83, | |
"charm@0.3.2": | |
89, | |
"charm@0.3.3": | |
104, | |
"charm@0.4.0": | |
343, | |
"charm@0.4.1": | |
345, | |
"chartjs@0.1.0": | |
75, | |
"chartjs@0.2.0": | |
132, | |
"chartjs@0.3.0": | |
56, | |
"chartjs@0.4.0": | |
54, | |
"checked-exceptions@1.0.0": | |
211, | |
"checked-exceptions@2.0.0": | |
124, | |
"checked-exceptions@3.0.0": | |
101, | |
"checked-exceptions@3.1.0": | |
99, | |
"checked-exceptions@3.1.1": | |
101, | |
"cheerio@0.1.0": | |
740, | |
"cheerio@0.2.0": | |
408, | |
"cheerio@0.2.1": | |
419, | |
"cheerio@0.2.2": | |
439, | |
"cheerio@0.2.3": | |
441, | |
"cheerio@0.2.4": | |
182, | |
"cherry@0.1.0": | |
-425, | |
"cherry@0.1.1": | |
-289, | |
"cherry@0.1.2": | |
-282, | |
"cherry@0.1.3": | |
-296, | |
"cherry@1.0.0": | |
796, | |
"cherry@1.1.0": | |
585, | |
"cherry@1.1.1": | |
642, | |
"cherry@1.1.2": | |
562, | |
"cherry@2.0.0": | |
553, | |
"cherry@2.0.1": | |
569, | |
"cherry@2.0.2": | |
565, | |
"cherry@2.1.0": | |
662, | |
"cherry@2.2.0": | |
556, | |
"cherry@2.3.0": | |
549, | |
"cherry@2.4.0": | |
556, | |
"cherry@3.0.0": | |
270, | |
"cherry@3.0.1": | |
348, | |
"chirashi@0.1.0": | |
102, | |
"chirashi@1.0.0": | |
100, | |
"choco-pie@0.1.0": | |
725, | |
"choco-pie@0.2.0": | |
720, | |
"choco-pie@0.3.0": | |
723, | |
"choco-pie@1.0.0": | |
470, | |
"choco-pie@2.0.0": | |
323, | |
"choco-pie@3.0.0": | |
307, | |
"choco-pie@4.0.0": | |
326, | |
"choco-pie@5.0.0": | |
324, | |
"choco-pie@6.0.0": | |
-66, | |
"chrono@0.1.0": | |
131, | |
"chrono@0.1.1": | |
56, | |
"chrono@0.1.2": | |
55, | |
"cirru-edn@0.0.1": | |
190, | |
"cirru-edn@0.0.3": | |
95, | |
"cirru-edn@0.0.4": | |
93, | |
"cirru-edn@0.0.5": | |
99, | |
"cirru-edn@0.0.6": | |
98, | |
"cirru-edn@0.0.7": | |
183, | |
"cirru-edn@0.0.8": | |
77, | |
"cirru-parser@0.0.2": | |
130, | |
"cirru-parser@0.0.3": | |
78, | |
"cirru-parser@0.0.4": | |
91, | |
"cirru-parser@0.0.5": | |
89, | |
"clappr@0.1.0": | |
491, | |
"clappr@0.2.0": | |
362, | |
"clappr@0.2.1": | |
355, | |
"clappr@0.3.0": | |
350, | |
"clappr@0.4.0": | |
365, | |
"clappr@0.4.1": | |
504, | |
"clappr@0.5.0": | |
502, | |
"clappr@0.6.0": | |
513, | |
"clappr@0.6.1": | |
412, | |
"clappr@0.7.0": | |
401, | |
"clappr@0.7.1": | |
413, | |
"clappr@0.7.2": | |
424, | |
"classless@0.1.0": | |
88, | |
"classless@0.1.1": | |
84, | |
"classless-arbitrary@0.1.1": | |
101, | |
"classless-decode-json@0.1.1": | |
207, | |
"classless-encode-json@0.1.2": | |
114, | |
"classless-encode-json@0.1.3": | |
112, | |
"classnames@0.1.0": | |
323, | |
"classnames@0.1.1": | |
105, | |
"classnames@1.0.0": | |
90, | |
"classnames@2.0.0": | |
159, | |
"clipboard@0.1.0": | |
-307, | |
"clipboard@0.2.0": | |
705, | |
"clipboard@0.3.0": | |
705, | |
"clipboard@0.4.0": | |
324, | |
"clipboard@0.5.0": | |
427, | |
"clipboard@1.0.0": | |
230, | |
"clipboardy@1.0.0": | |
328, | |
"clipboardy@1.0.1": | |
337, | |
"clipboardy@1.0.2": | |
354, | |
"clipboardy@1.0.3": | |
347, | |
"clock@0.1.0": | |
63, | |
"clock@0.1.1": | |
82, | |
"clock@1.0.0": | |
143, | |
"clock@1.0.1": | |
47, | |
"clock@2.0.0": | |
52, | |
"cnchar@0.0.1": | |
147, | |
"codec@1.0.0": | |
167, | |
"codec@2.0.0": | |
168, | |
"codec@2.1.0": | |
163, | |
"codec@3.0.0": | |
171, | |
"codec@3.1.0": | |
90, | |
"codec@4.0.0": | |
60, | |
"codec@4.0.1": | |
85, | |
"codec@5.0.0": | |
81, | |
"codec@6.0.0": | |
67, | |
"codec-argonaut@1.0.0": | |
519, | |
"codec-argonaut@2.0.0": | |
373, | |
"codec-argonaut@2.1.0": | |
364, | |
"codec-argonaut@3.0.0": | |
349, | |
"codec-argonaut@3.1.0": | |
362, | |
"codec-argonaut@3.2.0": | |
361, | |
"codec-argonaut@4.0.0": | |
301, | |
"codec-argonaut@4.1.0": | |
446, | |
"codec-argonaut@4.2.0": | |
293, | |
"codec-argonaut@4.3.0": | |
283, | |
"codec-argonaut@5.0.0": | |
231, | |
"codec-argonaut@6.0.0": | |
209, | |
"codec-argonaut@7.0.0": | |
218, | |
"codec-argonaut@7.0.1": | |
229, | |
"codec-argonaut@7.0.2": | |
316, | |
"codec-argonaut@7.1.0": | |
219, | |
"codec-argonaut@8.0.0": | |
96, | |
"codec-argonaut@9.0.0": | |
83, | |
"codec-argonaut@9.1.0": | |
96, | |
"codec-argonaut@9.2.0": | |
99, | |
"codec-argonaut@10.0.0": | |
100, | |
"coercible@1.0.0": | |
76, | |
"coercible@2.0.0": | |
171, | |
"coercible@2.1.0": | |
107, | |
"coercible@3.0.0": | |
177, | |
"coercions@1.0.0": | |
59, | |
"coercions@2.0.0": | |
86, | |
"coercions@2.1.0": | |
70, | |
"coercions@3.0.0": | |
120, | |
"cofree-react-router@0.3.3": | |
-413, | |
"cofree-react-router@0.3.4": | |
-505, | |
"cofree-react-router@0.3.5": | |
-397, | |
"cofree-react-router@0.3.6": | |
-381, | |
"cofree-react-router@1.0.0": | |
-408, | |
"cofree-react-router@1.0.1": | |
-405, | |
"cofree-react-router@2.0.1": | |
627, | |
"cofree-react-router@2.1.0": | |
780, | |
"cofree-react-router@2.1.1": | |
585, | |
"cofree-react-router@3.0.0": | |
582, | |
"cofree-react-router@3.0.1": | |
598, | |
"cofree-react-router@3.0.2": | |
599, | |
"cofree-react-router@4.0.0": | |
596, | |
"cofree-react-router@5.0.0": | |
701, | |
"cofree-react-router@5.1.0": | |
579, | |
"cofree-react-router@6.0.0": | |
584, | |
"cofree-react-router@6.1.0": | |
617, | |
"cofree-react-router@6.1.1": | |
-830, | |
"cofree-react-router@6.1.2": | |
939, | |
"cofree-react-router@6.2.0": | |
804, | |
"cofree-react-router@6.3.0": | |
823, | |
"cofree-react-router@6.4.0": | |
833, | |
"cofree-react-router@6.4.1": | |
840, | |
"cofree-react-router@7.0.0": | |
878, | |
"colehaus-graphs@0.1.0": | |
-47, | |
"colehaus-graphs@0.2.0": | |
56, | |
"colehaus-graphs@0.3.0": | |
73, | |
"colehaus-graphs@0.3.1": | |
76, | |
"colehaus-graphs@0.4.0": | |
86, | |
"colehaus-graphs@0.5.0": | |
130, | |
"colehaus-graphs@1.0.0": | |
148, | |
"colehaus-graphs@2.0.0": | |
195, | |
"colehaus-graphs@3.0.0": | |
225, | |
"colehaus-graphs@4.0.0": | |
124, | |
"colehaus-graphs@5.0.1": | |
129, | |
"colehaus-graphs@6.0.0": | |
127, | |
"colehaus-graphs@7.0.0": | |
246, | |
"colehaus-lattice@0.1.0": | |
49, | |
"colehaus-lattice@0.2.0": | |
57, | |
"colehaus-lattice@0.3.0": | |
57, | |
"colehaus-lattice@1.0.0": | |
110, | |
"colehaus-properties@0.1.0": | |
62, | |
"colehaus-properties@0.2.0": | |
74, | |
"colehaus-properties@0.3.0": | |
67, | |
"colehaus-properties@0.3.1": | |
114, | |
"colehaus-properties@0.3.2": | |
45, | |
"color-palettes@0.0.1": | |
-302, | |
"colorpalettepicker-halogen@0.1.0": | |
-1216, | |
"colorpicker-halogen@0.2.0": | |
1327, | |
"colors@0.4.4": | |
126, | |
"colors@1.0.0": | |
61, | |
"colors@1.0.1": | |
65, | |
"colors@1.0.2": | |
67, | |
"colors@2.0.0": | |
167, | |
"colors@2.1.0": | |
147, | |
"colors@2.2.0": | |
242, | |
"colors@3.0.0": | |
166, | |
"colors@3.1.0": | |
184, | |
"colors@4.0.0": | |
186, | |
"colors@4.1.0": | |
199, | |
"colors@4.2.0": | |
201, | |
"colors@4.3.0": | |
203, | |
"colors@5.0.0": | |
136, | |
"colors@6.0.0": | |
211, | |
"colors@7.0.0": | |
88, | |
"colors@7.0.1": | |
78, | |
"compact@0.0.1": | |
45, | |
"compact@0.0.2": | |
67, | |
"compact@1.0.0": | |
67, | |
"complex@1.0.0": | |
63, | |
"complex@1.0.1": | |
107, | |
"complex@1.1.0": | |
194, | |
"concur-core@0.2.0": | |
339, | |
"concur-core@0.3.0": | |
314, | |
"concur-core@0.3.1": | |
309, | |
"concur-core@0.3.2": | |
312, | |
"concur-core@0.3.3": | |
319, | |
"concur-core@0.3.4": | |
322, | |
"concur-core@0.3.5": | |
377, | |
"concur-core@0.3.6": | |
266, | |
"concur-core@0.3.7": | |
264, | |
"concur-core@0.3.8": | |
-269, | |
"concur-core@0.4.0": | |
259, | |
"concur-core@0.4.1": | |
257, | |
"concur-core@0.4.2": | |
367, | |
"concur-core@0.5.0": | |
97, | |
"concur-react@0.2.0": | |
324, | |
"concur-react@0.3.0": | |
327, | |
"concur-react@0.3.1": | |
322, | |
"concur-react@0.3.2": | |
327, | |
"concur-react@0.3.3": | |
428, | |
"concur-react@0.3.4": | |
301, | |
"concur-react@0.3.5": | |
262, | |
"concur-react@0.3.6": | |
269, | |
"concur-react@0.3.7": | |
283, | |
"concur-react@0.3.8": | |
-278, | |
"concur-react@0.4.1": | |
-271, | |
"concur-react@0.4.2": | |
-271, | |
"concur-react@0.5.0": | |
-551, | |
"concurrent@0.1.0": | |
51, | |
"concurrent-queues@0.1.0": | |
480, | |
"concurrent-queues@1.0.0": | |
319, | |
"concurrent-queues@1.1.0": | |
324, | |
"concurrent-queues@2.0.0": | |
137, | |
"concurrent-queues@3.0.0": | |
217, | |
"conditional@1.0.0": | |
45, | |
"conditional@1.0.1": | |
54, | |
"conditional@2.0.0": | |
58, | |
"config@0.0.1": | |
-376, | |
"config@0.0.2": | |
-357, | |
"config@0.0.3": | |
-379, | |
"config@0.0.4": | |
-474, | |
"config@0.0.5": | |
-331, | |
"config@0.0.6": | |
431, | |
"config2@0.0.1": | |
-355, | |
"config2@0.0.2": | |
-351, | |
"config2@0.0.3": | |
-346, | |
"config2@0.0.4": | |
-465, | |
"config2@0.0.5": | |
-333, | |
"config2@0.0.6": | |
435, | |
"config2@0.1.0": | |
180, | |
"confusables@1.0.0": | |
160, | |
"confusables@1.0.1": | |
161, | |
"cons@0.1.0": | |
-84, | |
"consable@0.0.1": | |
206, | |
"console@0.1.0": | |
42, | |
"console@0.1.1": | |
54, | |
"console@1.0.0": | |
62, | |
"console@2.0.0": | |
64, | |
"console@3.0.0": | |
72, | |
"console@4.0.0": | |
64, | |
"console@4.1.0": | |
108, | |
"console@4.2.0": | |
48, | |
"console@4.3.0": | |
55, | |
"console@4.4.0": | |
59, | |
"console@5.0.0": | |
73, | |
"console@6.0.0": | |
76, | |
"console-browser-specific@0.0.1": | |
141, | |
"console-browser-specific@1.0.0": | |
74, | |
"console-browser-specific@1.1.0": | |
64, | |
"console-browser-specific@2.0.0": | |
74, | |
"console-foreign@0.1.0": | |
156, | |
"console-lifted@0.0.1": | |
62, | |
"console-timer@0.0.1": | |
74, | |
"console-timer@0.0.2": | |
64, | |
"console-timer@0.0.3": | |
134, | |
"const@0.1.0": | |
67, | |
"const@0.1.1": | |
64, | |
"const@0.2.0": | |
61, | |
"const@0.3.0": | |
85, | |
"const@0.4.0": | |
80, | |
"const@0.4.1": | |
77, | |
"const@0.5.0": | |
95, | |
"const@1.0.0": | |
109, | |
"const@2.0.0": | |
60, | |
"const@3.0.0": | |
73, | |
"const@3.1.0": | |
96, | |
"const@3.2.0": | |
92, | |
"const@4.0.0": | |
76, | |
"const@4.1.0": | |
74, | |
"const@5.0.0": | |
64, | |
"const@6.0.0": | |
130, | |
"context@0.0.1": | |
46, | |
"context@0.0.2": | |
46, | |
"context@0.0.3": | |
53, | |
"context@1.0.0": | |
70, | |
"contravariant@0.0.1": | |
72, | |
"contravariant@0.1.0": | |
76, | |
"contravariant@0.2.0": | |
113, | |
"contravariant@0.2.1": | |
58, | |
"contravariant@0.2.2": | |
51, | |
"contravariant@0.2.3": | |
72, | |
"contravariant@1.0.0": | |
71, | |
"contravariant@2.0.0": | |
103, | |
"contravariant@3.0.0": | |
147, | |
"contravariant@3.1.0": | |
83, | |
"contravariant@3.2.0": | |
64, | |
"contravariant@3.3.0": | |
67, | |
"contravariant@4.0.0": | |
75, | |
"contravariant@4.0.1": | |
73, | |
"contravariant@5.0.0": | |
62, | |
"contravariant@6.0.0": | |
72, | |
"control@0.1.0": | |
63, | |
"control@0.1.1": | |
108, | |
"control@0.2.0": | |
42, | |
"control@0.2.1": | |
51, | |
"control@0.2.2": | |
67, | |
"control@0.2.3": | |
67, | |
"control@0.2.4": | |
128, | |
"control@0.2.5": | |
43, | |
"control@0.2.6": | |
52, | |
"control@0.3.0": | |
55, | |
"control@0.3.1": | |
67, | |
"control@0.3.2": | |
67, | |
"control@1.0.0": | |
66, | |
"control@2.0.0": | |
105, | |
"control@3.0.0": | |
46, | |
"control@3.1.0": | |
50, | |
"control@3.2.0": | |
63, | |
"control@3.3.0": | |
67, | |
"control@3.3.1": | |
67, | |
"control@4.0.0": | |
107, | |
"control@4.1.0": | |
45, | |
"control@4.2.0": | |
53, | |
"control@5.0.0": | |
66, | |
"control@6.0.0": | |
68, | |
"convertable-options@1.0.0": | |
74, | |
"conveyor@0.0.1": | |
485, | |
"conveyor@0.1.0": | |
329, | |
"conveyor@0.1.1": | |
322, | |
"conveyor@0.2.0": | |
330, | |
"conveyor@0.3.0": | |
338, | |
"conveyor@0.3.1": | |
344, | |
"conveyor@0.3.2": | |
342, | |
"conveyor@0.4.0": | |
455, | |
"conveyor@0.4.1": | |
328, | |
"conveyor@0.4.2": | |
561, | |
"conveyor@0.5.0": | |
591, | |
"conveyor@0.5.1": | |
598, | |
"conveyor@0.5.2": | |
704, | |
"conveyor@0.5.3": | |
592, | |
"conveyor@0.5.4": | |
575, | |
"conveyor@0.5.5": | |
586, | |
"conveyor@0.5.6": | |
602, | |
"conveyor@0.6.0": | |
605, | |
"conveyor@0.7.0": | |
609, | |
"conveyor@0.8.0": | |
693, | |
"conveyor@0.9.0": | |
506, | |
"conveyor@0.10.0": | |
503, | |
"conveyor@0.11.0": | |
337, | |
"conveyor@0.12.0": | |
327, | |
"conveyor@0.12.1": | |
335, | |
"conveyor@0.12.2": | |
428, | |
"conveyor@0.13.0": | |
318, | |
"conveyor@0.14.0": | |
414, | |
"conveyor@0.14.1": | |
436, | |
"conveyor@0.15.0": | |
438, | |
"conveyor@0.16.0": | |
511, | |
"conveyor@0.17.0": | |
428, | |
"conveyor@1.0.0": | |
412, | |
"conveyor@2.0.0": | |
418, | |
"conveyor@2.1.0": | |
432, | |
"conveyor-basic-auth@1.0.0": | |
550, | |
"conveyor-basic-auth@1.1.0": | |
552, | |
"conveyor-basic-auth@1.2.0": | |
631, | |
"conveyor-cors@0.1.0": | |
446, | |
"conveyor-cors@0.1.1": | |
434, | |
"conveyor-cors@0.1.2": | |
676, | |
"conveyor-cors@0.2.0": | |
745, | |
"conveyor-cors@0.2.1": | |
745, | |
"conveyor-cors@0.3.0": | |
742, | |
"conveyor-cors@0.4.0": | |
874, | |
"conveyor-cors@0.4.1": | |
705, | |
"conveyor-cors@0.5.0": | |
818, | |
"conveyor-cors@0.6.0": | |
826, | |
"conveyor-cors@0.7.0": | |
607, | |
"conveyor-cors@0.7.1": | |
687, | |
"conveyor-cors@0.8.0": | |
600, | |
"conveyor-cors@0.8.1": | |
723, | |
"conveyor-cors@0.9.0": | |
831, | |
"conveyor-cors@1.0.0": | |
535, | |
"conveyor-health@1.0.0": | |
531, | |
"cookie@0.1.0": | |
311, | |
"cookie@0.1.1": | |
311, | |
"cookie@0.1.2": | |
397, | |
"cookie@0.1.3": | |
308, | |
"cookie@0.2.0": | |
671, | |
"cookie@0.3.0": | |
678, | |
"cookie@1.0.0": | |
283, | |
"coproducts@0.1.0": | |
63, | |
"coproducts@0.2.0": | |
78, | |
"coproducts@0.3.0": | |
73, | |
"coproducts@0.3.1": | |
154, | |
"coproducts@0.4.0": | |
51, | |
"coproducts@0.4.1": | |
68, | |
"coroutines@0.2.2": | |
85, | |
"coroutines@0.2.3": | |
77, | |
"coroutines@0.2.4": | |
77, | |
"coroutines@0.3.0": | |
84, | |
"coroutines@0.3.1": | |
150, | |
"coroutines@0.4.0": | |
80, | |
"coroutines@0.5.0": | |
85, | |
"coroutines@1.0.0": | |
68, | |
"coroutines@1.1.0": | |
78, | |
"coroutines@1.2.0": | |
77, | |
"coroutines@1.3.0": | |
80, | |
"coroutines@2.0.0": | |
129, | |
"coroutines@2.0.1": | |
69, | |
"coroutines@3.0.0": | |
154, | |
"coroutines@3.0.1": | |
145, | |
"coroutines@3.1.0": | |
-117, | |
"coroutines@4.0.0": | |
145, | |
"coroutines@5.0.0": | |
206, | |
"coroutines@5.0.1": | |
232, | |
"coroutines@6.0.0": | |
111, | |
"coroutines@7.0.0": | |
90, | |
"cowlaser@0.0.1": | |
89, | |
"cowlaser@0.1.0": | |
84, | |
"cowlaser@0.2.0": | |
83, | |
"cowlaser@0.3.0": | |
90, | |
"cowlaser@0.4.0": | |
193, | |
"cowlaser@0.5.0": | |
94, | |
"cowlaser@0.6.0": | |
75, | |
"cowlaser@0.7.0": | |
78, | |
"creditcard-validation@1.0.0": | |
132, | |
"creditcard-validation@1.0.1": | |
130, | |
"creditcard-validation@1.0.2": | |
125, | |
"crypt-nacl@0.1.0": | |
64, | |
"crypt-nacl@0.2.0": | |
158, | |
"crypt-nacl@0.3.0": | |
77, | |
"crypto@0.1.0": | |
48, | |
"crypto@0.1.1": | |
75, | |
"crypto@0.1.2": | |
75, | |
"crypto@0.1.3": | |
72, | |
"crypto@0.2.0": | |
70, | |
"crypto@1.0.0": | |
131, | |
"crypto@1.1.0": | |
54, | |
"crypto@2.0.0": | |
61, | |
"crypto@2.0.1": | |
139, | |
"crypto@2.1.0": | |
94, | |
"crypto@3.0.0": | |
78, | |
"crypto@4.0.0": | |
145, | |
"crypto@5.0.0": | |
182, | |
"crypto@5.0.1": | |
85, | |
"css@0.1.0": | |
63, | |
"css@0.3.0": | |
-78, | |
"css@0.3.1": | |
-86, | |
"css@0.4.0": | |
-79, | |
"css@0.5.0": | |
-173, | |
"css@0.5.1": | |
-87, | |
"css@0.5.2": | |
-69, | |
"css@0.6.0": | |
-86, | |
"css@0.7.0": | |
-82, | |
"css@1.0.0": | |
78, | |
"css@1.1.0": | |
81, | |
"css@2.0.0": | |
199, | |
"css@2.1.0": | |
290, | |
"css@3.0.0": | |
191, | |
"css@3.1.0": | |
236, | |
"css@3.2.0": | |
244, | |
"css@3.3.0": | |
254, | |
"css@3.4.0": | |
254, | |
"css@4.0.0": | |
253, | |
"css@5.0.0": | |
164, | |
"css@5.0.1": | |
167, | |
"css@6.0.0": | |
104, | |
"css-bem@0.0.1": | |
110, | |
"css-bem@0.0.2": | |
320, | |
"css-properties@0.1.0": | |
41, | |
"css-properties@0.2.0": | |
53, | |
"css-properties@0.3.0": | |
57, | |
"css-validate@0.1.0": | |
70, | |
"css-validate@0.2.0": | |
66, | |
"css-validate@0.3.0": | |
65, | |
"css-validate@0.4.0": | |
76, | |
"css-validate@0.5.0": | |
134, | |
"css-validate@0.6.0": | |
70, | |
"cssom@0.0.2": | |
54, | |
"csv@1.2.2": | |
94, | |
"csv@1.3.0": | |
-282, | |
"csv@1.3.1": | |
277, | |
"csv@2.0.0": | |
326, | |
"csv@3.0.0": | |
190, | |
"cycle@0.0.1": | |
72, | |
"cycle@0.0.2": | |
81, | |
"cycle-run@0.1.0": | |
71, | |
"cycle-run@0.2.0": | |
511, | |
"cycle-run@0.3.0": | |
390, | |
"cycle-run@0.4.0": | |
502, | |
"cycle-run@0.5.0": | |
373, | |
"cycle-run@0.6.0": | |
1425, | |
"cycle-run@0.7.0": | |
1440, | |
"cycle-run@0.8.0": | |
1259, | |
"cycle-run@1.0.0": | |
1445, | |
"d3@0.1.0": | |
133, | |
"d3@0.1.1": | |
52, | |
"d3@0.2.0": | |
-54, | |
"d3@0.3.0": | |
-58, | |
"d3@0.4.0": | |
-69, | |
"d3@0.4.1": | |
-67, | |
"d3@0.5.0": | |
-69, | |
"d3@0.6.0": | |
-70, | |
"d3@0.7.0": | |
154, | |
"d3@0.8.0": | |
63, | |
"d3@0.8.1": | |
68, | |
"d3@0.9.0": | |
507, | |
"data-algebrae@1.0.0": | |
152, | |
"data-algebrae@2.0.0": | |
291, | |
"data-algebrae@2.1.0": | |
-348, | |
"data-algebrae@2.2.0": | |
-343, | |
"data-algebrae@2.2.1": | |
-374, | |
"data-algebrae@3.0.0": | |
-365, | |
"data-algebrae@3.1.0": | |
-380, | |
"data-algebrae@4.0.0": | |
398, | |
"data-default@0.1.0": | |
112, | |
"dataframe@0.1.0": | |
207, | |
"dataframe@0.1.1": | |
165, | |
"dataframe@0.1.2": | |
177, | |
"dataframe@0.1.3": | |
175, | |
"dataframe@0.1.4": | |
306, | |
"date-fns@1.0.0": | |
167, | |
"date-fns@1.0.1": | |
78, | |
"date-fns@1.0.2": | |
63, | |
"date-fns@1.0.3": | |
72, | |
"date-helpers@1.0.0": | |
101, | |
"datetime@0.0.1": | |
-60, | |
"datetime@0.1.0": | |
81, | |
"datetime@0.1.1": | |
68, | |
"datetime@0.1.2": | |
140, | |
"datetime@0.2.0": | |
-86, | |
"datetime@0.3.0": | |
78, | |
"datetime@0.3.1": | |
84, | |
"datetime@0.4.0": | |
79, | |
"datetime@0.5.0": | |
74, | |
"datetime@0.5.1": | |
77, | |
"datetime@0.5.2": | |
91, | |
"datetime@0.5.3": | |
108, | |
"datetime@0.6.0": | |
62, | |
"datetime@0.7.0": | |
61, | |
"datetime@0.8.0": | |
82, | |
"datetime@0.9.0": | |
78, | |
"datetime@0.9.1": | |
129, | |
"datetime@0.9.2": | |
71, | |
"datetime@1.0.0": | |
51, | |
"datetime@2.0.0": | |
137, | |
"datetime@2.1.0": | |
128, | |
"datetime@2.1.1": | |
129, | |
"datetime@2.2.0": | |
200, | |
"datetime@3.0.0": | |
164, | |
"datetime@3.1.0": | |
187, | |
"datetime@3.2.0": | |
192, | |
"datetime@3.3.0": | |
246, | |
"datetime@3.4.0": | |
319, | |
"datetime@3.4.1": | |
225, | |
"datetime@4.0.0": | |
114, | |
"datetime@4.1.0": | |
118, | |
"datetime@4.1.1": | |
132, | |
"datetime@5.0.0": | |
99, | |
"datetime@5.0.1": | |
100, | |
"datetime@5.0.2": | |
100, | |
"datetime@6.0.0": | |
198, | |
"datetime@6.1.0": | |
101, | |
"datetime-iso@1.0.0": | |
310, | |
"datetime-iso@1.0.1": | |
303, | |
"datetime-iso@1.0.2": | |
309, | |
"datetime-iso@2.0.0": | |
237, | |
"datetime-iso@2.0.2": | |
236, | |
"datetime-iso@3.0.0": | |
382, | |
"datetime-iso@4.0.0": | |
247, | |
"datetime-parsing@0.1.0": | |
95, | |
"datetime-parsing@0.2.0": | |
93, | |
"day@1.0.0": | |
65, | |
"day@2.0.0": | |
71, | |
"day@2.1.0": | |
63, | |
"day@3.0.0": | |
78, | |
"day@3.1.0": | |
184, | |
"day@4.0.0": | |
67, | |
"day@4.1.0": | |
59, | |
"day@5.0.0": | |
68, | |
"day@5.1.0": | |
72, | |
"day@6.0.0": | |
72, | |
"day@7.0.0": | |
319, | |
"day@8.0.0": | |
-350, | |
"day@9.0.0": | |
282, | |
"day@9.0.1": | |
265, | |
"day@9.1.0": | |
266, | |
"day@9.2.0": | |
273, | |
"day@10.0.0": | |
178, | |
"day@10.0.1": | |
179, | |
"debug@0.1.0": | |
56, | |
"debug@0.1.1": | |
101, | |
"debug@0.1.2": | |
42, | |
"debug@0.1.3": | |
43, | |
"debug@0.1.4": | |
59, | |
"debug@0.1.5": | |
58, | |
"debug@0.1.6": | |
114, | |
"debug@0.1.7": | |
49, | |
"debug@1.0.0": | |
43, | |
"debug@2.0.0": | |
43, | |
"debug@3.0.0": | |
64, | |
"debug@4.0.0": | |
62, | |
"debug@4.0.1": | |
59, | |
"debug@5.0.0": | |
59, | |
"debug@6.0.0": | |
122, | |
"debug@6.0.1": | |
48, | |
"debug@6.0.2": | |
42, | |
"debug-foreign@0.0.2": | |
48, | |
"debug-foreign@0.0.3": | |
55, | |
"debug-foreign@0.0.4": | |
57, | |
"debugged@0.1.0": | |
199, | |
"debugger@1.0.1": | |
191, | |
"debugger@2.0.0": | |
693, | |
"debugger@3.0.0": | |
177, | |
"debuggest@0.3.1": | |
49, | |
"debuggest@0.4.0": | |
59, | |
"debuggest@0.4.1": | |
59, | |
"debuggest@0.5.0": | |
60, | |
"debuggest@0.5.1": | |
60, | |
"decimal@1.0.0": | |
124, | |
"decimal@2.0.0": | |
52, | |
"decimals@1.0.0": | |
49, | |
"decimals@1.1.0": | |
52, | |
"decimals@1.2.0": | |
60, | |
"decimals@1.3.0": | |
60, | |
"decimals@1.4.0": | |
63, | |
"decimals@2.0.0": | |
122, | |
"decimals@2.1.0": | |
59, | |
"decimals@3.0.0": | |
54, | |
"decimals@3.1.0": | |
62, | |
"decimals@3.2.0": | |
61, | |
"decimals@3.3.0": | |
60, | |
"decimals@3.4.0": | |
103, | |
"decimals@4.0.0": | |
82, | |
"decimals@5.0.0": | |
44, | |
"decimals@6.0.0": | |
45, | |
"decimals@7.0.0": | |
60, | |
"decimals@7.1.0": | |
59, | |
"decision-theory@0.0.1": | |
121, | |
"decision-theory@0.0.2": | |
113, | |
"decision-theory@0.1.0": | |
166, | |
"decision-theory@0.1.1": | |
178, | |
"decision-theory@0.1.2": | |
139, | |
"default@1.0.0": | |
94, | |
"default@2.1.0": | |
147, | |
"default-values@1.0.0": | |
59, | |
"default-values@1.0.1": | |
83, | |
"deku@0.0.0": | |
-401, | |
"deku@0.0.1": | |
-524, | |
"deku@0.0.2": | |
-377, | |
"deku@0.0.3": | |
-375, | |
"deku@0.0.4": | |
-394, | |
"deku@0.0.5": | |
-395, | |
"deku@0.0.6": | |
-398, | |
"deku@0.0.7": | |
-401, | |
"deku@0.0.8": | |
-495, | |
"deku@0.1.0": | |
-386, | |
"deku@0.1.1": | |
-88, | |
"deku@0.1.2": | |
-96, | |
"deku@0.1.3": | |
-98, | |
"deku@0.2.1": | |
-99, | |
"deku@0.2.2": | |
-173, | |
"deku@0.2.3": | |
-90, | |
"deku@0.2.4": | |
-88, | |
"deku@0.2.5": | |
-97, | |
"deku@0.2.6": | |
-100, | |
"deku@0.3.0": | |
-409, | |
"deku@0.3.1": | |
-500, | |
"deku@0.3.2": | |
-384, | |
"deku@0.3.3": | |
-389, | |
"deku@0.3.4": | |
-402, | |
"deku@0.3.5": | |
-407, | |
"deku@0.3.6": | |
-474, | |
"deku@0.3.7": | |
-369, | |
"deku@0.3.8": | |
-359, | |
"deku@0.4.0": | |
-151, | |
"deku@0.4.1": | |
-175, | |
"deku@0.4.2": | |
-174, | |
"deku@0.4.3": | |
-255, | |
"deku@0.4.4": | |
-172, | |
"deku@0.4.5": | |
-166, | |
"deku@0.4.6": | |
-170, | |
"deku@0.4.7": | |
-179, | |
"deku@0.4.8": | |
-218, | |
"deku@0.4.9": | |
-218, | |
"deku@0.4.10": | |
-216, | |
"deku@0.4.11": | |
-322, | |
"deku@0.4.12": | |
-206, | |
"deku@0.4.13": | |
222, | |
"deku@0.5.2": | |
141, | |
"deku@0.6.0": | |
141, | |
"deku@0.6.1": | |
138, | |
"deku@0.8.1": | |
123, | |
"deku@0.8.2": | |
210, | |
"deku@0.8.3": | |
106, | |
"deku@0.8.4": | |
114, | |
"deku@0.8.5": | |
115, | |
"deku@0.8.6": | |
119, | |
"deku@0.9.0": | |
118, | |
"deku@0.9.1": | |
239, | |
"deku@0.9.2": | |
110, | |
"deku@0.9.3": | |
114, | |
"deku@0.9.4": | |
120, | |
"deku@0.9.5": | |
122, | |
"deno@0.0.2": | |
117, | |
"deno@0.0.3": | |
118, | |
"deno@0.0.4": | |
197, | |
"deno@0.0.5": | |
111, | |
"density-codensity@1.0.0": | |
52, | |
"density-codensity@1.0.1": | |
56, | |
"density-codensity@1.0.2": | |
110, | |
"des@0.0.1": | |
64, | |
"dexie@0.1.0": | |
119, | |
"dexie@0.1.1": | |
112, | |
"dexie@0.1.2": | |
199, | |
"dexie@0.2.0": | |
100, | |
"dexie@0.2.1": | |
98, | |
"dexie@0.3.0": | |
105, | |
"diff@0.0.0": | |
233, | |
"diff@0.0.1": | |
229, | |
"diff@0.0.2": | |
258, | |
"difference-containers@0.0.1": | |
67, | |
"difference-containers@0.0.2": | |
152, | |
"difference-containers@1.0.0": | |
76, | |
"difference-containers@1.0.1": | |
63, | |
"difflists@2.0.0": | |
58, | |
"difflists@2.0.1": | |
72, | |
"difflists@2.1.0": | |
72, | |
"difflists@3.0.0": | |
66, | |
"difflists@3.0.1": | |
65, | |
"digraph@0.1.0": | |
180, | |
"digraph@0.1.1": | |
68, | |
"digraph@0.1.2": | |
75, | |
"digraph@0.1.3": | |
81, | |
"digraph@0.2.0": | |
79, | |
"digraph@0.3.0": | |
80, | |
"digraph@0.4.0": | |
80, | |
"digraph@0.5.0": | |
342, | |
"digraph@1.0.0": | |
239, | |
"digraph@1.0.1": | |
169, | |
"digraph@1.0.2": | |
178, | |
"digraph@1.1.0": | |
187, | |
"digraph@1.1.1": | |
186, | |
"digraph@1.1.2": | |
186, | |
"digraph@1.1.3": | |
188, | |
"digraph@2.0.0": | |
217, | |
"dispatcher-react@1.0.0": | |
-383, | |
"dispatcher-react@2.0.0": | |
454, | |
"dispatcher-react@2.1.0": | |
444, | |
"dispatcher-react@3.0.0": | |
424, | |
"dispatcher-react@3.1.0": | |
437, | |
"dispatcher-react@4.0.0": | |
340, | |
"dissect@0.1.0": | |
52, | |
"dissect@1.0.0": | |
59, | |
"distributions@1.1.0": | |
59, | |
"distributions@2.0.0": | |
145, | |
"distributions@3.0.0": | |
180, | |
"distributions@4.0.0": | |
82, | |
"distributive@0.0.1": | |
-54, | |
"distributive@0.1.0": | |
-79, | |
"distributive@0.1.1": | |
-103, | |
"distributive@0.2.0": | |
57, | |
"distributive@0.3.0": | |
50, | |
"distributive@0.4.0": | |
71, | |
"distributive@0.4.1": | |
71, | |
"distributive@0.5.0": | |
63, | |
"distributive@0.5.1": | |
66, | |
"distributive@1.0.0": | |
61, | |
"distributive@2.0.0": | |
139, | |
"distributive@3.0.0": | |
54, | |
"distributive@4.0.0": | |
59, | |
"distributive@5.0.0": | |
52, | |
"distributive@6.0.0": | |
61, | |
"dodo-printer@1.0.0": | |
320, | |
"dodo-printer@1.0.1": | |
309, | |
"dodo-printer@1.0.2": | |
401, | |
"dodo-printer@1.0.3": | |
297, | |
"dodo-printer@1.0.4": | |
292, | |
"dodo-printer@1.0.5": | |
305, | |
"dodo-printer@1.0.6": | |
303, | |
"dodo-printer@1.0.7": | |
303, | |
"dodo-printer@1.0.8": | |
203, | |
"dodo-printer@1.0.9": | |
115, | |
"dodo-printer@1.1.0": | |
295, | |
"dodo-printer@1.1.1": | |
305, | |
"dodo-printer@2.0.0": | |
141, | |
"dodo-printer@2.1.0": | |
242, | |
"dodo-printer@2.2.0": | |
9487, | |
"dodo-printer@2.2.1": | |
117, | |
"dom@0.1.0": | |
54, | |
"dom@0.1.1": | |
52, | |
"dom@0.1.2": | |
134, | |
"dom@0.1.3": | |
49, | |
"dom@0.2.0": | |
89, | |
"dom@0.2.1": | |
66, | |
"dom@0.2.2": | |
75, | |
"dom@0.2.3": | |
76, | |
"dom@0.2.4": | |
77, | |
"dom@0.2.5": | |
74, | |
"dom@0.2.6": | |
145, | |
"dom@0.2.7": | |
76, | |
"dom@0.2.8": | |
58, | |
"dom@0.2.9": | |
58, | |
"dom@0.2.10": | |
73, | |
"dom@0.2.11": | |
75, | |
"dom@0.2.12": | |
73, | |
"dom@0.2.13": | |
76, | |
"dom@0.2.14": | |
153, | |
"dom@0.2.15": | |
78, | |
"dom@0.2.16": | |
63, | |
"dom@0.2.17": | |
61, | |
"dom@0.2.18": | |
76, | |
"dom@0.2.19": | |
76, | |
"dom@0.2.20": | |
78, | |
"dom@0.2.21": | |
79, | |
"dom@0.2.22": | |
157, | |
"dom@1.0.0": | |
65, | |
"dom@1.1.0": | |
50, | |
"dom@1.2.0": | |
51, | |
"dom@2.0.0": | |
-203, | |
"dom@2.0.1": | |
-196, | |
"dom@2.1.0": | |
-206, | |
"dom@2.2.0": | |
-207, | |
"dom@2.2.1": | |
-398, | |
"dom@3.0.0": | |
-239, | |
"dom@3.1.0": | |
298, | |
"dom@3.2.0": | |
-198, | |
"dom@3.3.0": | |
-533, | |
"dom@3.3.1": | |
-238, | |
"dom@3.4.0": | |
-241, | |
"dom@3.5.0": | |
-324, | |
"dom@3.5.1": | |
-1643, | |
"dom@3.6.0": | |
-290, | |
"dom@3.7.0": | |
-296, | |
"dom@3.8.0": | |
-354, | |
"dom@3.8.1": | |
-353, | |
"dom@4.0.0": | |
385, | |
"dom@4.1.0": | |
575, | |
"dom@4.1.1": | |
545, | |
"dom@4.2.0": | |
291, | |
"dom@4.3.0": | |
285, | |
"dom@4.3.1": | |
288, | |
"dom@4.4.0": | |
302, | |
"dom@4.4.1": | |
306, | |
"dom@4.5.0": | |
469, | |
"dom@4.6.0": | |
317, | |
"dom@4.6.1": | |
299, | |
"dom@4.7.0": | |
310, | |
"dom@4.8.0": | |
318, | |
"dom@4.8.1": | |
310, | |
"dom@4.8.2": | |
402, | |
"dom@4.8.3": | |
283, | |
"dom@4.9.0": | |
276, | |
"dom@4.10.0": | |
291, | |
"dom@4.11.0": | |
294, | |
"dom@4.12.0": | |
318, | |
"dom@4.13.0": | |
378, | |
"dom@4.13.1": | |
285, | |
"dom@4.13.2": | |
282, | |
"dom@4.14.0": | |
280, | |
"dom@4.15.0": | |
342, | |
"dom@4.16.0": | |
304, | |
"dom@5.0.0": | |
323, | |
"dom-classy@1.0.0": | |
-347, | |
"dom-classy@1.1.0": | |
-420, | |
"dom-classy@1.2.0": | |
-281, | |
"dom-classy@1.3.0": | |
-281, | |
"dom-classy@1.4.0": | |
-293, | |
"dom-classy@2.0.0": | |
751, | |
"dom-classy@2.1.0": | |
892, | |
"dom-classy@2.2.0": | |
739, | |
"dom-delegator@0.1.0": | |
43, | |
"dom-filereader@1.0.0": | |
543, | |
"dom-filereader@2.0.0": | |
814, | |
"dom-filereader@3.0.0": | |
790, | |
"dom-filereader@4.0.0": | |
453, | |
"dom-filereader@5.0.0": | |
519, | |
"dom-filereader@6.0.0": | |
154, | |
"dom-filereader@7.0.0": | |
119, | |
"dom-indexed@1.0.0": | |
-271, | |
"dom-indexed@1.0.1": | |
-277, | |
"dom-indexed@1.0.2": | |
-271, | |
"dom-indexed@1.1.0": | |
-359, | |
"dom-indexed@2.0.0": | |
-229, | |
"dom-indexed@3.0.0": | |
332, | |
"dom-indexed@4.0.0": | |
428, | |
"dom-indexed@5.0.0": | |
429, | |
"dom-indexed@6.0.0": | |
1142, | |
"dom-indexed@7.0.0": | |
1293, | |
"dom-indexed@8.0.0": | |
360, | |
"dom-indexed@8.0.1": | |
353, | |
"dom-indexed@9.0.0": | |
224, | |
"dom-indexed@10.0.0": | |
231, | |
"dom-indexed@11.0.0": | |
196, | |
"dom-parser@1.0.0": | |
500, | |
"dom-parser@2.0.1": | |
302, | |
"dom-parser@3.0.0": | |
397, | |
"dom-parser@4.0.0": | |
280, | |
"dominator-core@0.1.0": | |
359, | |
"dominator-core@0.1.1": | |
374, | |
"domparser@0.0.1": | |
56, | |
"dotenv@0.1.0": | |
352, | |
"dotenv@0.1.1": | |
425, | |
"dotenv@0.1.2": | |
325, | |
"dotenv@0.1.3": | |
325, | |
"dotenv@0.1.4": | |
344, | |
"dotenv@0.1.5": | |
353, | |
"dotenv@0.2.0": | |
341, | |
"dotenv@0.2.1": | |
433, | |
"dotenv@0.2.2": | |
324, | |
"dotenv@0.3.0": | |
366, | |
"dotenv@0.4.0": | |
341, | |
"dotenv@0.4.1": | |
337, | |
"dotenv@1.0.0": | |
365, | |
"dotenv@1.1.0": | |
480, | |
"dotenv@2.0.0": | |
-396, | |
"dotenv@3.0.0": | |
125, | |
"dotlang@1.0.0": | |
144, | |
"dotlang@1.0.1": | |
145, | |
"dotlang@1.0.2": | |
198, | |
"dotlang@1.1.0": | |
200, | |
"dotlang@1.2.0": | |
259, | |
"dotlang@2.0.0": | |
133, | |
"dotlang@3.0.1": | |
130, | |
"dotlang@3.1.0": | |
309, | |
"dotlang@4.0.0": | |
103, | |
"downloadjs@1.0.0": | |
317, | |
"drawing@0.1.0": | |
75, | |
"drawing@0.2.0": | |
157, | |
"drawing@0.3.0": | |
75, | |
"drawing@0.3.1": | |
60, | |
"drawing@0.3.2": | |
80, | |
"drawing@0.3.3": | |
89, | |
"drawing@0.3.4": | |
87, | |
"drawing@0.3.5": | |
80, | |
"drawing@0.3.6": | |
164, | |
"drawing@0.3.7": | |
73, | |
"drawing@0.3.8": | |
62, | |
"drawing@0.4.0": | |
-77, | |
"drawing@0.5.0": | |
84, | |
"drawing@1.0.0": | |
78, | |
"drawing@2.0.0": | |
183, | |
"drawing@2.1.0": | |
262, | |
"drawing@3.0.0": | |
181, | |
"drawing@4.0.0": | |
106, | |
"droplet@0.1.0": | |
147, | |
"droplet@0.2.0": | |
157, | |
"droplet@0.3.0": | |
169, | |
"droplet@0.4.0": | |
216, | |
"droplet@0.5.0": | |
127, | |
"dual-tree@0.0.2": | |
323, | |
"dynamic-buffer@1.0.0": | |
41, | |
"dynamic-buffer@1.0.1": | |
76, | |
"dynamic-buffer@2.0.0": | |
68, | |
"dynamic-buffer@3.0.0": | |
66, | |
"dynamic-buffer@3.0.1": | |
67, | |
"dynamodb@0.1.0": | |
-300, | |
"dynamodb@0.2.0": | |
-208, | |
"dynamodb@0.2.1": | |
-194, | |
"dynamodb@0.2.2": | |
-202, | |
"each@0.0.1": | |
-70, | |
"easings@1.0.0": | |
96, | |
"easings@1.0.1": | |
66, | |
"easings@2.0.0": | |
71, | |
"easings@2.1.0": | |
155, | |
"easy-alexa@0.0.1": | |
392, | |
"easy-alexa@0.0.2": | |
332, | |
"easy-alexa@0.0.3": | |
336, | |
"easy-alexa@0.0.4": | |
344, | |
"easy-alexa@0.0.5": | |
354, | |
"easy-alexa@0.0.6": | |
363, | |
"easy-alexa@0.0.7": | |
353, | |
"easy-alexa@0.0.8": | |
432, | |
"easy-alexa@0.0.9": | |
339, | |
"easy-alexa@0.0.10": | |
336, | |
"easy-ffi@1.0.0": | |
55, | |
"easy-ffi@1.0.1": | |
76, | |
"easy-ffi@1.0.2": | |
118, | |
"easy-ffi@2.0.0": | |
46, | |
"easy-ffi@2.1.0": | |
52, | |
"easy-ffi@2.1.2": | |
61, | |
"easyimage@0.1.0": | |
144, | |
"easyimage@0.2.0": | |
100, | |
"easyimage@0.3.0": | |
99, | |
"easyimage@1.0.0": | |
142, | |
"ebyam@0.1.0": | |
52, | |
"ebyam@0.1.1": | |
55, | |
"ebyam@1.0.0": | |
64, | |
"ebyam@1.2.0": | |
72, | |
"echarts@0.4.0": | |
163, | |
"echarts@0.4.1": | |
240, | |
"echarts@0.5.0": | |
132, | |
"echarts@0.6.0": | |
126, | |
"echarts@0.7.0": | |
126, | |
"echarts@1.0.0": | |
91, | |
"echarts@1.0.1": | |
89, | |
"echarts@2.0.0": | |
-275, | |
"echarts@3.0.0": | |
513, | |
"echarts@3.0.1": | |
601, | |
"echarts@3.1.0": | |
473, | |
"echarts@3.2.0": | |
475, | |
"echarts@4.0.0": | |
629, | |
"echarts@4.0.1": | |
635, | |
"echarts@4.0.2": | |
737, | |
"echarts@4.1.0": | |
616, | |
"echarts@5.0.0": | |
678, | |
"echarts@6.0.0": | |
527, | |
"echarts@6.1.0": | |
536, | |
"echarts@7.0.0": | |
536, | |
"echarts@7.0.1": | |
543, | |
"echarts@8.0.0": | |
689, | |
"echarts@8.0.1": | |
569, | |
"echarts@9.0.0": | |
558, | |
"echarts@9.1.0": | |
586, | |
"echarts@10.0.0": | |
364, | |
"echarts@10.1.0": | |
365, | |
"eff@0.1.0": | |
66, | |
"eff@0.1.1": | |
76, | |
"eff@0.1.2": | |
120, | |
"eff@1.0.0": | |
44, | |
"eff@2.0.0": | |
52, | |
"eff@3.0.0": | |
61, | |
"eff@3.1.0": | |
66, | |
"eff@3.2.0": | |
71, | |
"eff@3.2.1": | |
75, | |
"eff@3.2.2": | |
69, | |
"eff@3.2.3": | |
72, | |
"eff-functions@0.1.2": | |
123, | |
"eff-functions@1.0.0": | |
43, | |
"eff-functions@2.0.0": | |
52, | |
"eff-object@0.0.0": | |
68, | |
"eff-object@0.0.1": | |
74, | |
"effect@0.1.0": | |
56, | |
"effect@1.0.0": | |
71, | |
"effect@1.1.0": | |
97, | |
"effect@2.0.0": | |
102, | |
"effect@2.0.1": | |
44, | |
"effect@3.0.0": | |
51, | |
"effect@4.0.0": | |
68, | |
"effectful@1.0.0": | |
126, | |
"either@0.1.0": | |
59, | |
"either@0.1.1": | |
74, | |
"either@0.1.2": | |
69, | |
"either@0.1.3": | |
132, | |
"either@0.1.4": | |
46, | |
"either@0.1.5": | |
49, | |
"either@0.1.6": | |
59, | |
"either@0.1.7": | |
65, | |
"either@0.1.8": | |
73, | |
"either@0.2.0": | |
88, | |
"either@0.2.1": | |
124, | |
"either@0.2.2": | |
57, | |
"either@0.2.3": | |
66, | |
"either@1.0.0": | |
54, | |
"either@2.0.0": | |
83, | |
"either@2.1.0": | |
73, | |
"either@2.2.0": | |
155, | |
"either@2.2.1": | |
93, | |
"either@3.0.0": | |
55, | |
"either@3.1.0": | |
73, | |
"either@3.2.0": | |
79, | |
"either@4.0.0": | |
67, | |
"either@4.1.0": | |
68, | |
"either@4.1.1": | |
72, | |
"either@5.0.0": | |
137, | |
"either@6.0.0": | |
56, | |
"either@6.1.0": | |
57, | |
"either-extra@0.0.2": | |
64, | |
"either-extra@0.0.3": | |
91, | |
"either-extra@0.0.4": | |
79, | |
"ejson@1.0.0": | |
112, | |
"ejson@2.0.0": | |
-458, | |
"ejson@2.1.0": | |
-351, | |
"ejson@3.0.0": | |
-340, | |
"ejson@3.1.0": | |
-358, | |
"ejson@4.0.0": | |
-376, | |
"ejson@4.1.0": | |
-372, | |
"ejson@5.0.0": | |
-501, | |
"ejson@6.0.0": | |
-606, | |
"ejson@7.0.0": | |
-479, | |
"ejson@7.1.0": | |
-472, | |
"ejson@8.0.0": | |
-487, | |
"ejson@9.0.0": | |
767, | |
"ejson@10.0.0": | |
1005, | |
"ejson@10.0.1": | |
1110, | |
"ejson@11.0.0": | |
244, | |
"ejson@12.0.0": | |
357, | |
"ejson@13.0.0": | |
112, | |
"elasticsearch@0.1.0": | |
162, | |
"elasticsearch@0.1.1": | |
162, | |
"electron@0.0.1": | |
246, | |
"electron@0.1.0": | |
69, | |
"electron@0.1.1": | |
123, | |
"electron@0.2.0": | |
107, | |
"electron@0.2.1": | |
198, | |
"electron@0.3.0": | |
245, | |
"electron@0.3.1": | |
239, | |
"electron@0.4.0": | |
239, | |
"electron@0.5.0": | |
239, | |
"electron@0.5.1": | |
246, | |
"electron@0.6.0": | |
252, | |
"electron@0.7.0": | |
345, | |
"electron@1.0.0": | |
221, | |
"electron@1.0.1": | |
239, | |
"elm-color@0.1.0": | |
65, | |
"elm-compat@0.0.0": | |
85, | |
"elm-compat@1.0.0": | |
86, | |
"elm-compat@2.0.0": | |
534, | |
"elm-compat@2.0.1": | |
378, | |
"elm-compat@3.0.0": | |
412, | |
"elm-license-checker@1.0.0": | |
273, | |
"elm-license-checker@2.0.0": | |
276, | |
"elm-license-checker@2.1.0": | |
278, | |
"elm-license-checker@2.2.0": | |
281, | |
"elm-license-checker@2.2.1": | |
370, | |
"elm-license-checker@2.3.0": | |
362, | |
"elm-license-checker@2.4.0": | |
377, | |
"elmish@0.0.1": | |
308, | |
"elmish@0.0.2": | |
314, | |
"elmish@0.0.3": | |
310, | |
"elmish@0.0.4": | |
406, | |
"elmish@0.0.5": | |
297, | |
"elmish@0.1.0": | |
305, | |
"elmish@0.1.1": | |
306, | |
"elmish@0.1.2": | |
302, | |
"elmish@0.1.3": | |
305, | |
"elmish@0.1.4": | |
392, | |
"elmish@0.1.5": | |
293, | |
"elmish@0.1.6": | |
290, | |
"elmish@0.2.0": | |
302, | |
"elmish@0.2.1": | |
318, | |
"elmish@0.2.2": | |
302, | |
"elmish@0.3.0": | |
296, | |
"elmish@0.3.1": | |
297, | |
"elmish@0.3.2": | |
390, | |
"elmish@0.4.0": | |
-126, | |
"elmish@0.5.0": | |
136, | |
"elmish@0.5.1": | |
138, | |
"elmish@0.5.2": | |
139, | |
"elmish@0.5.3": | |
140, | |
"elmish@0.5.4": | |
232, | |
"elmish@0.5.5": | |
127, | |
"elmish@0.5.6": | |
141, | |
"elmish@0.5.7": | |
149, | |
"elmish@0.5.8": | |
144, | |
"elmish@0.6.0": | |
149, | |
"elmish@0.7.0": | |
144, | |
"elmish@0.8.0": | |
243, | |
"elmish@0.8.1": | |
116, | |
"elmish@0.8.2": | |
118, | |
"elmish@0.8.3": | |
127, | |
"elmish-enzyme@0.0.1": | |
150, | |
"elmish-enzyme@0.0.2": | |
151, | |
"elmish-enzyme@0.0.3": | |
235, | |
"elmish-enzyme@0.1.0": | |
140, | |
"elmish-enzyme@0.1.1": | |
122, | |
"elmish-hooks@0.0.1": | |
146, | |
"elmish-hooks@0.1.0": | |
142, | |
"elmish-hooks@0.2.0": | |
153, | |
"elmish-hooks@0.3.0": | |
154, | |
"elmish-hooks@0.3.1": | |
150, | |
"elmish-hooks@0.4.0": | |
293, | |
"elmish-hooks@0.4.1": | |
132, | |
"elmish-hooks@0.4.2": | |
137, | |
"elmish-hooks@0.5.0": | |
144, | |
"elmish-hooks@0.5.1": | |
142, | |
"elmish-hooks@0.5.2": | |
143, | |
"elmish-hooks@0.6.0": | |
149, | |
"elmish-hooks@0.6.1": | |
145, | |
"elmish-hooks@0.7.0": | |
234, | |
"elmish-hooks@0.8.0": | |
136, | |
"elmish-hooks@0.8.1": | |
230, | |
"elmish-hooks@0.8.2": | |
228, | |
"elmish-hooks@0.8.3": | |
126, | |
"elmish-html@0.0.1": | |
526, | |
"elmish-html@0.0.2": | |
423, | |
"elmish-html@0.0.3": | |
439, | |
"elmish-html@0.0.4": | |
352, | |
"elmish-html@0.1.0": | |
357, | |
"elmish-html@0.1.1": | |
456, | |
"elmish-html@0.1.2": | |
348, | |
"elmish-html@0.1.3": | |
348, | |
"elmish-html@0.1.4": | |
363, | |
"elmish-html@0.2.0": | |
333, | |
"elmish-html@0.3.0": | |
184, | |
"elmish-html@0.3.1": | |
183, | |
"elmish-html@0.4.0": | |
167, | |
"elmish-html@0.5.0": | |
273, | |
"elmish-html@0.6.0": | |
151, | |
"elmish-html@0.7.0": | |
162, | |
"elmish-html@0.7.1": | |
231, | |
"elmish-html@0.7.2": | |
144, | |
"elmish-testing-library@0.1.0": | |
265, | |
"elmish-testing-library@0.1.1": | |
396, | |
"elmish-testing-library@0.1.2": | |
267, | |
"elmish-testing-library@0.1.3": | |
257, | |
"elmish-testing-library@0.1.4": | |
263, | |
"elmish-testing-library@0.1.5": | |
265, | |
"elmish-testing-library@0.1.6": | |
266, | |
"elmish-testing-library@0.2.0": | |
268, | |
"elmish-testing-library@0.3.0": | |
219, | |
"elmish-testing-library@0.3.1": | |
118, | |
"email-validate@0.0.0": | |
79, | |
"email-validate@1.0.1": | |
92, | |
"email-validate@1.0.2": | |
88, | |
"email-validate@1.0.3": | |
95, | |
"email-validate@1.0.4": | |
92, | |
"email-validate@1.0.5": | |
93, | |
"email-validate@1.0.6": | |
170, | |
"email-validate@1.0.7": | |
426, | |
"email-validate@2.0.0": | |
362, | |
"email-validate@3.0.0": | |
208, | |
"email-validate@3.0.1": | |
208, | |
"email-validate@4.0.0": | |
211, | |
"email-validate@5.0.0": | |
209, | |
"email-validate@6.0.0": | |
116, | |
"email-validate@7.0.0": | |
213, | |
"emmet@1.0.2": | |
467, | |
"emmet@1.0.3": | |
225, | |
"emmet@1.0.4": | |
231, | |
"emo8@0.1.0": | |
648, | |
"emo8@0.2.0": | |
651, | |
"emo8@0.3.0": | |
794, | |
"emo8@0.4.0": | |
628, | |
"emo8@0.5.0": | |
594, | |
"emo8@0.5.1": | |
594, | |
"emo8@0.6.0": | |
656, | |
"emo8@0.7.0": | |
368, | |
"emo8@0.7.1": | |
456, | |
"emoji-splitter@0.1.0": | |
116, | |
"emoji-splitter@0.2.0": | |
114, | |
"emoji-splitter@0.2.1": | |
124, | |
"encoding@0.0.1": | |
66, | |
"encoding@0.0.2": | |
72, | |
"encoding@0.0.3": | |
74, | |
"encoding@0.0.4": | |
81, | |
"encoding@0.0.5": | |
151, | |
"encoding@0.0.6": | |
82, | |
"encoding@0.0.7": | |
49, | |
"encoding@0.0.8": | |
75, | |
"enums@0.2.2": | |
71, | |
"enums@0.2.3": | |
70, | |
"enums@0.2.4": | |
77, | |
"enums@0.3.0": | |
-72, | |
"enums@0.3.1": | |
-120, | |
"enums@0.4.0": | |
100, | |
"enums@0.5.0": | |
59, | |
"enums@0.6.0": | |
81, | |
"enums@0.7.0": | |
74, | |
"enums@1.0.0": | |
65, | |
"enums@1.1.0": | |
67, | |
"enums@2.0.0": | |
84, | |
"enums@2.0.1": | |
152, | |
"enums@3.0.0": | |
183, | |
"enums@3.1.0": | |
182, | |
"enums@3.2.0": | |
193, | |
"enums@3.2.1": | |
191, | |
"enums@4.0.0": | |
89, | |
"enums@4.0.1": | |
88, | |
"enums@5.0.0": | |
85, | |
"enums@6.0.0": | |
142, | |
"enums@6.0.1": | |
76, | |
"envparse@1.0.1": | |
99, | |
"enzyme@0.0.1": | |
758, | |
"enzyme@0.1.0": | |
736, | |
"enzyme@0.1.1": | |
733, | |
"enzyme@0.2.0": | |
732, | |
"enzyme@0.3.0": | |
850, | |
"enzyme@0.4.0": | |
716, | |
"enzyme@0.5.0": | |
718, | |
"enzyme@0.6.0": | |
731, | |
"enzyme@0.6.1": | |
745, | |
"enzyme@0.7.0": | |
733, | |
"enzyme@0.7.1": | |
730, | |
"enzyme@0.8.0": | |
844, | |
"equatable-functions@1.0.0": | |
44, | |
"equatable-functions@1.0.1": | |
56, | |
"equatable-functions@1.0.2": | |
69, | |
"equatable-functions@1.0.3": | |
68, | |
"erlps-core@0.0.1": | |
364, | |
"erlps-core@0.0.2": | |
357, | |
"erlps-core@0.0.3": | |
362, | |
"erlps-core@0.0.4": | |
485, | |
"error@1.0.1": | |
41, | |
"error@1.0.2": | |
63, | |
"error@2.0.0": | |
83, | |
"errors@0.1.0": | |
83, | |
"errors@0.1.1": | |
78, | |
"errors@0.1.2": | |
79, | |
"errors@0.1.3": | |
136, | |
"errors@0.1.4": | |
69, | |
"errors@0.2.0": | |
79, | |
"errors@0.3.0": | |
78, | |
"errors@1.0.0": | |
71, | |
"errors@2.0.0": | |
119, | |
"errors@2.1.0": | |
208, | |
"errors@2.2.0": | |
91, | |
"errors@2.3.0": | |
91, | |
"errors@2.4.0": | |
103, | |
"errors@3.0.0": | |
154, | |
"errors@4.0.0": | |
89, | |
"errors@4.0.1": | |
90, | |
"errors@4.1.0": | |
90, | |
"es6-symbols@1.0.0": | |
123, | |
"es6-symbols@1.0.1": | |
57, | |
"es6-symbols@1.0.2": | |
89, | |
"eth-core@0.0.1": | |
-465, | |
"eth-core@0.1.0": | |
-434, | |
"eth-core@1.0.0": | |
498, | |
"eth-core@1.1.0": | |
639, | |
"eth-core@2.0.0": | |
476, | |
"eth-core@3.0.0": | |
409, | |
"eth-core@4.0.0": | |
451, | |
"eth-core@5.0.0": | |
430, | |
"ethereum@0.1.0": | |
281, | |
"ethereum@0.2.1": | |
284, | |
"ethereum@0.2.2": | |
406, | |
"ethereum@0.2.3": | |
268, | |
"ethereum@0.2.4": | |
275, | |
"ethereum@0.2.5": | |
282, | |
"ethereum@0.2.6": | |
282, | |
"ethereum@0.2.7": | |
284, | |
"ethereum@0.2.8": | |
284, | |
"ethereum@0.2.9": | |
369, | |
"ethereum@0.2.10": | |
273, | |
"ethereum-client@0.1.0": | |
996, | |
"eulalie@1.0.0": | |
88, | |
"eulalie@2.0.0": | |
73, | |
"eulalie@3.0.0": | |
75, | |
"eulalie@4.0.0": | |
-186, | |
"eulalie@4.1.0": | |
201, | |
"eulalie@5.0.0": | |
336, | |
"eval@1.0.0": | |
43, | |
"eval@1.0.1": | |
65, | |
"eval@1.1.0": | |
59, | |
"event@1.0.0": | |
198, | |
"event@1.1.0": | |
205, | |
"event@1.2.0": | |
332, | |
"event@1.2.1": | |
240, | |
"event@1.2.2": | |
235, | |
"event@1.2.3": | |
248, | |
"event@1.2.4": | |
251, | |
"event@1.3.0": | |
249, | |
"exceptions@0.1.0": | |
63, | |
"exceptions@0.2.0": | |
64, | |
"exceptions@0.2.1": | |
140, | |
"exceptions@0.2.2": | |
52, | |
"exceptions@0.2.3": | |
56, | |
"exceptions@0.3.0": | |
68, | |
"exceptions@0.3.1": | |
69, | |
"exceptions@0.3.2": | |
65, | |
"exceptions@0.3.3": | |
61, | |
"exceptions@0.3.4": | |
155, | |
"exceptions@1.0.0": | |
59, | |
"exceptions@2.0.0": | |
64, | |
"exceptions@3.0.0": | |
87, | |
"exceptions@3.1.0": | |
83, | |
"exceptions@4.0.0": | |
73, | |
"exceptions@5.0.0": | |
73, | |
"exceptions@6.0.0": | |
72, | |
"exists@0.1.0": | |
90, | |
"exists@0.1.1": | |
107, | |
"exists@0.2.0": | |
45, | |
"exists@1.0.0": | |
73, | |
"exists@2.0.0": | |
67, | |
"exists@3.0.0": | |
61, | |
"exists@4.0.0": | |
73, | |
"exists@5.0.0": | |
67, | |
"exists@5.1.0": | |
63, | |
"exists@6.0.0": | |
133, | |
"exists-eq@1.0.0": | |
49, | |
"exists-eq@1.0.1": | |
62, | |
"exists-eq@1.0.2": | |
67, | |
"exists-eq@1.0.3": | |
69, | |
"exitcodes@1.0.0": | |
71, | |
"exitcodes@2.0.0": | |
112, | |
"exitcodes@3.0.0": | |
460, | |
"exitcodes@4.0.0": | |
74, | |
"expect-inferred@0.1.0": | |
52, | |
"expect-inferred@0.2.0": | |
69, | |
"expect-inferred@1.0.0": | |
66, | |
"expect-inferred@2.0.0": | |
66, | |
"expect-inferred@3.0.0": | |
129, | |
"express@0.1.5": | |
-85, | |
"express@0.2.0": | |
88, | |
"express@0.3.0": | |
117, | |
"express@0.3.1": | |
106, | |
"express@0.3.2": | |
100, | |
"express@0.3.3": | |
92, | |
"express@0.4.0": | |
188, | |
"express@0.4.1": | |
381, | |
"express@0.4.2": | |
358, | |
"express@0.4.3": | |
367, | |
"express@0.5.0": | |
407, | |
"express@0.5.1": | |
618, | |
"express@0.5.2": | |
704, | |
"express@0.6.0": | |
496, | |
"express@0.6.1": | |
504, | |
"express@0.6.2": | |
508, | |
"express@0.6.3": | |
517, | |
"express@0.6.4": | |
516, | |
"express@0.7.0": | |
373, | |
"express@0.7.1": | |
637, | |
"express@0.8.0": | |
521, | |
"express@0.9.0": | |
194, | |
"express-passport@0.0.2": | |
-463, | |
"express-passport@0.0.4": | |
-464, | |
"express-passport@0.0.5": | |
914, | |
"extensions@1.0.0": | |
83, | |
"extensions@1.0.1": | |
113, | |
"extensions@1.0.2": | |
49, | |
"extensions@1.0.3": | |
75, | |
"extensions@1.0.4": | |
72, | |
"extensions@1.0.5": | |
70, | |
"extensions@1.1.0": | |
158, | |
"extensions@1.2.0": | |
189, | |
"extensions@1.2.1": | |
171, | |
"extensions@1.2.2": | |
283, | |
"extensions@2.0.0": | |
221, | |
"extensions@2.1.0": | |
205, | |
"extensions@2.1.1": | |
212, | |
"extensions@2.1.2": | |
212, | |
"extensions@2.1.3": | |
217, | |
"extensions@2.1.4": | |
210, | |
"extensions@2.1.5": | |
378, | |
"extensions@2.1.6": | |
269, | |
"extensions@2.2.0": | |
267, | |
"extensions@2.2.1": | |
278, | |
"extensions@2.2.2": | |
274, | |
"extensions@2.3.0": | |
275, | |
"extensions@2.3.1": | |
399, | |
"extensions@2.3.2": | |
266, | |
"extensions@2.3.3": | |
265, | |
"extensions@2.3.4": | |
274, | |
"extensions@2.3.5": | |
275, | |
"extensions@2.3.6": | |
274, | |
"extensions@2.3.7": | |
278, | |
"extensions@2.3.8": | |
404, | |
"externs-check@0.1.0": | |
1192, | |
"externs-check@0.1.1": | |
1204, | |
"externs-check@0.2.0": | |
837, | |
"externs-check@0.2.1": | |
842, | |
"externs-check@1.0.0": | |
812, | |
"externs-check@2.0.0": | |
324, | |
"externs-check@2.0.1": | |
436, | |
"facebook@0.0.1": | |
385, | |
"facebook@0.1.0": | |
403, | |
"facebook@0.2.0": | |
436, | |
"facebook@0.2.1": | |
380, | |
"facebook@0.2.2": | |
379, | |
"facebook@0.2.3": | |
492, | |
"facebook@0.3.0": | |
308, | |
"fahrtwind@1.0.1": | |
126, | |
"fallback@0.1.0": | |
77, | |
"fancy-operators@1.0.0": | |
61, | |
"fast-vect@0.1.0": | |
196, | |
"fast-vect@0.1.1": | |
302, | |
"fast-vect@0.1.2": | |
71, | |
"fast-vect@0.2.0": | |
79, | |
"fast-vect@0.3.0": | |
188, | |
"fast-vect@0.3.1": | |
87, | |
"fast-vect@0.5.0": | |
184, | |
"fast-vect@0.5.1": | |
100, | |
"fast-vect@0.6.0": | |
163, | |
"fast-vect@0.6.2": | |
71, | |
"fast-vect@0.7.0": | |
83, | |
"fast-vect@1.0.0": | |
93, | |
"fetch@1.0.0": | |
127, | |
"fetch@1.0.1": | |
129, | |
"fetch@1.1.0": | |
127, | |
"fetch@1.1.1": | |
252, | |
"fetch@1.1.2": | |
115, | |
"fetch@1.1.3": | |
115, | |
"fetch@1.1.4": | |
128, | |
"fetch-api@1.0.0": | |
412, | |
"fetch-argonaut@1.0.0": | |
123, | |
"fetch-core@4.0.3": | |
115, | |
"fetch-core@4.0.4": | |
116, | |
"fetch-free@0.1.0": | |
589, | |
"fetch-free@0.1.1": | |
433, | |
"fetch-yoga-json@1.0.1": | |
96, | |
"fetch-yoga-json@1.1.0": | |
116, | |
"ffi-foreign@0.0.1": | |
177, | |
"ffi-foreign@0.0.2": | |
179, | |
"ffi-props@0.1.0": | |
66, | |
"ffi-utils@1.0.0": | |
347, | |
"ffi-utils@1.1.0": | |
218, | |
"ffi-utils@1.2.0": | |
219, | |
"ffi-utils@1.3.0": | |
231, | |
"ffi-utils@1.4.0": | |
233, | |
"ffi-utils@2.0.0": | |
373, | |
"ffi-utils@2.0.1": | |
369, | |
"ffi-utils@3.0.0": | |
393, | |
"ffi-utils@4.0.0": | |
510, | |
"filterable@0.1.0": | |
47, | |
"filterable@0.1.1": | |
62, | |
"filterable@0.1.2": | |
74, | |
"filterable@0.1.3": | |
61, | |
"filterable@1.0.0": | |
103, | |
"filterable@1.1.0": | |
161, | |
"filterable@2.0.0": | |
133, | |
"filterable@2.0.1": | |
106, | |
"filterable@2.1.0": | |
173, | |
"filterable@2.2.0": | |
534, | |
"filterable@2.3.0": | |
207, | |
"filterable@2.4.0": | |
205, | |
"filterable@2.4.1": | |
208, | |
"filterable@3.0.0": | |
242, | |
"filterable@3.0.1": | |
121, | |
"filterable@3.0.2": | |
122, | |
"filterable@4.0.0": | |
98, | |
"filterable@4.0.1": | |
98, | |
"filterable@5.0.0": | |
83, | |
"filterables@0.1.0": | |
507, | |
"firebase@3.0.0": | |
-461, | |
"firebase@4.0.0": | |
-546, | |
"firebase-client@0.0.1": | |
-180, | |
"firebase-client@1.0.0": | |
-202, | |
"firebase-client@1.1.0": | |
-203, | |
"fixed-points@0.1.0": | |
64, | |
"fixed-points@0.2.0": | |
124, | |
"fixed-points@1.0.0": | |
50, | |
"fixed-points@2.0.0": | |
57, | |
"fixed-points@3.0.0": | |
74, | |
"fixed-points@4.0.0": | |
213, | |
"fixed-points@5.0.0": | |
91, | |
"fixed-points@5.1.0": | |
90, | |
"fixed-points@6.0.0": | |
163, | |
"fixed-points@7.0.0": | |
181, | |
"fixed-precision@1.0.0": | |
286, | |
"fixed-precision@2.0.0": | |
265, | |
"fixed-precision@3.0.0": | |
147, | |
"fixed-precision@3.0.1": | |
140, | |
"fixed-precision@4.0.0": | |
125, | |
"fixed-precision@4.0.1": | |
126, | |
"fixed-precision@4.1.0": | |
238, | |
"fixed-precision@4.2.0": | |
117, | |
"fixed-precision@4.3.0": | |
111, | |
"fixed-precision@4.3.1": | |
129, | |
"fixed-precision@5.0.0": | |
95, | |
"flame@0.0.1": | |
311, | |
"flame@0.2.0": | |
312, | |
"flame@0.3.0": | |
310, | |
"flame@0.3.1": | |
438, | |
"flame@0.4.0": | |
295, | |
"flame@0.4.1": | |
309, | |
"flame@0.4.2": | |
306, | |
"flame@0.4.3": | |
317, | |
"flame@0.4.4": | |
307, | |
"flame@0.4.5": | |
432, | |
"flame@0.5.0": | |
292, | |
"flame@0.5.1": | |
357, | |
"flame@0.5.2": | |
370, | |
"flame@0.5.3": | |
367, | |
"flame@0.5.4": | |
368, | |
"flame@0.6.0": | |
452, | |
"flame@0.6.1": | |
357, | |
"flame@0.6.2": | |
352, | |
"flame@0.6.3": | |
354, | |
"flame@0.7.0": | |
356, | |
"flame@1.0.0": | |
345, | |
"flame@1.1.0": | |
154, | |
"flame@1.1.1": | |
146, | |
"flame@1.1.2": | |
239, | |
"flame@1.2.0": | |
145, | |
"flare@0.1.0": | |
108, | |
"flare@0.1.1": | |
109, | |
"flare@0.1.2": | |
112, | |
"flare@0.1.3": | |
110, | |
"flare@0.1.4": | |
204, | |
"flare@0.1.5": | |
99, | |
"flare@0.1.6": | |
101, | |
"flare@0.1.7": | |
112, | |
"flare@0.2.0": | |
-105, | |
"flare@0.2.1": | |
-104, | |
"flare@0.3.0": | |
-102, | |
"flare@0.4.0": | |
-192, | |
"flare@0.4.1": | |
-95, | |
"flare@0.4.2": | |
-99, | |
"flare@0.4.3": | |
-104, | |
"flare@0.5.0": | |
-114, | |
"flare@0.5.1": | |
-113, | |
"flare@1.0.0": | |
180, | |
"flare@1.0.1": | |
82, | |
"flare@1.1.0": | |
-207, | |
"flare@2.0.0": | |
-470, | |
"flare@2.0.1": | |
-468, | |
"flare@3.0.0": | |
469, | |
"flare@3.1.0": | |
602, | |
"flare@3.2.0": | |
450, | |
"flare@4.0.0": | |
559, | |
"flare@4.1.0": | |
551, | |
"flare@5.0.0": | |
283, | |
"flare@6.0.0": | |
273, | |
"flaredoc@4.0.0": | |
1852, | |
"flatpickr@0.1.0": | |
-286, | |
"flatpickr@1.0.0": | |
672, | |
"float32@0.0.0": | |
101, | |
"float32@0.0.1": | |
101, | |
"float32@0.0.2": | |
190, | |
"float32@0.1.0": | |
88, | |
"float32@0.1.1": | |
97, | |
"float32@0.2.0": | |
100, | |
"float32@1.0.0": | |
85, | |
"float32@2.0.0": | |
78, | |
"flow-id@0.1.1": | |
229, | |
"flow-id@0.1.2": | |
326, | |
"flow-id@1.0.0": | |
238, | |
"foldable-traversable@0.1.6": | |
52, | |
"foldable-traversable@0.2.0": | |
77, | |
"foldable-traversable@0.2.1": | |
69, | |
"foldable-traversable@0.3.0": | |
77, | |
"foldable-traversable@0.3.1": | |
72, | |
"foldable-traversable@0.4.0": | |
133, | |
"foldable-traversable@0.4.1": | |
65, | |
"foldable-traversable@0.4.2": | |
65, | |
"foldable-traversable@1.0.0": | |
69, | |
"foldable-traversable@2.0.0": | |
74, | |
"foldable-traversable@2.1.0": | |
75, | |
"foldable-traversable@2.2.0": | |
75, | |
"foldable-traversable@3.0.0": | |
121, | |
"foldable-traversable@3.1.0": | |
49, | |
"foldable-traversable@3.2.0": | |
77, | |
"foldable-traversable@3.3.0": | |
69, | |
"foldable-traversable@3.3.1": | |
74, | |
"foldable-traversable@3.4.0": | |
71, | |
"foldable-traversable@3.5.0": | |
111, | |
"foldable-traversable@3.6.0": | |
57, | |
"foldable-traversable@3.6.1": | |
71, | |
"foldable-traversable@3.7.0": | |
72, | |
"foldable-traversable@3.7.1": | |
71, | |
"foldable-traversable@4.0.0": | |
90, | |
"foldable-traversable@4.0.1": | |
123, | |
"foldable-traversable@4.1.0": | |
47, | |
"foldable-traversable@4.1.1": | |
73, | |
"foldable-traversable@5.0.0": | |
80, | |
"foldable-traversable@5.0.1": | |
79, | |
"foldable-traversable@6.0.0": | |
72, | |
"folds@1.0.1": | |
71, | |
"folds@2.0.0": | |
86, | |
"folds@3.0.0": | |
213, | |
"folds@3.1.0": | |
112, | |
"folds@4.0.0": | |
71, | |
"folds@5.0.0": | |
114, | |
"folds@5.1.0": | |
108, | |
"folds@5.2.0": | |
106, | |
"foreign@0.3.0": | |
76, | |
"foreign@0.4.0": | |
151, | |
"foreign@0.4.1": | |
75, | |
"foreign@0.4.2": | |
51, | |
"foreign@0.5.0": | |
83, | |
"foreign@0.5.1": | |
80, | |
"foreign@0.6.0": | |
83, | |
"foreign@0.7.0": | |
84, | |
"foreign@0.7.1": | |
78, | |
"foreign@0.7.2": | |
149, | |
"foreign@1.0.0": | |
84, | |
"foreign@1.1.0": | |
47, | |
"foreign@2.0.0": | |
138, | |
"foreign@3.0.0": | |
174, | |
"foreign@3.0.1": | |
154, | |
"foreign@3.1.0": | |
165, | |
"foreign@3.2.0": | |
151, | |
"foreign@4.0.0": | |
290, | |
"foreign@4.0.1": | |
217, | |
"foreign@5.0.0": | |
123, | |
"foreign@6.0.0": | |
101, | |
"foreign@6.0.1": | |
100, | |
"foreign@7.0.0": | |
90, | |
"foreign-clone@0.0.1": | |
178, | |
"foreign-datetime@0.1.0": | |
200, | |
"foreign-datetime@1.0.0": | |
322, | |
"foreign-datetime@2.0.0": | |
283, | |
"foreign-datetime@2.0.1": | |
536, | |
"foreign-datetime@3.0.0": | |
388, | |
"foreign-extra@0.3.0": | |
76, | |
"foreign-extra@0.4.0": | |
84, | |
"foreign-extra@0.4.1": | |
74, | |
"foreign-extra@0.4.2": | |
134, | |
"foreign-extra@0.5.0": | |
74, | |
"foreign-extra@0.5.1": | |
57, | |
"foreign-extra@0.6.0": | |
85, | |
"foreign-extra@0.7.0": | |
87, | |
"foreign-extra@0.7.1": | |
77, | |
"foreign-extra@0.7.2": | |
78, | |
"foreign-generic@1.0.1": | |
78, | |
"foreign-generic@2.0.0": | |
323, | |
"foreign-generic@3.0.0": | |
189, | |
"foreign-generic@4.0.0": | |
216, | |
"foreign-generic@4.1.0": | |
308, | |
"foreign-generic@4.2.0": | |
269, | |
"foreign-generic@4.3.0": | |
259, | |
"foreign-generic@5.0.0": | |
266, | |
"foreign-generic@5.0.1": | |
257, | |
"foreign-generic@6.0.0": | |
372, | |
"foreign-generic@7.0.0": | |
141, | |
"foreign-generic@8.0.0": | |
146, | |
"foreign-generic@8.1.0": | |
185, | |
"foreign-generic@9.0.0": | |
162, | |
"foreign-generic@10.0.0": | |
163, | |
"foreign-generic@11.0.0": | |
112, | |
"foreign-lens@1.0.1": | |
168, | |
"foreign-lens@2.0.0": | |
365, | |
"foreign-lens@3.0.0": | |
405, | |
"foreign-object@1.0.0": | |
102, | |
"foreign-object@1.1.0": | |
101, | |
"foreign-object@2.0.0": | |
102, | |
"foreign-object@2.0.1": | |
198, | |
"foreign-object@2.0.2": | |
107, | |
"foreign-object@2.0.3": | |
86, | |
"foreign-object@3.0.0": | |
93, | |
"foreign-object@4.0.0": | |
91, | |
"foreign-object@4.1.0": | |
83, | |
"foreign-readwrite@1.0.1": | |
114, | |
"foreign-readwrite@1.0.2": | |
115, | |
"foreign-readwrite@2.0.0": | |
214, | |
"foreign-readwrite@3.0.0": | |
92, | |
"foreign-readwrite@3.1.0": | |
100, | |
"foreign-readwrite@3.2.0": | |
94, | |
"foreign-readwrite@3.2.1": | |
104, | |
"fork@1.0.0": | |
-119, | |
"fork@1.1.0": | |
205, | |
"fork@2.0.0": | |
271, | |
"fork@3.0.0": | |
579, | |
"fork@4.0.0": | |
289, | |
"fork@5.0.0": | |
125, | |
"fork@6.0.0": | |
112, | |
"form-decoder@0.0.0": | |
73, | |
"form-decoder@0.0.1": | |
78, | |
"form-decoder@0.0.2": | |
74, | |
"form-decoder@0.0.3": | |
77, | |
"form-urlencoded@0.2.0": | |
272, | |
"form-urlencoded@0.2.1": | |
143, | |
"form-urlencoded@0.3.0": | |
57, | |
"form-urlencoded@0.3.1": | |
83, | |
"form-urlencoded@1.0.0": | |
68, | |
"form-urlencoded@2.0.0": | |
122, | |
"form-urlencoded@3.0.0": | |
203, | |
"form-urlencoded@4.0.0": | |
119, | |
"form-urlencoded@4.0.1": | |
225, | |
"form-urlencoded@5.0.0": | |
96, | |
"form-urlencoded@6.0.0": | |
80, | |
"form-urlencoded@6.0.1": | |
96, | |
"form-urlencoded@6.0.2": | |
94, | |
"form-urlencoded@7.0.0": | |
87, | |
"format@0.1.0": | |
73, | |
"format@0.1.1": | |
143, | |
"format@1.0.0": | |
90, | |
"format@1.0.1": | |
51, | |
"format@2.0.0": | |
124, | |
"format@2.1.0": | |
101, | |
"format@3.0.0": | |
156, | |
"format@4.0.0": | |
129, | |
"format-nix@0.1.0": | |
236, | |
"format-nix@0.1.1": | |
232, | |
"format-nix@0.2.0": | |
135, | |
"format-nix@0.3.0": | |
146, | |
"formatters@0.0.1": | |
73, | |
"formatters@0.0.2": | |
79, | |
"formatters@0.0.3": | |
145, | |
"formatters@0.0.4": | |
60, | |
"formatters@0.0.5": | |
73, | |
"formatters@0.1.0": | |
-201, | |
"formatters@0.1.1": | |
225, | |
"formatters@0.1.2": | |
219, | |
"formatters@0.1.3": | |
219, | |
"formatters@0.2.0": | |
280, | |
"formatters@0.3.0": | |
178, | |
"formatters@0.3.1": | |
183, | |
"formatters@0.4.0": | |
190, | |
"formatters@1.0.0": | |
263, | |
"formatters@1.0.1": | |
483, | |
"formatters@2.0.0": | |
447, | |
"formatters@2.0.1": | |
395, | |
"formatters@2.0.2": | |
298, | |
"formatters@2.1.0": | |
313, | |
"formatters@3.0.0": | |
312, | |
"formatters@3.0.1": | |
312, | |
"formatters@3.0.2": | |
312, | |
"formatters@4.0.0": | |
297, | |
"formatters@4.0.1": | |
204, | |
"formatters@5.0.0": | |
104, | |
"formatters@5.0.1": | |
116, | |
"formatters@6.0.0": | |
118, | |
"formatters@7.0.0": | |
102, | |
"formatting@1.0.0": | |
59, | |
"formatting@1.0.1": | |
70, | |
"formatting@1.0.2": | |
95, | |
"formatting@1.0.3": | |
110, | |
"formatting@1.0.4": | |
38, | |
"formatting@1.0.5": | |
64, | |
"formless-aj@0.1.0": | |
245, | |
"framer-motion@0.0.2": | |
198, | |
"framer-motion@0.0.3": | |
195, | |
"framer-motion@0.0.5": | |
202, | |
"framer-motion@0.0.6": | |
297, | |
"framer-motion@0.1.0": | |
183, | |
"framer-motion@1.0.1": | |
-147, | |
"free@0.0.8": | |
-66, | |
"free@0.1.4": | |
82, | |
"free@0.1.5": | |
73, | |
"free@0.1.6": | |
76, | |
"free@0.2.0": | |
76, | |
"free@0.3.0": | |
170, | |
"free@0.4.0": | |
91, | |
"free@0.4.1": | |
69, | |
"free@0.4.2": | |
88, | |
"free@0.5.0": | |
91, | |
"free@0.5.1": | |
91, | |
"free@0.6.0": | |
90, | |
"free@0.6.1": | |
92, | |
"free@0.7.0": | |
181, | |
"free@0.8.0": | |
94, | |
"free@0.9.0": | |
71, | |
"free@0.9.1": | |
93, | |
"free@1.0.0": | |
76, | |
"free@1.1.0": | |
81, | |
"free@1.2.0": | |
75, | |
"free@1.3.0": | |
80, | |
"free@1.4.0": | |
145, | |
"free@2.0.0": | |
-115, | |
"free@3.0.0": | |
202, | |
"free@3.0.1": | |
181, | |
"free@3.1.0": | |
-167, | |
"free@3.2.0": | |
181, | |
"free@3.3.0": | |
-164, | |
"free@3.4.0": | |
187, | |
"free@3.5.0": | |
308, | |
"free@3.5.1": | |
173, | |
"free@4.0.0": | |
214, | |
"free@4.0.1": | |
194, | |
"free@4.1.0": | |
205, | |
"free@4.2.0": | |
195, | |
"free@4.3.0": | |
197, | |
"free@5.0.0": | |
195, | |
"free@5.1.0": | |
101, | |
"free@5.2.0": | |
93, | |
"free@6.0.0": | |
82, | |
"free@6.0.1": | |
87, | |
"free@6.1.0": | |
87, | |
"free@6.2.0": | |
86, | |
"free@7.0.0": | |
82, | |
"free-alt@0.1.0": | |
255, | |
"free-alt@0.2.0": | |
155, | |
"free-alternative@0.1.0": | |
165, | |
"free-alternative@0.2.0": | |
181, | |
"free-canvas@0.2.0": | |
94, | |
"free-canvas@0.3.0": | |
92, | |
"free-canvas@0.3.1": | |
92, | |
"free-canvas@1.0.1": | |
78, | |
"free-canvas@2.0.0": | |
343, | |
"free-canvas@2.1.0": | |
230, | |
"free-canvas@3.0.0": | |
111, | |
"free-group@1.0.0": | |
95, | |
"free-group@1.1.0": | |
95, | |
"free-group@1.1.1": | |
96, | |
"free-group@1.1.2": | |
100, | |
"free-group@1.1.3": | |
96, | |
"free-monadplus@0.1.0": | |
391, | |
"freeap@0.1.3": | |
52, | |
"freeap@1.0.0": | |
51, | |
"freeap@2.0.0": | |
-82, | |
"freeap@3.0.0": | |
101, | |
"freeap@3.0.1": | |
180, | |
"freeap@4.0.0": | |
124, | |
"freeap@5.0.0": | |
94, | |
"freeap@5.0.1": | |
191, | |
"freeap@6.0.0": | |
87, | |
"freeap@7.0.0": | |
64, | |
"freearr@0.1.0": | |
79, | |
"freedom@0.0.1": | |
331, | |
"freedom@0.0.2": | |
319, | |
"freedom@0.0.3": | |
322, | |
"freedom@0.0.4": | |
407, | |
"freedom@0.1.0": | |
307, | |
"freedom@0.1.1": | |
301, | |
"freedom@0.2.0": | |
317, | |
"freedom@0.3.0": | |
317, | |
"freedom@0.4.0": | |
318, | |
"freedom@0.5.0": | |
318, | |
"freedom@0.6.0": | |
318, | |
"freedom@0.6.1": | |
400, | |
"freedom@0.6.2": | |
299, | |
"freedom@0.6.3": | |
313, | |
"freedom@1.0.0": | |
364, | |
"freedom@1.1.0": | |
333, | |
"freedom@1.1.1": | |
435, | |
"freedom@1.1.2": | |
336, | |
"freedom@1.2.0": | |
331, | |
"freedom@1.3.0": | |
347, | |
"freedom@1.4.0": | |
336, | |
"freedom@1.4.1": | |
336, | |
"freedom@2.0.0": | |
488, | |
"freedom@2.1.0": | |
374, | |
"freedom@2.2.0": | |
369, | |
"freedom-now@1.0.0": | |
635, | |
"freedom-now@2.0.0": | |
635, | |
"freedom-now@3.0.0": | |
572, | |
"freedom-portal@0.0.1": | |
501, | |
"freedom-portal@0.0.2": | |
595, | |
"freedom-portal@0.1.0": | |
487, | |
"freedom-portal@0.2.0": | |
479, | |
"freedom-portal@0.3.0": | |
493, | |
"freedom-portal@0.4.0": | |
495, | |
"freedom-portal@0.5.0": | |
500, | |
"freedom-portal@1.0.0": | |
647, | |
"freedom-portal@2.0.0": | |
679, | |
"freedom-router@0.0.1": | |
339, | |
"freedom-router@0.0.2": | |
341, | |
"freedom-router@0.0.3": | |
357, | |
"freedom-router@0.1.0": | |
360, | |
"freedom-router@0.2.0": | |
355, | |
"freedom-router@0.3.0": | |
357, | |
"freedom-router@0.4.0": | |
428, | |
"freedom-router@0.5.0": | |
358, | |
"freedom-router@1.0.0": | |
469, | |
"freedom-router@1.0.1": | |
480, | |
"freedom-router@2.0.0": | |
461, | |
"freedom-transition@0.1.0": | |
594, | |
"freedom-transition@1.0.0": | |
627, | |
"freedom-transition@1.0.1": | |
529, | |
"freedom-transition@2.0.0": | |
573, | |
"freedom-virtualized@0.1.0": | |
497, | |
"freedom-virtualized@0.1.1": | |
601, | |
"freedom-virtualized@0.1.2": | |
485, | |
"freedom-virtualized@0.2.0": | |
482, | |
"freedom-virtualized@1.0.0": | |
641, | |
"freedom-virtualized@1.1.0": | |
646, | |
"freedom-virtualized@2.0.0": | |
650, | |
"freedom-virtualized@3.0.0": | |
580, | |
"freedom-virtualized@3.0.1": | |
707, | |
"freedom-window-resize@0.1.0": | |
480, | |
"freedom-window-resize@0.2.0": | |
483, | |
"freedom-window-resize@1.0.0": | |
642, | |
"freedom-window-resize@2.0.0": | |
576, | |
"freer-free@0.0.1": | |
58, | |
"freet@0.1.0": | |
87, | |
"freet@0.1.1": | |
142, | |
"freet@0.1.2": | |
92, | |
"freet@0.1.3": | |
52, | |
"freet@0.2.0": | |
78, | |
"freet@0.3.0": | |
75, | |
"freet@0.3.1": | |
84, | |
"freet@1.0.0": | |
77, | |
"freet@1.0.1": | |
79, | |
"freet@2.0.0": | |
204, | |
"freet@2.0.1": | |
90, | |
"freet@2.1.0": | |
103, | |
"freet@3.0.0": | |
124, | |
"freet@4.0.0": | |
92, | |
"freet@4.0.1": | |
97, | |
"freet@4.1.0": | |
96, | |
"freet@5.0.0": | |
180, | |
"freet@6.0.0": | |
199, | |
"freet@7.0.0": | |
84, | |
"function-eff@0.1.0": | |
41, | |
"function-run@0.1.0": | |
62, | |
"functional-maps@1.0.0": | |
92, | |
"functions@0.1.0": | |
62, | |
"functions@1.0.0": | |
68, | |
"functions@2.0.0": | |
69, | |
"functions@3.0.0": | |
76, | |
"functions@4.0.0": | |
141, | |
"functions@5.0.0": | |
51, | |
"functions@6.0.0": | |
62, | |
"functor-compose@0.1.0": | |
68, | |
"functor-coproducts@1.0.0": | |
69, | |
"functor-coproducts@1.0.1": | |
67, | |
"functor-coproducts@1.1.0": | |
69, | |
"functor-coproducts@2.0.0": | |
90, | |
"functor-products@1.0.0": | |
149, | |
"functor-products@2.0.0": | |
85, | |
"functor-vector@0.1.0": | |
228, | |
"functor1@1.0.0": | |
55, | |
"functor1@2.0.0": | |
72, | |
"functor1@3.0.0": | |
62, | |
"functors@0.1.0": | |
88, | |
"functors@0.1.1": | |
69, | |
"functors@0.1.2": | |
160, | |
"functors@1.0.0": | |
151, | |
"functors@1.1.0": | |
76, | |
"functors@2.0.0": | |
98, | |
"functors@2.1.0": | |
109, | |
"functors@2.2.0": | |
105, | |
"functors@3.0.0": | |
81, | |
"functors@3.0.1": | |
155, | |
"functors@3.1.0": | |
87, | |
"functors@3.1.1": | |
56, | |
"functors@4.0.0": | |
72, | |
"functors@4.1.0": | |
69, | |
"functors@4.1.1": | |
72, | |
"functors@5.0.0": | |
75, | |
"fuzzy@0.1.1": | |
193, | |
"fuzzy@0.1.2": | |
277, | |
"fuzzy@0.2.0": | |
197, | |
"fuzzy@0.2.1": | |
277, | |
"fuzzy@0.3.0": | |
147, | |
"fuzzy@0.4.0": | |
-109, | |
"game@1.0.0": | |
310, | |
"game@2.0.0": | |
251, | |
"game@2.0.1": | |
247, | |
"gametree@1.0.0": | |
154, | |
"gametree@2.0.0": | |
163, | |
"gametree@3.0.0": | |
230, | |
"gdp@0.1.0": | |
54, | |
"gejang@1.0.0": | |
128, | |
"gen@1.0.0": | |
94, | |
"gen@1.1.0": | |
100, | |
"gen@1.1.1": | |
177, | |
"gen@1.2.0": | |
81, | |
"gen@1.2.1": | |
90, | |
"gen@1.3.0": | |
100, | |
"gen@1.3.1": | |
99, | |
"gen@2.0.0": | |
85, | |
"gen@2.1.0": | |
153, | |
"gen@2.1.1": | |
98, | |
"gen@3.0.0": | |
60, | |
"gen@4.0.0": | |
79, | |
"generate-values@1.0.1": | |
1142, | |
"generic-graphviz@1.0.1": | |
266, | |
"generic-graphviz@1.0.2": | |
271, | |
"generic-graphviz@1.1.1": | |
260, | |
"generic-graphviz@2.0.0": | |
502, | |
"generic-graphviz@2.0.1": | |
359, | |
"generic-router@0.0.1": | |
74, | |
"generics@0.1.0": | |
69, | |
"generics@0.2.0": | |
74, | |
"generics@0.3.0": | |
76, | |
"generics@0.3.1": | |
71, | |
"generics@0.4.0": | |
144, | |
"generics@0.5.0": | |
73, | |
"generics@0.5.1": | |
51, | |
"generics@0.6.0": | |
72, | |
"generics@0.6.1": | |
72, | |
"generics@0.6.2": | |
71, | |
"generics@0.7.0": | |
75, | |
"generics@0.7.1": | |
77, | |
"generics@0.7.2": | |
121, | |
"generics@1.0.0": | |
88, | |
"generics@1.0.1": | |
45, | |
"generics@2.0.0": | |
87, | |
"generics@3.0.0": | |
90, | |
"generics@3.1.0": | |
97, | |
"generics@3.2.0": | |
86, | |
"generics@3.3.0": | |
90, | |
"generics@4.0.0": | |
277, | |
"generics@4.0.1": | |
201, | |
"generics-rep@1.0.0": | |
41, | |
"generics-rep@2.0.0": | |
62, | |
"generics-rep@3.0.0": | |
73, | |
"generics-rep@4.0.0": | |
61, | |
"generics-rep@4.1.0": | |
79, | |
"generics-rep@5.0.0": | |
66, | |
"generics-rep@5.1.0": | |
146, | |
"generics-rep@5.2.0": | |
181, | |
"generics-rep@5.3.0": | |
160, | |
"generics-rep@5.4.0": | |
171, | |
"generics-rep@6.0.0": | |
89, | |
"generics-rep@6.1.0": | |
93, | |
"generics-rep@6.1.1": | |
90, | |
"generics-rep@6.1.2": | |
92, | |
"generics-rep@6.1.3": | |
183, | |
"generics-rep@6.1.4": | |
80, | |
"generics-rep-optics@0.1.0": | |
395, | |
"generics-rep-optics@1.0.0": | |
199, | |
"generics-rep-optics@1.0.1": | |
200, | |
"generics-rep-optics@1.0.2": | |
200, | |
"generics-rep-optics@1.1.0": | |
201, | |
"geom@1.0.0": | |
54, | |
"geom@1.1.0": | |
133, | |
"geom@2.0.0": | |
88, | |
"geom@3.0.0": | |
73, | |
"geometry@0.0.0": | |
71, | |
"geometry@0.0.1": | |
77, | |
"geometry@0.0.2": | |
72, | |
"geometry-plane@1.0.2": | |
231, | |
"geometry-plane@1.0.3": | |
104, | |
"github-actions-toolkit@0.1.0": | |
346, | |
"github-actions-toolkit@0.2.0": | |
231, | |
"github-actions-toolkit@0.2.1": | |
235, | |
"github-actions-toolkit@0.2.2": | |
243, | |
"github-actions-toolkit@0.3.0": | |
129, | |
"github-actions-toolkit@0.4.0": | |
111, | |
"github-actions-toolkit@0.5.0": | |
188, | |
"github-corners@0.1.0": | |
362, | |
"github-corners@0.1.1": | |
351, | |
"github-corners@0.2.0": | |
362, | |
"github-corners@0.2.1": | |
367, | |
"gl-matrix@1.0.0": | |
143, | |
"gl-matrix@1.0.1": | |
238, | |
"gl-matrix@2.0.0": | |
129, | |
"gl-matrix@2.0.1": | |
69, | |
"gl-matrix@2.1.0": | |
83, | |
"glapple@1.0.0": | |
-328, | |
"glapple@1.0.1": | |
-341, | |
"glapple@1.0.2": | |
-336, | |
"glapple@1.1.0": | |
-443, | |
"glapple@1.1.1": | |
-333, | |
"glapple@2.0.0": | |
-316, | |
"glapple@2.0.1": | |
-322, | |
"glapple@2.0.2": | |
-325, | |
"glapple@2.1.0": | |
-325, | |
"glapple@3.0.0": | |
-433, | |
"glitter@0.0.1": | |
858, | |
"glitter@0.1.0": | |
839, | |
"globals@0.1.0": | |
65, | |
"globals@0.1.1": | |
67, | |
"globals@0.1.2": | |
62, | |
"globals@0.1.3": | |
66, | |
"globals@0.1.4": | |
134, | |
"globals@0.1.5": | |
49, | |
"globals@0.1.6": | |
52, | |
"globals@0.2.0": | |
68, | |
"globals@0.2.1": | |
67, | |
"globals@0.2.2": | |
67, | |
"globals@1.0.0": | |
66, | |
"globals@1.1.0": | |
130, | |
"globals@2.0.0": | |
54, | |
"globals@3.0.0": | |
51, | |
"globals@4.0.0": | |
65, | |
"globals@4.1.0": | |
69, | |
"globals@5.0.0": | |
62, | |
"gm@1.0.0": | |
143, | |
"gomtang-basic@0.1.0": | |
563, | |
"gomtang-basic@0.2.0": | |
385, | |
"google-apps@0.0.1": | |
94, | |
"google-apps@0.0.2": | |
112, | |
"google-apps@0.0.3": | |
112, | |
"google-cloud-datastore@0.1.0": | |
497, | |
"grain@0.1.0": | |
335, | |
"grain@0.2.0": | |
338, | |
"grain@0.3.0": | |
443, | |
"grain@0.4.0": | |
463, | |
"grain@0.4.1": | |
464, | |
"grain@0.5.0": | |
477, | |
"grain@0.7.0": | |
472, | |
"grain@0.8.0": | |
565, | |
"grain@0.9.0": | |
465, | |
"grain@1.0.0": | |
452, | |
"grain@2.0.0": | |
212, | |
"grain@3.0.0": | |
115, | |
"grain-portal@0.1.0": | |
491, | |
"grain-portal@0.1.1": | |
490, | |
"grain-router@0.1.0": | |
392, | |
"grain-router@0.2.0": | |
508, | |
"grain-router@0.3.0": | |
368, | |
"grain-router@0.4.0": | |
517, | |
"grain-router@0.4.1": | |
516, | |
"grain-router@0.5.0": | |
525, | |
"grain-router@0.7.0": | |
520, | |
"grain-router@0.8.0": | |
622, | |
"grain-router@0.9.0": | |
501, | |
"grain-router@1.0.0": | |
509, | |
"grain-router@2.0.0": | |
212, | |
"grain-router@3.0.0": | |
110, | |
"grain-virtualized@0.1.0": | |
649, | |
"grain-virtualized@0.1.1": | |
475, | |
"grain-virtualized@0.2.0": | |
471, | |
"grain-virtualized@0.3.0": | |
488, | |
"grain-virtualized@0.4.0": | |
1543, | |
"grain-virtualized@0.4.1": | |
1548, | |
"grain-virtualized@0.5.0": | |
1567, | |
"grain-virtualized@0.7.0": | |
1668, | |
"grain-virtualized@0.8.0": | |
1528, | |
"grain-virtualized@0.9.0": | |
1529, | |
"grain-virtualized@1.0.0": | |
1542, | |
"grain-virtualized@2.0.0": | |
486, | |
"grain-virtualized@3.0.0": | |
109, | |
"graphics-vis@1.0.0": | |
171, | |
"graphics-vis@2.0.0": | |
293, | |
"graphql@1.0.0": | |
284, | |
"graphql@1.0.1": | |
284, | |
"graphql@1.0.2": | |
322, | |
"graphql-client@0.1.0": | |
450, | |
"graphql-client@0.1.1": | |
447, | |
"graphql-client@0.2.0": | |
543, | |
"graphql-client@1.4.5": | |
570, | |
"graphql-client@1.5.0": | |
575, | |
"graphql-client@1.5.1": | |
581, | |
"graphql-client@1.6.1": | |
715, | |
"graphql-client@1.6.4": | |
569, | |
"graphql-client@1.6.5": | |
572, | |
"graphql-client@1.6.6": | |
581, | |
"graphql-client@1.6.7": | |
584, | |
"graphql-client@1.6.9": | |
586, | |
"graphql-client@1.6.11": | |
725, | |
"graphql-client@1.6.13": | |
566, | |
"graphql-client@1.7.0": | |
575, | |
"graphql-client@1.7.1": | |
586, | |
"graphql-client@1.7.3": | |
588, | |
"graphql-client@1.7.5": | |
587, | |
"graphql-client@1.7.6": | |
697, | |
"graphql-client@1.7.7": | |
570, | |
"graphql-client@1.7.8": | |
565, | |
"graphql-client@1.7.9": | |
580, | |
"graphql-client@1.7.10": | |
453, | |
"graphql-client@1.7.11": | |
456, | |
"graphql-client@1.7.13": | |
457, | |
"graphql-client@1.7.14": | |
549, | |
"graphql-client@1.7.17": | |
444, | |
"graphql-client@1.7.19": | |
448, | |
"graphql-client@1.7.21": | |
464, | |
"graphql-client@1.7.23": | |
461, | |
"graphql-client@1.7.24": | |
455, | |
"graphql-client@1.7.27": | |
558, | |
"graphql-client@2.0.0": | |
453, | |
"graphql-client@2.0.1": | |
457, | |
"graphql-client@2.0.2": | |
469, | |
"graphql-client@2.0.3": | |
473, | |
"graphql-client@2.0.4": | |
574, | |
"graphql-client@2.0.5": | |
465, | |
"graphql-client@2.0.6": | |
449, | |
"graphql-client@2.0.7": | |
470, | |
"graphql-client@2.0.8": | |
471, | |
"graphql-client@2.0.9": | |
477, | |
"graphql-client@2.0.10": | |
473, | |
"graphql-client@2.0.11": | |
622, | |
"graphql-client@2.0.12": | |
461, | |
"graphql-client@2.0.14": | |
460, | |
"graphql-client@2.1.6": | |
476, | |
"graphql-client@2.1.8": | |
473, | |
"graphql-client@2.2.0": | |
473, | |
"graphql-client@2.2.1": | |
582, | |
"graphql-client@2.2.2": | |
460, | |
"graphql-client@2.3.0": | |
455, | |
"graphql-client@3.0.0": | |
470, | |
"graphql-client@3.0.1": | |
469, | |
"graphql-client@3.0.2": | |
473, | |
"graphql-client@3.0.4": | |
473, | |
"graphql-client@3.0.5": | |
604, | |
"graphql-client@4.0.1": | |
245, | |
"graphql-client@4.0.4": | |
240, | |
"graphql-client@4.0.9": | |
258, | |
"graphql-client@4.0.12": | |
257, | |
"graphql-client@4.0.13": | |
261, | |
"graphql-client@4.0.14": | |
259, | |
"graphql-client@4.0.15": | |
333, | |
"graphql-client@4.0.16": | |
243, | |
"graphql-client@4.0.17": | |
247, | |
"graphql-client@4.0.18": | |
258, | |
"graphql-client@6.0.0": | |
258, | |
"graphql-client@7.0.0": | |
354, | |
"graphql-client@7.0.4": | |
229, | |
"graphql-client@7.0.5": | |
219, | |
"graphql-client@7.0.6": | |
237, | |
"graphql-client@7.0.7": | |
235, | |
"graphql-client@8.0.2": | |
238, | |
"graphql-client@8.0.3": | |
350, | |
"graphql-client@8.1.0": | |
224, | |
"graphql-client@9.1.1": | |
187, | |
"graphql-client@9.2.2": | |
195, | |
"graphql-parser@0.0.0": | |
196, | |
"graphql-parser@0.0.1": | |
193, | |
"graphql-parser@0.0.2": | |
190, | |
"graphql-parser@0.0.3": | |
284, | |
"graphql-parser@0.0.4": | |
180, | |
"graphql-parser@0.0.5": | |
181, | |
"graphql-parser@0.0.6": | |
191, | |
"graphql-parser@0.0.7": | |
205, | |
"graphql-parser@0.0.8": | |
193, | |
"graphql-parser@0.0.9": | |
323, | |
"graphql-parser@0.0.10": | |
181, | |
"graphql-parser@0.0.11": | |
177, | |
"graphqlclient@1.2.0": | |
181, | |
"graphqlclient@1.2.1": | |
182, | |
"graphs@0.1.0": | |
-70, | |
"graphs@0.2.0": | |
69, | |
"graphs@0.3.0": | |
191, | |
"graphs@0.3.1": | |
80, | |
"graphs@0.4.0": | |
69, | |
"graphs@0.5.0": | |
136, | |
"graphs@1.0.0": | |
78, | |
"graphs@2.0.0": | |
233, | |
"graphs@3.0.0": | |
272, | |
"graphs@4.0.0": | |
124, | |
"graphs@5.0.0": | |
173, | |
"graphs@8.0.0": | |
73, | |
"graphs@8.1.0": | |
72, | |
"graphviz@1.0.0": | |
351, | |
"graphviz@1.1.0": | |
188, | |
"graphviz@1.1.1": | |
192, | |
"graphviz@1.2.0": | |
281, | |
"graphviz@1.3.0": | |
180, | |
"grid-reactors@0.0.1": | |
160, | |
"grid-reactors@2.1.0": | |
171, | |
"grid-reactors@3.0.0": | |
163, | |
"grid-reactors@3.0.1": | |
254, | |
"grid-reactors@4.0.0": | |
157, | |
"group@1.0.0": | |
43, | |
"group@1.1.0": | |
71, | |
"group@2.0.0": | |
73, | |
"group@2.1.0": | |
71, | |
"group@3.0.0": | |
84, | |
"group@3.1.0": | |
111, | |
"group@3.2.0": | |
87, | |
"group@3.2.1": | |
82, | |
"group@3.2.2": | |
95, | |
"group@3.3.0": | |
92, | |
"group@4.0.0": | |
88, | |
"group@4.1.0": | |
85, | |
"group@4.1.1": | |
88, | |
"gun@0.1.0": | |
313, | |
"gun@0.1.1": | |
194, | |
"halogen@0.1.0": | |
59, | |
"halogen@0.2.0": | |
88, | |
"halogen@0.3.0": | |
80, | |
"halogen@0.4.0": | |
92, | |
"halogen@0.4.1": | |
90, | |
"halogen@0.5.0": | |
258, | |
"halogen@0.5.1": | |
132, | |
"halogen@0.5.2": | |
123, | |
"halogen@0.5.3": | |
132, | |
"halogen@0.5.4": | |
136, | |
"halogen@0.5.5": | |
135, | |
"halogen@0.5.6": | |
147, | |
"halogen@0.5.7": | |
139, | |
"halogen@0.5.8": | |
236, | |
"halogen@0.5.9": | |
131, | |
"halogen@0.5.10": | |
129, | |
"halogen@0.5.11": | |
140, | |
"halogen@0.5.12": | |
140, | |
"halogen@0.5.13": | |
140, | |
"halogen@0.5.14": | |
257, | |
"halogen@0.5.15": | |
135, | |
"halogen@0.5.16": | |
126, | |
"halogen@0.5.17": | |
142, | |
"halogen@0.5.18": | |
138, | |
"halogen@0.6.0": | |
133, | |
"halogen@0.6.1": | |
133, | |
"halogen@0.6.2": | |
226, | |
"halogen@0.7.0": | |
130, | |
"halogen@0.7.1": | |
123, | |
"halogen@0.8.0": | |
127, | |
"halogen@0.9.0": | |
91, | |
"halogen@0.10.0": | |
91, | |
"halogen@0.11.0": | |
-205, | |
"halogen@0.12.0": | |
-465, | |
"halogen@1.0.0": | |
-527, | |
"halogen@1.1.0": | |
-395, | |
"halogen@1.2.0": | |
-381, | |
"halogen@1.2.1": | |
-395, | |
"halogen@2.0.0": | |
723, | |
"halogen@2.0.1": | |
791, | |
"halogen@2.1.0": | |
755, | |
"halogen@2.2.0": | |
674, | |
"halogen@2.3.0": | |
678, | |
"halogen@3.0.0": | |
600, | |
"halogen@3.0.1": | |
611, | |
"halogen@3.1.0": | |
603, | |
"halogen@3.1.1": | |
740, | |
"halogen@3.1.2": | |
633, | |
"halogen@3.1.3": | |
598, | |
"halogen@4.0.0": | |
319, | |
"halogen@5.0.0": | |
282, | |
"halogen@5.0.1": | |
280, | |
"halogen@5.0.2": | |
382, | |
"halogen@5.1.0": | |
276, | |
"halogen@5.1.1": | |
261, | |
"halogen@6.0.0": | |
151, | |
"halogen@6.1.0": | |
160, | |
"halogen@6.1.1": | |
164, | |
"halogen@6.1.2": | |
171, | |
"halogen@6.1.3": | |
163, | |
"halogen@7.0.0": | |
298, | |
"halogen-bootstrap@0.1.0": | |
98, | |
"halogen-bootstrap@0.4.0": | |
229, | |
"halogen-bootstrap@0.5.0": | |
165, | |
"halogen-bootstrap@0.6.0": | |
164, | |
"halogen-bootstrap@0.7.0": | |
160, | |
"halogen-bootstrap@1.0.0": | |
103, | |
"halogen-bootstrap@2.0.0": | |
184, | |
"halogen-bootstrap@3.0.0": | |
-293, | |
"halogen-bootstrap@4.0.0": | |
-693, | |
"halogen-bootstrap@5.0.0": | |
-598, | |
"halogen-bootstrap@6.0.0": | |
1386, | |
"halogen-bootstrap@7.0.0": | |
1175, | |
"halogen-bootstrap@8.0.0": | |
545, | |
"halogen-bootstrap4@0.1.0": | |
552, | |
"halogen-bootstrap4@0.1.2": | |
575, | |
"halogen-bootstrap4@0.1.3": | |
571, | |
"halogen-bootstrap4@0.1.4": | |
580, | |
"halogen-bootstrap4@0.2.0": | |
236, | |
"halogen-bootstrap5@1.0.0": | |
337, | |
"halogen-bootstrap5@2.0.0": | |
222, | |
"halogen-bootstrap5@2.1.0": | |
230, | |
"halogen-bulma@1.0.0": | |
573, | |
"halogen-bulma@1.0.1": | |
570, | |
"halogen-bulma@1.0.2": | |
658, | |
"halogen-bulma@1.0.3": | |
550, | |
"halogen-calendar-datepicker@0.0.1": | |
1168, | |
"halogen-calendar-datepicker@0.0.2": | |
1173, | |
"halogen-calendar-datepicker@0.0.3": | |
1180, | |
"halogen-calendar-datepicker@0.0.4": | |
1188, | |
"halogen-calendar-datepicker@0.0.5": | |
1333, | |
"halogen-css@0.1.0": | |
-175, | |
"halogen-css@0.1.1": | |
-166, | |
"halogen-css@0.2.0": | |
-186, | |
"halogen-css@0.2.1": | |
-187, | |
"halogen-css@0.2.2": | |
-186, | |
"halogen-css@0.3.0": | |
-143, | |
"halogen-css@0.4.0": | |
-228, | |
"halogen-css@0.5.0": | |
-135, | |
"halogen-css@1.0.0": | |
90, | |
"halogen-css@2.0.0": | |
101, | |
"halogen-css@3.0.0": | |
-259, | |
"halogen-css@4.0.0": | |
-697, | |
"halogen-css@5.0.0": | |
-565, | |
"halogen-css@6.0.0": | |
1483, | |
"halogen-css@7.0.0": | |
992, | |
"halogen-css@8.0.0": | |
575, | |
"halogen-css@9.0.0": | |
360, | |
"halogen-css@10.0.0": | |
260, | |
"halogen-datepicker@0.1.0": | |
1424, | |
"halogen-datepicker@1.0.0": | |
960, | |
"halogen-datepicker@2.0.0": | |
302, | |
"halogen-day-picker@0.1.0": | |
891, | |
"halogen-day-picker@0.1.1": | |
892, | |
"halogen-day-picker@0.1.2": | |
901, | |
"halogen-day-picker@0.2.0": | |
374, | |
"halogen-day-picker@0.3.0": | |
479, | |
"halogen-day-picker@0.4.0": | |
356, | |
"halogen-dialog@0.0.1": | |
98, | |
"halogen-dialog@0.0.2": | |
121, | |
"halogen-dialog@0.1.0": | |
103, | |
"halogen-driver@1.0.0": | |
569, | |
"halogen-driver@2.0.0": | |
699, | |
"halogen-echarts@0.1.0": | |
-190, | |
"halogen-echarts@0.1.1": | |
-183, | |
"halogen-echarts@0.2.0": | |
-198, | |
"halogen-echarts@0.3.0": | |
-200, | |
"halogen-echarts@0.4.0": | |
-200, | |
"halogen-echarts@0.5.0": | |
-168, | |
"halogen-echarts@0.6.0": | |
-276, | |
"halogen-echarts@0.7.0": | |
-159, | |
"halogen-echarts@0.8.0": | |
-156, | |
"halogen-echarts@1.0.0": | |
121, | |
"halogen-echarts@2.0.0": | |
-398, | |
"halogen-echarts@3.0.0": | |
-890, | |
"halogen-echarts@4.0.0": | |
-946, | |
"halogen-echarts@4.1.0": | |
-816, | |
"halogen-echarts@5.0.0": | |
-825, | |
"halogen-echarts@6.0.0": | |
1730, | |
"halogen-echarts@7.0.0": | |
1774, | |
"halogen-echarts@8.0.0": | |
1737, | |
"halogen-echarts@9.0.0": | |
1453, | |
"halogen-echarts@10.0.0": | |
1287, | |
"halogen-echarts@11.0.0": | |
-1237, | |
"halogen-echarts@12.0.0": | |
1272, | |
"halogen-echarts@13.0.0": | |
1111, | |
"halogen-echarts@14.0.0": | |
930, | |
"halogen-formless@0.1.0": | |
488, | |
"halogen-formless@0.1.1": | |
508, | |
"halogen-formless@0.2.0": | |
443, | |
"halogen-formless@0.3.0": | |
469, | |
"halogen-formless@0.3.1": | |
574, | |
"halogen-formless@0.4.0": | |
417, | |
"halogen-formless@0.4.1": | |
413, | |
"halogen-formless@0.5.0": | |
434, | |
"halogen-formless@0.5.1": | |
427, | |
"halogen-formless@0.5.2": | |
430, | |
"halogen-formless@1.0.0": | |
510, | |
"halogen-formless@2.0.0": | |
178, | |
"halogen-formless@2.0.1": | |
173, | |
"halogen-formless@2.1.0": | |
195, | |
"halogen-formless@2.2.0": | |
192, | |
"halogen-formless@3.0.0": | |
165, | |
"halogen-formless@4.0.0": | |
-202, | |
"halogen-formless@4.0.2": | |
-321, | |
"halogen-foundation@0.1.0": | |
100, | |
"halogen-framework7@0.1.0": | |
-222, | |
"halogen-framework7@0.1.1": | |
-229, | |
"halogen-framework7@0.1.2": | |
-234, | |
"halogen-framework7@0.1.3": | |
-260, | |
"halogen-framework7@0.1.4": | |
-238, | |
"halogen-framework7@0.1.5": | |
-235, | |
"halogen-framework7@0.1.6": | |
-330, | |
"halogen-framework7@0.1.7": | |
-205, | |
"halogen-framework7@0.1.8": | |
-213, | |
"halogen-framework7@0.1.9": | |
-218, | |
"halogen-framework7@0.1.10": | |
-222, | |
"halogen-framework7@0.1.11": | |
-220, | |
"halogen-framework7@0.1.12": | |
-316, | |
"halogen-framework7@0.2.0": | |
-608, | |
"halogen-framework7@0.2.1": | |
-597, | |
"halogen-framework7@0.2.2": | |
-609, | |
"halogen-framework7@0.2.3": | |
-614, | |
"halogen-framework7@0.2.4": | |
-613, | |
"halogen-framework7@0.2.5": | |
-715, | |
"halogen-framework7@0.2.6": | |
-599, | |
"halogen-framework7@0.2.7": | |
-609, | |
"halogen-framework7@0.2.8": | |
-619, | |
"halogen-framework7@0.2.9": | |
-615, | |
"halogen-hooks@0.1.0": | |
582, | |
"halogen-hooks@0.2.0": | |
451, | |
"halogen-hooks@0.2.1": | |
455, | |
"halogen-hooks@0.3.0": | |
462, | |
"halogen-hooks@0.4.0": | |
465, | |
"halogen-hooks@0.4.1": | |
475, | |
"halogen-hooks@0.4.2": | |
575, | |
"halogen-hooks@0.4.3": | |
448, | |
"halogen-hooks@0.5.0": | |
220, | |
"halogen-hooks@0.5.1": | |
234, | |
"halogen-hooks@0.6.0": | |
271, | |
"halogen-hooks@0.6.1": | |
269, | |
"halogen-hooks@0.6.2": | |
-238, | |
"halogen-hooks@0.6.3": | |
210, | |
"halogen-hooks-extra@0.1.0": | |
598, | |
"halogen-hooks-extra@0.1.1": | |
479, | |
"halogen-hooks-extra@0.2.0": | |
487, | |
"halogen-hooks-extra@0.2.1": | |
495, | |
"halogen-hooks-extra@0.2.2": | |
500, | |
"halogen-hooks-extra@0.3.0": | |
668, | |
"halogen-hooks-extra@0.4.0": | |
533, | |
"halogen-hooks-extra@0.5.0": | |
490, | |
"halogen-hooks-extra@0.5.1": | |
500, | |
"halogen-hooks-extra@0.6.0": | |
553, | |
"halogen-hooks-extra@0.6.1": | |
363, | |
"halogen-hooks-extra@0.6.2": | |
444, | |
"halogen-hooks-extra@0.6.3": | |
345, | |
"halogen-hooks-extra@0.7.0": | |
347, | |
"halogen-hooks-extra@0.7.1": | |
556, | |
"halogen-hooks-extra@0.8.0": | |
267, | |
"halogen-hooks-extra@0.9.0": | |
393, | |
"halogen-leaflet@0.0.1": | |
1340, | |
"halogen-leaflet@0.1.0": | |
1253, | |
"halogen-menu@0.5.0": | |
164, | |
"halogen-menu@0.6.0": | |
165, | |
"halogen-menu@0.7.0": | |
160, | |
"halogen-menu@1.0.0": | |
98, | |
"halogen-menu@2.0.0": | |
-377, | |
"halogen-menu@3.0.0": | |
-490, | |
"halogen-menu@4.0.0": | |
-591, | |
"halogen-menu@5.0.0": | |
1766, | |
"halogen-proxy@1.0.0": | |
1009, | |
"halogen-pure@0.0.1": | |
56, | |
"halogen-pure@0.0.2": | |
516, | |
"halogen-renderless@0.0.1": | |
590, | |
"halogen-renderless@0.0.2": | |
481, | |
"halogen-renderless@0.0.3": | |
502, | |
"halogen-renderless@0.0.4": | |
54, | |
"halogen-router@0.1.0": | |
214, | |
"halogen-select@0.2.0": | |
979, | |
"halogen-select@0.3.0": | |
795, | |
"halogen-select@1.0.0": | |
816, | |
"halogen-select@1.0.1": | |
818, | |
"halogen-select@2.0.0": | |
654, | |
"halogen-select@3.0.0": | |
524, | |
"halogen-select@3.0.1": | |
519, | |
"halogen-select@3.0.2": | |
534, | |
"halogen-select@4.0.0": | |
540, | |
"halogen-select@5.0.0": | |
459, | |
"halogen-select@6.0.0": | |
315, | |
"halogen-selects@0.1.0": | |
-158, | |
"halogen-selects@0.2.0": | |
-157, | |
"halogen-selects@0.2.1": | |
-179, | |
"halogen-selects@0.3.0": | |
-140, | |
"halogen-selects@0.4.0": | |
-138, | |
"halogen-selects@0.5.0": | |
-259, | |
"halogen-store@0.1.0": | |
179, | |
"halogen-store@0.1.1": | |
172, | |
"halogen-store@0.1.2": | |
220, | |
"halogen-store@0.2.0": | |
218, | |
"halogen-store@0.2.1": | |
208, | |
"halogen-store@0.3.0": | |
216, | |
"halogen-store@0.4.0": | |
261, | |
"halogen-store@0.4.1": | |
331, | |
"halogen-store@0.5.0": | |
354, | |
"halogen-store@0.5.1": | |
288, | |
"halogen-store@0.5.2": | |
297, | |
"halogen-store@0.5.3": | |
297, | |
"halogen-store@0.5.4": | |
299, | |
"halogen-storybook@0.1.0": | |
1029, | |
"halogen-storybook@0.2.0": | |
776, | |
"halogen-storybook@0.3.0": | |
297, | |
"halogen-storybook@0.4.0": | |
305, | |
"halogen-storybook@1.0.1": | |
167, | |
"halogen-storybook@2.0.0": | |
373, | |
"halogen-subscriptions@1.0.0": | |
80, | |
"halogen-subscriptions@2.0.0": | |
60, | |
"halogen-svg-elems@0.0.2": | |
895, | |
"halogen-svg-elems@0.0.3": | |
884, | |
"halogen-svg-elems@0.0.4": | |
895, | |
"halogen-svg-elems@0.1.0": | |
887, | |
"halogen-svg-elems@2.0.0": | |
-1221, | |
"halogen-svg-elems@2.0.1": | |
613, | |
"halogen-svg-elems@2.0.2": | |
614, | |
"halogen-svg-elems@3.0.0": | |
232, | |
"halogen-svg-elems@4.0.0": | |
234, | |
"halogen-svg-elems@5.0.0": | |
233, | |
"halogen-svg-elems@5.0.1": | |
361, | |
"halogen-svg-elems@5.0.2": | |
226, | |
"halogen-svg-elems@5.0.3": | |
219, | |
"halogen-svg-elems@6.0.0": | |
236, | |
"halogen-svg-elems@7.0.0": | |
241, | |
"halogen-vdom@1.0.0": | |
-283, | |
"halogen-vdom@1.0.1": | |
-300, | |
"halogen-vdom@1.0.2": | |
-387, | |
"halogen-vdom@1.0.3": | |
-297, | |
"halogen-vdom@1.0.4": | |
-285, | |
"halogen-vdom@2.0.0": | |
362, | |
"halogen-vdom@2.0.1": | |
583, | |
"halogen-vdom@3.0.0": | |
206, | |
"halogen-vdom@3.0.1": | |
205, | |
"halogen-vdom@4.0.0": | |
206, | |
"halogen-vdom@5.0.0": | |
306, | |
"halogen-vdom@5.1.0": | |
202, | |
"halogen-vdom@6.0.0": | |
188, | |
"halogen-vdom@6.1.0": | |
201, | |
"halogen-vdom@6.1.1": | |
206, | |
"halogen-vdom@6.1.2": | |
203, | |
"halogen-vdom@6.1.3": | |
327, | |
"halogen-vdom@7.0.0": | |
123, | |
"halogen-vdom@7.0.1": | |
128, | |
"halogen-vdom@8.0.0": | |
113, | |
"halogen-vdom-string-renderer@0.1.0": | |
-386, | |
"halogen-vdom-string-renderer@0.2.0": | |
665, | |
"halogen-vdom-string-renderer@0.2.1": | |
663, | |
"halogen-vdom-string-renderer@0.2.2": | |
801, | |
"halogen-vdom-string-renderer@0.3.0": | |
230, | |
"halogen-vdom-string-renderer@0.3.1": | |
230, | |
"halogen-vdom-string-renderer@0.5.0": | |
122, | |
"halogen-virtual-dom@1.0.0": | |
-600, | |
"halogen-virtual-dom@2.0.0": | |
1243, | |
"handlebars@0.1.0": | |
89, | |
"handlebars@1.0.0": | |
102, | |
"handlebars@2.0.0": | |
44, | |
"handsontable@0.1.0": | |
259, | |
"handsontable@0.1.1": | |
98, | |
"handsontable@0.2.0": | |
100, | |
"handsontable@1.0.0": | |
-332, | |
"handsontable@2.0.0": | |
-411, | |
"handsontable@3.0.0": | |
680, | |
"hareactive@0.0.1": | |
64, | |
"hareactive@0.0.2": | |
77, | |
"hareactive@0.0.3": | |
72, | |
"hareactive@0.0.4": | |
269, | |
"hareactive@0.0.5": | |
175, | |
"hareactive@0.0.6": | |
173, | |
"hareactive@0.0.7": | |
183, | |
"hareactive@0.0.8": | |
187, | |
"hareactive@0.0.9": | |
259, | |
"hareactive@0.1.0": | |
204, | |
"hareactive@0.1.1": | |
301, | |
"hareactive@0.1.2": | |
306, | |
"has-js-rep@0.1.0": | |
240, | |
"hash@0.1.0": | |
69, | |
"hash@0.1.1": | |
74, | |
"hash@0.1.2": | |
75, | |
"hash@0.2.0": | |
144, | |
"hash@0.2.1": | |
69, | |
"hash@1.0.0": | |
142, | |
"hash@1.1.0": | |
121, | |
"hash@1.1.1": | |
134, | |
"hash@1.3.0": | |
128, | |
"haskell-iso@0.0.0": | |
348, | |
"haskell-iso@0.0.1": | |
443, | |
"haskell-iso@0.0.2": | |
335, | |
"haskell-iso@0.0.3": | |
326, | |
"heap@0.1.0": | |
66, | |
"heckin@1.0.0": | |
136, | |
"heckin@1.0.1": | |
127, | |
"heckin@1.0.2": | |
126, | |
"heckin@1.0.3": | |
128, | |
"heckin@1.1.0": | |
234, | |
"heckin@2.0.0": | |
83, | |
"heckin@2.0.1": | |
83, | |
"heterogeneous@0.1.0": | |
82, | |
"heterogeneous@0.2.0": | |
116, | |
"heterogeneous@0.3.0": | |
109, | |
"heterogeneous@0.4.0": | |
115, | |
"heterogeneous@0.4.1": | |
199, | |
"heterogeneous@0.5.0": | |
74, | |
"heterogeneous@0.5.1": | |
72, | |
"heterogeneous@0.6.0": | |
76, | |
"heterogeneous-extrablatt@0.1.0": | |
103, | |
"heterogeneous-extrablatt@0.2.1": | |
88, | |
"heterogeneous-extrablatt@1.0.0": | |
158, | |
"heterogeneous-extrablatt@1.0.1": | |
88, | |
"hetu@0.2.0": | |
-244, | |
"higher-order@0.1.0": | |
115, | |
"higher-order@0.1.1": | |
142, | |
"higher-order@0.2.0": | |
140, | |
"hoist@1.0.0": | |
72, | |
"hoist@2.0.0": | |
63, | |
"hoist@3.0.0": | |
190, | |
"hoist@4.0.0": | |
116, | |
"home-run-ball@0.1.0": | |
116, | |
"home-run-ball@0.2.0": | |
158, | |
"home-run-ball@1.0.0": | |
121, | |
"homogeneous@0.2.0": | |
116, | |
"homogeneous@0.3.0": | |
102, | |
"homogeneous@0.4.0": | |
1858, | |
"homogeneous-objects@1.0.0": | |
164, | |
"homogeneous-objects@2.0.0": | |
66, | |
"homogeneous-objects@3.0.0": | |
221, | |
"homogeneous-objects@4.0.0": | |
385, | |
"hot-shots@0.0.1": | |
269, | |
"hot-shots@0.0.2": | |
271, | |
"hotteok@0.1.0": | |
359, | |
"hotteok@1.0.0": | |
179, | |
"hotteok@1.0.1": | |
167, | |
"howl@0.1.0": | |
167, | |
"howl@0.2.0": | |
118, | |
"howler@0.2.0": | |
55, | |
"howler@0.3.0": | |
78, | |
"howler@0.4.0": | |
67, | |
"html@0.1.0": | |
100, | |
"html@0.1.1": | |
100, | |
"html@0.2.0": | |
43, | |
"html@0.3.0": | |
54, | |
"html@0.4.0": | |
72, | |
"html@0.5.0": | |
65, | |
"html@0.6.0": | |
66, | |
"html@0.6.1": | |
66, | |
"html@0.6.2": | |
68, | |
"html@0.6.3": | |
124, | |
"html@0.6.4": | |
49, | |
"html@0.6.5": | |
59, | |
"html@0.6.6": | |
69, | |
"html@0.6.7": | |
75, | |
"html@0.6.8": | |
68, | |
"html@0.6.9": | |
128, | |
"html@0.7.0": | |
50, | |
"html@0.8.0": | |
59, | |
"html@0.9.0": | |
72, | |
"html@0.9.1": | |
73, | |
"html@0.10.0": | |
76, | |
"html@0.10.1": | |
149, | |
"html-codegen-halogen@0.0.1": | |
260, | |
"html-parser@1.0.0": | |
-160, | |
"html-parser@1.0.1": | |
-166, | |
"html-parser@1.0.2": | |
-177, | |
"html-parser-halogen@0.1.0": | |
787, | |
"html-parser-halogen@0.2.0": | |
771, | |
"html-parser-halogen@0.3.0": | |
517, | |
"html-parser-halogen@1.0.0": | |
181, | |
"html-parser-halogen@1.1.0": | |
176, | |
"http@0.1.0": | |
52, | |
"http@0.2.0": | |
75, | |
"http@0.3.0": | |
63, | |
"http@0.4.0": | |
79, | |
"http@1.0.0": | |
87, | |
"http@2.0.0": | |
125, | |
"http@3.0.0": | |
51, | |
"http@4.0.0": | |
65, | |
"http-methods@0.1.0": | |
102, | |
"http-methods@0.1.1": | |
92, | |
"http-methods@1.0.0": | |
81, | |
"http-methods@2.0.0": | |
128, | |
"http-methods@3.0.0": | |
209, | |
"http-methods@4.0.0": | |
235, | |
"http-methods@4.0.1": | |
108, | |
"http-methods@4.0.2": | |
103, | |
"http-methods@5.0.0": | |
87, | |
"http-methods@6.0.0": | |
93, | |
"http-types@0.1.0": | |
184, | |
"http-types@0.2.0": | |
186, | |
"http-types@0.2.1": | |
274, | |
"http-types@0.3.0": | |
181, | |
"http-types@0.4.0": | |
131, | |
"http-types@0.5.0": | |
256, | |
"http-types@0.6.0": | |
392, | |
"http-types@0.6.1": | |
399, | |
"http-types-basic@0.0.0": | |
147, | |
"http-types-basic@0.0.1": | |
155, | |
"http-types-basic@0.0.2": | |
244, | |
"http-types-basic@0.0.3": | |
132, | |
"http-types-basic@0.0.4": | |
135, | |
"http-types-basic@0.0.5": | |
145, | |
"httpure@0.1.0": | |
527, | |
"httpure@0.2.0": | |
518, | |
"httpure@0.3.0": | |
679, | |
"httpure@0.4.0": | |
422, | |
"httpure@0.4.1": | |
408, | |
"httpure@0.5.0": | |
423, | |
"httpure@0.6.0": | |
427, | |
"httpure@0.6.1": | |
537, | |
"httpure@0.6.2": | |
422, | |
"httpure@0.6.3": | |
410, | |
"httpure@0.7.0": | |
305, | |
"httpure@0.7.1": | |
302, | |
"httpure@0.8.0": | |
428, | |
"httpure@0.8.1": | |
557, | |
"httpure@0.8.2": | |
401, | |
"httpure@0.8.3": | |
404, | |
"httpure@0.9.0": | |
417, | |
"httpure@0.10.0": | |
419, | |
"httpure@0.11.0": | |
464, | |
"httpure@0.12.0": | |
162, | |
"httpure@0.13.0": | |
239, | |
"httpure@0.13.1": | |
145, | |
"httpure@0.14.0": | |
145, | |
"httpure@0.15.0": | |
136, | |
"httpure@0.16.0": | |
138, | |
"httpure-contrib-biscotti@0.1.0": | |
732, | |
"httpure-contrib-biscotti@0.1.1": | |
609, | |
"httpure-contrib-biscotti@0.1.2": | |
511, | |
"httpure-contrib-biscotti@0.2.0": | |
1100, | |
"httpure-middleware@1.0.0": | |
521, | |
"httpure-middleware@1.1.0": | |
641, | |
"httpure-middleware@1.2.0": | |
494, | |
"httpure-middleware@1.2.1": | |
494, | |
"httpure-middleware@2.0.0": | |
497, | |
"httpure-middleware@2.1.0": | |
502, | |
"httpure-middleware@3.0.0": | |
606, | |
"httpure-middleware@4.0.0": | |
128, | |
"httpure-middleware@4.0.1": | |
126, | |
"httpurple@0.1.0": | |
522, | |
"httpurple@0.2.0": | |
520, | |
"httpurple@0.3.0": | |
558, | |
"httpurple@0.4.0": | |
440, | |
"httpurple@0.4.1": | |
541, | |
"httpurple@0.5.0": | |
423, | |
"httpurple@0.6.0": | |
413, | |
"httpurple@0.6.1": | |
421, | |
"httpurple@0.6.2": | |
431, | |
"httpurple@0.6.3": | |
425, | |
"httpurple@0.7.0": | |
303, | |
"httpurple@0.7.1": | |
412, | |
"httpurple@0.8.0": | |
301, | |
"httpurple@0.8.1": | |
398, | |
"httpurple@0.8.2": | |
406, | |
"httpurple@0.8.3": | |
414, | |
"httpurple@0.9.0": | |
415, | |
"httpurple@0.10.0": | |
417, | |
"httpurple@0.11.0": | |
1228, | |
"httpurple@0.12.0": | |
147, | |
"httpurple@1.0.0": | |
110, | |
"httpurple@1.1.0": | |
120, | |
"httpurple@1.2.0": | |
130, | |
"httpurple@1.2.1": | |
127, | |
"httpurple@1.3.0": | |
131, | |
"httpurple@2.0.0": | |
125, | |
"httpurple@3.0.0": | |
214, | |
"httpurple@3.0.1": | |
104, | |
"httpurple-argonaut@1.0.1": | |
142, | |
"httpurple-yoga-json@1.0.0": | |
144, | |
"huffman@0.2.0": | |
145, | |
"huffman@0.2.1": | |
117, | |
"hugenums@1.0.0": | |
141, | |
"hugenums@1.0.1": | |
65, | |
"hugenums@1.1.0": | |
51, | |
"hugenums@1.2.0": | |
63, | |
"hugenums@1.2.1": | |
73, | |
"hugenums@1.3.0": | |
83, | |
"hugenums@1.3.1": | |
83, | |
"hugenums@1.3.2": | |
86, | |
"hugenums@1.4.0": | |
163, | |
"hugenums@2.0.0": | |
81, | |
"hugenums@2.0.1": | |
52, | |
"hyper@0.1.0": | |
-569, | |
"hyper@0.1.1": | |
-570, | |
"hyper@0.1.2": | |
-578, | |
"hyper@0.1.3": | |
-574, | |
"hyper@0.1.4": | |
-662, | |
"hyper@0.1.5": | |
-549, | |
"hyper@0.2.0": | |
-560, | |
"hyper@0.3.0": | |
-584, | |
"hyper@0.4.0": | |
-585, | |
"hyper@0.4.1": | |
-585, | |
"hyper@0.5.0": | |
-671, | |
"hyper@0.6.0": | |
-547, | |
"hyper@0.7.0": | |
792, | |
"hyper@0.7.1": | |
800, | |
"hyper@0.7.2": | |
823, | |
"hyper@0.7.3": | |
806, | |
"hyper@0.8.0": | |
913, | |
"hyper@0.9.0": | |
463, | |
"hyper@0.9.1": | |
447, | |
"hyper@0.10.0": | |
-428, | |
"hyper@0.10.1": | |
-410, | |
"hyper@0.11.0": | |
377, | |
"hyper@0.11.1": | |
382, | |
"hyper-sslify@0.1.0": | |
1065, | |
"hyper-sslify@0.1.1": | |
872, | |
"hyper-sslify@0.1.2": | |
893, | |
"hyperdrive@0.1.0": | |
1001, | |
"hypertrout@0.8.0": | |
1064, | |
"hypertrout@0.8.1": | |
1181, | |
"hypertrout@0.9.0": | |
1011, | |
"hypertrout@0.10.0": | |
635, | |
"hypertrout@0.11.0": | |
-568, | |
"hypertrout@0.11.1": | |
575, | |
"hyrule@1.0.0": | |
180, | |
"hyrule@1.1.0": | |
201, | |
"hyrule@1.2.0": | |
380, | |
"hyrule@1.2.1": | |
238, | |
"hyrule@1.2.2": | |
232, | |
"hyrule@1.2.3": | |
247, | |
"hyrule@1.2.4": | |
249, | |
"hyrule@1.3.0": | |
249, | |
"hyrule@1.4.0": | |
121, | |
"hyrule@1.4.1": | |
226, | |
"hyrule@1.4.2": | |
111, | |
"hyrule@1.5.0": | |
95, | |
"hyrule@1.5.1": | |
102, | |
"hyrule@1.6.0": | |
113, | |
"hyrule@1.6.1": | |
115, | |
"hyrule@1.6.2": | |
124, | |
"hyrule@1.6.3": | |
100, | |
"hyrule@1.6.4": | |
210, | |
"hyrule@1.6.5": | |
92, | |
"hyrule@1.6.6": | |
94, | |
"hyrule@1.6.7": | |
100, | |
"hyrule@1.6.8": | |
108, | |
"hyrule@1.6.9": | |
111, | |
"hyrule@2.0.0": | |
123, | |
"hyrule@2.0.6": | |
247, | |
"hyrule@2.0.7": | |
112, | |
"hyrule@2.0.8": | |
107, | |
"hyrule@2.1.0": | |
126, | |
"hyrule@2.2.0": | |
123, | |
"hyrule@2.3.0": | |
125, | |
"hyrule@2.3.1": | |
125, | |
"hyrule@2.3.2": | |
210, | |
"hyrule@2.3.3": | |
115, | |
"ide-purescript-core@0.7.0": | |
790, | |
"ide-purescript-core@0.7.1": | |
796, | |
"ide-purescript-core@0.8.0": | |
800, | |
"ide-purescript-core@0.8.1": | |
808, | |
"ide-purescript-core@0.8.2": | |
905, | |
"ide-purescript-core@0.9.0": | |
779, | |
"ide-purescript-core@0.9.1": | |
778, | |
"ide-purescript-core@0.10.0": | |
867, | |
"ide-purescript-core@0.10.1": | |
871, | |
"ide-purescript-core@0.10.2": | |
869, | |
"ide-purescript-core@0.10.3": | |
970, | |
"ide-purescript-core@0.10.4": | |
835, | |
"ide-purescript-core@0.11.0": | |
848, | |
"ide-purescript-core@0.12.0": | |
872, | |
"ide-purescript-core@0.12.1": | |
947, | |
"ide-purescript-core@0.13.0": | |
853, | |
"ide-purescript-core@0.14.0": | |
829, | |
"ide-purescript-core@0.15.0": | |
931, | |
"ide-purescript-core@0.16.0": | |
947, | |
"ide-purescript-core@0.16.1": | |
950, | |
"identity@0.1.0": | |
119, | |
"identity@0.2.0": | |
79, | |
"identity@0.3.0": | |
49, | |
"identity@0.4.0": | |
56, | |
"identity@0.4.1": | |
75, | |
"identity@1.0.0": | |
60, | |
"identity@1.1.0": | |
72, | |
"identity@2.0.0": | |
77, | |
"identity@2.1.0": | |
84, | |
"identity@3.0.0": | |
96, | |
"identity@3.1.0": | |
59, | |
"identity@4.0.0": | |
50, | |
"identity@4.1.0": | |
75, | |
"identity@5.0.0": | |
66, | |
"identity@6.0.0": | |
115, | |
"identy@1.0.0": | |
280, | |
"identy@2.0.0": | |
224, | |
"identy@2.0.1": | |
210, | |
"identy@2.0.2": | |
196, | |
"identy@2.1.0": | |
197, | |
"identy@2.2.0": | |
327, | |
"identy@3.0.0": | |
131, | |
"identy@4.0.0": | |
102, | |
"identy@4.0.1": | |
94, | |
"idiomatic-node-buffer@0.1.0": | |
279, | |
"idiomatic-node-buffer@0.2.0": | |
270, | |
"idiomatic-node-buffer@0.4.0": | |
184, | |
"idiomatic-node-buffer@0.4.1": | |
194, | |
"idiomatic-node-crypto@0.2.0": | |
318, | |
"idiomatic-node-crypto@0.2.1": | |
202, | |
"idiomatic-node-errors@0.3.0": | |
42, | |
"idiomatic-node-errors@0.3.1": | |
69, | |
"idiomatic-node-events@0.4.0": | |
187, | |
"idiomatic-node-events@0.4.1": | |
181, | |
"idiomatic-node-http@0.4.0": | |
277, | |
"idiomatic-node-http@0.4.1": | |
182, | |
"idiomatic-node-process@0.3.0": | |
43, | |
"idiomatic-node-process@0.3.1": | |
55, | |
"idiomatic-node-server@0.1.0": | |
-241, | |
"idiomatic-node-server@0.2.0": | |
-231, | |
"idiomatic-node-server@0.3.0": | |
-229, | |
"idiomatic-node-server@0.5.0": | |
202, | |
"idiomatic-node-server@0.5.1": | |
338, | |
"idiomatic-node-stream@0.2.0": | |
-361, | |
"idiomatic-node-stream@0.3.0": | |
-356, | |
"idiomatic-node-stream@0.6.0": | |
187, | |
"idiomatic-node-stream@0.6.1": | |
191, | |
"ifrit@0.1.0": | |
-223, | |
"ifrit@0.1.1": | |
-220, | |
"ifrit@0.1.2": | |
-225, | |
"ifrit@0.1.3": | |
-319, | |
"imagediff@0.1.0": | |
77, | |
"imagediff@0.2.0": | |
69, | |
"imagediff@0.3.0": | |
86, | |
"imagediff@0.4.0": | |
76, | |
"impulse@1.0.0": | |
66, | |
"impulse@1.0.1": | |
91, | |
"impulse@1.1.0": | |
127, | |
"impulse@1.2.0": | |
70, | |
"impulse@1.3.0": | |
76, | |
"impulse@1.3.1": | |
86, | |
"impulse@2.0.0": | |
272, | |
"impulse@2.0.1": | |
274, | |
"impulse@2.0.2": | |
268, | |
"impulse@2.0.3": | |
273, | |
"impulse@2.1.0": | |
363, | |
"impulse@2.1.1": | |
257, | |
"impulse@2.2.0": | |
264, | |
"impulse@2.2.1": | |
271, | |
"impulse@3.0.0": | |
296, | |
"impur@0.0.1": | |
679, | |
"impur@0.0.2": | |
647, | |
"impur@0.0.3": | |
656, | |
"impur@0.0.4": | |
662, | |
"impur@0.0.5": | |
660, | |
"impur@0.0.6": | |
666, | |
"incremental@0.1.0": | |
190, | |
"incremental@0.2.0": | |
90, | |
"incremental@0.3.0": | |
82, | |
"incremental-dom@0.1.0": | |
563, | |
"incremental-functions@0.1.0": | |
155, | |
"incremental-functions@0.2.0": | |
381, | |
"incremental-functions@0.2.1": | |
512, | |
"incremental-functions@1.0.0": | |
264, | |
"incremental-functions@1.1.0": | |
259, | |
"incremental-functions@1.1.1": | |
273, | |
"incremental-functions@1.1.2": | |
276, | |
"incremental-functions@1.2.0": | |
278, | |
"incremental-functions@1.2.1": | |
283, | |
"incremental-functions@1.3.0": | |
388, | |
"incremental-functions@1.4.0": | |
278, | |
"incremental-functions@1.5.0": | |
264, | |
"incremental-functions@2.0.0": | |
148, | |
"index@0.1.0": | |
-70, | |
"index@0.2.0": | |
73, | |
"index@0.3.0": | |
85, | |
"index@0.4.0": | |
95, | |
"indexed@0.0.1": | |
120, | |
"indexed@0.0.2": | |
62, | |
"indexed-monad@0.1.0": | |
-167, | |
"indexed-monad@0.1.1": | |
-138, | |
"indexed-monad@0.2.0": | |
457, | |
"indexed-monad@0.3.0": | |
433, | |
"indexed-monad@1.0.0": | |
59, | |
"indexed-monad@1.1.0": | |
74, | |
"indexed-monad@1.2.0": | |
113, | |
"indexed-monad@2.0.0": | |
43, | |
"indexed-monad@2.0.1": | |
55, | |
"indexed-monad@2.1.0": | |
72, | |
"indexed-nonempty@0.0.1": | |
322, | |
"indexed-nonempty@0.1.0": | |
363, | |
"indexed-nonempty@1.0.0": | |
89, | |
"indexeddb@1.0.0": | |
412, | |
"indexeddb@1.0.1": | |
414, | |
"indexeddb@1.0.2": | |
425, | |
"indexeddb@2.0.0": | |
515, | |
"indexeddb@2.0.1": | |
517, | |
"indexeddb@3.0.0": | |
519, | |
"indexeddb@4.0.0": | |
625, | |
"inefficiency@0.0.1": | |
39, | |
"infinite-list@0.1.0": | |
118, | |
"infinite-list@0.2.0": | |
159, | |
"infinite-list@0.2.1": | |
158, | |
"infinite-list@0.2.2": | |
250, | |
"infinite-lists@1.0.0": | |
51, | |
"infinite-lists@1.1.0": | |
63, | |
"infinite-lists@2.0.0": | |
71, | |
"infinite-lists@3.0.0": | |
70, | |
"infinite-lists@3.1.0": | |
74, | |
"infinite-lists@3.2.0": | |
152, | |
"inflection@0.0.0": | |
70, | |
"inflection@1.0.0": | |
49, | |
"inflection@1.0.1": | |
55, | |
"information@2.0.1": | |
263, | |
"information@2.0.2": | |
224, | |
"information@2.0.3": | |
228, | |
"inject@0.0.2": | |
67, | |
"inject@0.1.0": | |
176, | |
"inject@0.2.0": | |
68, | |
"inject@0.2.1": | |
80, | |
"inject@0.3.0": | |
67, | |
"inject@1.0.0": | |
65, | |
"inject@2.0.0": | |
97, | |
"inject@3.0.0": | |
88, | |
"inject@4.0.0": | |
179, | |
"inject@4.0.1": | |
130, | |
"int-53@0.0.0": | |
53, | |
"int-53@0.0.1": | |
66, | |
"int-53@1.0.0": | |
67, | |
"int-53@1.1.0": | |
68, | |
"int-53@2.0.0": | |
71, | |
"int-53@2.0.1": | |
115, | |
"int-53@2.1.0": | |
57, | |
"int-53@2.1.1": | |
107, | |
"int-53@3.0.0": | |
252, | |
"int-53@4.0.0": | |
65, | |
"int64@1.0.0": | |
99, | |
"int64@2.0.0": | |
152, | |
"integers@0.0.1": | |
37, | |
"integers@0.1.0": | |
53, | |
"integers@0.2.0": | |
74, | |
"integers@0.2.1": | |
69, | |
"integers@1.0.0": | |
97, | |
"integers@1.1.0": | |
95, | |
"integers@2.0.0": | |
46, | |
"integers@2.1.0": | |
53, | |
"integers@2.1.1": | |
78, | |
"integers@3.0.0": | |
71, | |
"integers@3.1.0": | |
63, | |
"integers@3.2.0": | |
75, | |
"integers@4.0.0": | |
70, | |
"integers@5.0.0": | |
125, | |
"integers@6.0.0": | |
50, | |
"interpolate@1.0.0": | |
54, | |
"interpolate@2.0.0": | |
59, | |
"interpolate@2.0.1": | |
73, | |
"interpolate@3.0.0": | |
59, | |
"interpolate@3.0.1": | |
73, | |
"interpolate@4.0.0": | |
136, | |
"interpolate@5.0.0": | |
46, | |
"interpolate@5.0.1": | |
51, | |
"interpolate@5.0.2": | |
62, | |
"intertwine@0.0.1": | |
231, | |
"intertwine@0.0.2": | |
198, | |
"intertwine@0.0.3": | |
177, | |
"intertwine@0.0.4": | |
178, | |
"intertwine@0.1.0": | |
212, | |
"intertwine@0.1.1": | |
295, | |
"intertwine@0.1.2": | |
190, | |
"intertwine@0.2.0": | |
184, | |
"intertwine@0.2.1": | |
200, | |
"intertwine@0.2.2": | |
205, | |
"intertwine@0.2.3": | |
288, | |
"intertwine@0.2.4": | |
195, | |
"intertwine@0.3.0": | |
187, | |
"intertwine@0.4.0": | |
188, | |
"intertwine@0.4.1": | |
203, | |
"intertwine@0.4.2": | |
202, | |
"intervals@0.0.1": | |
269, | |
"intervals@1.0.0": | |
239, | |
"intervals@2.0.0": | |
349, | |
"intervals@2.0.1": | |
234, | |
"intervals@3.0.0": | |
229, | |
"intervals@3.1.0": | |
237, | |
"intervals@3.2.0": | |
242, | |
"intervals@4.0.0": | |
106, | |
"intl@0.1.0": | |
397, | |
"intl@0.1.1": | |
493, | |
"intl@0.2.0": | |
371, | |
"intl@0.3.0": | |
362, | |
"intl@0.4.0": | |
382, | |
"intl@0.4.1": | |
380, | |
"intl@0.4.2": | |
380, | |
"intmap@1.0.0": | |
628, | |
"intmap@1.0.1": | |
504, | |
"intmaps@1.1.2": | |
47, | |
"intmaps@1.1.3": | |
64, | |
"invariant@0.1.0": | |
71, | |
"invariant@0.2.0": | |
60, | |
"invariant@0.3.0": | |
78, | |
"invariant@1.0.0": | |
114, | |
"invariant@2.0.0": | |
45, | |
"invariant@3.0.0": | |
53, | |
"invariant@4.0.0": | |
58, | |
"invariant@4.1.0": | |
71, | |
"invariant@5.0.0": | |
62, | |
"invariant@6.0.0": | |
134, | |
"invertible-syntax@1.0.0": | |
149, | |
"io-lists@0.0.1": | |
178, | |
"io-lists@0.0.2": | |
190, | |
"io-lists@0.0.3": | |
187, | |
"io-lists@0.0.4": | |
194, | |
"ipfs-api@0.0.1": | |
505, | |
"ipfs-api@0.0.2": | |
507, | |
"ipfs-api@0.0.3": | |
630, | |
"ipfs-api@0.0.4": | |
535, | |
"isometric@0.1.0": | |
86, | |
"isometric@0.2.0": | |
-88, | |
"isometric@1.0.0": | |
81, | |
"isometric@2.0.0": | |
350, | |
"isometric@3.0.0": | |
253, | |
"isomorphisms@2.0.0": | |
43, | |
"isomorphisms@3.0.0": | |
74, | |
"isomorphisms@4.0.0": | |
98, | |
"isomorphisms@5.0.0": | |
79, | |
"isotypes@0.1.0": | |
80, | |
"isotypes@0.1.1": | |
80, | |
"isotypes@1.0.0": | |
474, | |
"iterable@1.0.0": | |
51, | |
"iterable@2.0.0": | |
171, | |
"jack@0.0.1": | |
90, | |
"jack@0.0.2": | |
104, | |
"jack@0.1.0": | |
105, | |
"jack@0.2.0": | |
106, | |
"jack@1.0.0": | |
188, | |
"jack@2.0.0": | |
348, | |
"jack@3.0.0": | |
110, | |
"jajanmen@0.1.0": | |
313, | |
"jajanmen@0.2.0": | |
316, | |
"jajanmen@1.0.0": | |
322, | |
"jarilo@0.4.0": | |
309, | |
"jarilo@0.5.0": | |
415, | |
"jarilo@0.5.1": | |
311, | |
"jarilo@0.5.2": | |
290, | |
"jarilo@0.5.3": | |
403, | |
"jarilo@1.0.0": | |
130, | |
"jarilo@1.0.1": | |
130, | |
"jaws@0.1.0": | |
191, | |
"jaws@0.1.1": | |
194, | |
"jaws@0.1.2": | |
301, | |
"jaws@0.1.3": | |
182, | |
"jaws@0.1.4": | |
172, | |
"jaws@0.1.5": | |
188, | |
"jaws@0.1.6": | |
190, | |
"jaws@0.1.7": | |
190, | |
"jaws@0.1.8": | |
295, | |
"jaws@0.1.9": | |
189, | |
"jaws@0.2.0": | |
174, | |
"jaws@0.2.1": | |
165, | |
"jaws@0.2.2": | |
177, | |
"jaws@0.2.3": | |
178, | |
"jelly@0.1.0": | |
-268, | |
"jelly@0.1.1": | |
-267, | |
"jelly@0.2.0": | |
-380, | |
"jelly@0.3.1": | |
-251, | |
"jelly@0.4.0": | |
-248, | |
"jelly@0.4.1": | |
-260, | |
"jelly@0.5.0": | |
132, | |
"jelly@0.6.0": | |
119, | |
"jelly@0.6.1": | |
118, | |
"jelly@0.6.2": | |
227, | |
"jelly@0.6.3": | |
108, | |
"jelly@0.7.0": | |
92, | |
"jelly@0.8.0": | |
101, | |
"jelly@0.8.1": | |
117, | |
"jelly@0.9.0": | |
-276, | |
"jelly-hooks@0.1.0": | |
100, | |
"jelly-hooks@0.2.0": | |
101, | |
"jelly-hooks@0.2.1": | |
193, | |
"jelly-hooks@0.3.0": | |
-86, | |
"jelly-router@0.1.0": | |
103, | |
"jelly-router@0.1.1": | |
126, | |
"jelly-router@0.2.1": | |
-295, | |
"jelly-signal@0.1.0": | |
60, | |
"jelly-signal@0.2.0": | |
72, | |
"jelly-signal@0.3.0": | |
109, | |
"jest@0.1.0": | |
50, | |
"jest@0.2.0": | |
52, | |
"jest@0.2.1": | |
57, | |
"jest@0.3.0": | |
417, | |
"jest@0.4.0": | |
356, | |
"jest@0.5.0": | |
273, | |
"jest@1.0.0": | |
3403, | |
"jolly-pong@0.1.0": | |
206, | |
"jolly-pong@0.2.0": | |
221, | |
"jolly-pong@1.0.0": | |
186, | |
"jquery@0.2.0": | |
-54, | |
"jquery@0.2.1": | |
-71, | |
"jquery@0.2.2": | |
-130, | |
"jquery@0.2.3": | |
-56, | |
"jquery@0.3.0": | |
70, | |
"jquery@0.4.0": | |
71, | |
"jquery@0.5.0": | |
91, | |
"jquery@0.6.0": | |
109, | |
"jquery@0.6.1": | |
109, | |
"jquery@1.0.0": | |
80, | |
"jquery@2.0.0": | |
-347, | |
"jquery@3.0.0": | |
391, | |
"jquery@3.1.0": | |
-322, | |
"jquery@4.0.0": | |
429, | |
"jquery@4.1.0": | |
708, | |
"jquery@4.2.0": | |
694, | |
"jquery@4.2.1": | |
885, | |
"jquery@4.3.0": | |
680, | |
"jquery@5.0.0": | |
260, | |
"jquery-fancy@0.0.1": | |
696, | |
"jquery-fancy@0.1.0": | |
705, | |
"jquery-fancy@0.2.0": | |
705, | |
"jquery-fancy@0.3.0": | |
709, | |
"jquery-fancy@1.0.0": | |
404, | |
"jquery-fancy@2.0.0": | |
305, | |
"jquery-slider@0.1.0": | |
101, | |
"jquery-slider@0.2.0": | |
106, | |
"js@0.1.0": | |
66, | |
"js@0.1.1": | |
76, | |
"js@0.1.2": | |
72, | |
"js-barcode@0.1.0": | |
-224, | |
"js-barcode@1.0.0": | |
641, | |
"js-barcode@1.0.1": | |
490, | |
"js-barcode@1.0.2": | |
483, | |
"js-barcode-halogen@0.1.0": | |
-263, | |
"js-barcode-halogen@0.2.0": | |
-270, | |
"js-barcode-halogen@1.0.0": | |
-751, | |
"js-barcode-halogen@1.0.1": | |
-747, | |
"js-barcode-halogen@2.0.0": | |
-817, | |
"js-bigints@1.0.1": | |
74, | |
"js-bigints@1.1.0": | |
76, | |
"js-bigints@1.2.0": | |
92, | |
"js-cookie@0.0.0": | |
826, | |
"js-date@1.0.0": | |
65, | |
"js-date@1.1.0": | |
145, | |
"js-date@1.2.0": | |
61, | |
"js-date@2.0.0": | |
252, | |
"js-date@3.0.0": | |
181, | |
"js-date@4.0.0": | |
244, | |
"js-date@5.0.0": | |
243, | |
"js-date@5.0.1": | |
484, | |
"js-date@5.1.0": | |
402, | |
"js-date@5.2.0": | |
388, | |
"js-date@6.0.0": | |
199, | |
"js-date@7.0.0": | |
123, | |
"js-date@8.0.0": | |
104, | |
"js-fileio@2.1.0": | |
274, | |
"js-fileio@2.2.0": | |
130, | |
"js-fileio@3.0.0": | |
216, | |
"js-history@2.0.1": | |
-275, | |
"js-history@2.0.2": | |
-267, | |
"js-history@2.0.3": | |
-277, | |
"js-promise@1.0.0": | |
69, | |
"js-promise-aff@1.0.0": | |
108, | |
"js-timers@1.0.0": | |
56, | |
"js-timers@2.0.0": | |
124, | |
"js-timers@3.0.0": | |
52, | |
"js-timers@4.0.0": | |
50, | |
"js-timers@4.0.1": | |
59, | |
"js-timers@5.0.0": | |
76, | |
"js-timers@5.0.1": | |
61, | |
"js-timers@6.0.0": | |
73, | |
"js-timers@6.1.0": | |
110, | |
"js-uri@1.0.0": | |
45, | |
"js-uri@2.0.0": | |
54, | |
"js-uri@3.0.0": | |
71, | |
"js-uri@3.1.0": | |
68, | |
"jsdiff@0.1.0": | |
276, | |
"json-minify@1.0.0": | |
49, | |
"json-minify@1.0.1": | |
55, | |
"json-minify@2.0.0": | |
51, | |
"json-minify@3.0.0": | |
70, | |
"json-pointer@0.1.0": | |
397, | |
"json-pointer@1.0.0": | |
392, | |
"json-pointer@1.1.0": | |
381, | |
"json-schema@0.0.1": | |
280, | |
"jsonrpc@0.1.0": | |
871, | |
"jsonrpc@0.1.1": | |
836, | |
"jsonrpc@0.2.0": | |
886, | |
"jsonrpc@0.2.1": | |
863, | |
"jtable@0.7.0": | |
-178, | |
"jtable@0.8.0": | |
305, | |
"jtable@0.9.0": | |
184, | |
"jtable@0.10.0": | |
184, | |
"jtable@0.11.0": | |
133, | |
"jtable@0.12.0": | |
141, | |
"jtable@0.13.0": | |
141, | |
"jtable@1.0.0": | |
103, | |
"jtable@2.0.0": | |
-359, | |
"jtable@2.0.1": | |
-242, | |
"jtable@3.0.0": | |
-549, | |
"jtable@4.0.0": | |
-420, | |
"jtable@5.0.0": | |
-847, | |
"jtable@5.1.0": | |
-938, | |
"jtable@6.0.0": | |
-826, | |
"jtable@7.0.0": | |
-807, | |
"jtable@8.0.0": | |
760, | |
"justifill@0.1.0": | |
416, | |
"justifill@0.2.0": | |
16577, | |
"justifill@0.2.1": | |
289, | |
"justifill@0.3.1": | |
44, | |
"justifill@0.5.0": | |
62, | |
"jwt@0.0.1": | |
118, | |
"jwt@0.0.2": | |
-262, | |
"jwt@0.0.3": | |
449, | |
"jwt@0.0.4": | |
192, | |
"jwt@0.0.5": | |
280, | |
"jwt@0.0.6": | |
216, | |
"jwt@0.0.7": | |
186, | |
"jwt@0.0.8": | |
-134, | |
"jwt@0.0.9": | |
96, | |
"kafkajs@0.1.0": | |
304, | |
"kafkajs@0.2.0": | |
-303, | |
"kancho@0.1.0": | |
194, | |
"kancho@0.2.0": | |
331, | |
"kancho@0.3.0": | |
180, | |
"kancho@1.0.0": | |
147, | |
"kancho@2.0.0": | |
146, | |
"kanren@1.0.0": | |
65, | |
"kanren@2.0.0": | |
169, | |
"karma-test-unit@1.0.0": | |
-247, | |
"karma-test-unit@1.0.1": | |
874, | |
"karma-test-unit@1.0.2": | |
715, | |
"karma-test-unit@1.1.0": | |
631, | |
"karma-test-unit@2.0.0": | |
632, | |
"karma-test-unit@3.0.0": | |
332, | |
"kefir@0.1.0": | |
68, | |
"kefir@0.2.0": | |
69, | |
"kefir@0.3.0": | |
137, | |
"kefir@0.4.0": | |
45, | |
"kefir@0.5.0": | |
63, | |
"kefir@0.6.0": | |
76, | |
"kefir@0.6.1": | |
66, | |
"kefir@0.6.2": | |
71, | |
"kefir@0.6.3": | |
69, | |
"kefir@0.6.4": | |
121, | |
"kefir@0.6.5": | |
49, | |
"kefir@0.6.6": | |
73, | |
"kefir@0.6.7": | |
69, | |
"kefir@0.6.8": | |
70, | |
"kefir@0.6.9": | |
73, | |
"key-based-diff@0.1.0": | |
327, | |
"key-based-diff@0.1.1": | |
200, | |
"key-based-diff@0.1.2": | |
206, | |
"key-based-diff@0.2.0": | |
215, | |
"key-based-diff@0.3.0": | |
205, | |
"key-based-diff@0.4.0": | |
205, | |
"kishimen@0.1.0": | |
111, | |
"kishimen@0.2.0": | |
107, | |
"kishimen@1.0.0": | |
225, | |
"kishimen@1.0.1": | |
98, | |
"kishimen@2.0.0": | |
102, | |
"kleene-logic@0.1.0": | |
62, | |
"knockoutjs@0.0.1": | |
84, | |
"knockoutjs@0.0.2": | |
77, | |
"kubernetes@0.1.0": | |
562, | |
"kubernetes@0.1.1": | |
643, | |
"kubernetes@0.1.2": | |
518, | |
"kubernetes@0.2.0": | |
532, | |
"kubernetes@0.3.0": | |
535, | |
"kubernetes@0.4.0": | |
540, | |
"kubernetes@0.5.0": | |
641, | |
"kubernetes@0.6.0": | |
373, | |
"kushiyaki@0.1.0": | |
167, | |
"lambs@0.1.0": | |
311, | |
"lambs@0.2.0": | |
319, | |
"lambs@0.3.0": | |
316, | |
"lambs@0.3.1": | |
315, | |
"language-cst-parser@0.1.0": | |
162, | |
"language-cst-parser@0.2.0": | |
247, | |
"language-cst-parser@0.2.1": | |
153, | |
"language-cst-parser@0.3.0": | |
163, | |
"language-cst-parser@0.4.0": | |
160, | |
"language-cst-parser@0.4.1": | |
161, | |
"language-cst-parser@0.4.2": | |
159, | |
"language-cst-parser@0.5.0": | |
259, | |
"language-cst-parser@0.5.1": | |
142, | |
"language-cst-parser@0.6.0": | |
-174, | |
"language-cst-parser@0.7.0": | |
-175, | |
"language-cst-parser@0.7.1": | |
-183, | |
"language-cst-parser@0.7.2": | |
-185, | |
"language-cst-parser@0.8.0": | |
190, | |
"language-cst-parser@0.8.1": | |
109, | |
"language-cst-parser@0.8.2": | |
102, | |
"language-cst-parser@0.8.3": | |
118, | |
"language-cst-parser@0.9.0": | |
112, | |
"language-cst-parser@0.9.1": | |
114, | |
"language-cst-parser@0.9.2": | |
112, | |
"language-cst-parser@0.9.3": | |
113, | |
"language-cst-parser@0.10.0": | |
198, | |
"language-cst-parser@0.10.1": | |
112, | |
"language-cst-parser@0.11.0": | |
110, | |
"language-cst-parser@0.12.0": | |
95, | |
"language-cst-parser@0.12.1": | |
100, | |
"language-purescript-ast@0.0.1": | |
98, | |
"language-purescript-base@0.0.1": | |
89, | |
"language-purescript-base@0.0.2": | |
88, | |
"language-purescript-base@0.0.3": | |
175, | |
"lattice@0.1.0": | |
59, | |
"lattice@0.2.0": | |
56, | |
"lattice@0.3.0": | |
76, | |
"lazy@0.1.1": | |
-66, | |
"lazy@0.1.2": | |
74, | |
"lazy@0.2.0": | |
73, | |
"lazy@0.3.0": | |
70, | |
"lazy@0.3.1": | |
120, | |
"lazy@0.4.0": | |
97, | |
"lazy@0.4.1": | |
48, | |
"lazy@1.0.0": | |
71, | |
"lazy@1.0.1": | |
66, | |
"lazy@2.0.0": | |
67, | |
"lazy@3.0.0": | |
68, | |
"lazy@4.0.0": | |
74, | |
"lazy@5.0.0": | |
105, | |
"lazy@6.0.0": | |
119, | |
"lazy-joe@1.0.0": | |
108, | |
"lcg@1.0.0": | |
71, | |
"lcg@2.0.0": | |
67, | |
"lcg@3.0.0": | |
71, | |
"lcg@4.0.0": | |
74, | |
"leaflet@0.1.0": | |
62, | |
"leaflet-tdammers@0.0.1": | |
77, | |
"leaflet-tdammers@0.0.3": | |
146, | |
"leaflet-tdammers@0.0.4": | |
111, | |
"leaflet-tdammers@0.1.0": | |
148, | |
"leaflet-tdammers@0.2.0": | |
134, | |
"leaflet-tdammers@0.3.0": | |
133, | |
"leafletjs@0.1.0": | |
773, | |
"leafletjs@0.2.0": | |
770, | |
"leafletjs@0.3.0": | |
1035, | |
"leafletjs@0.3.1": | |
895, | |
"leafletjs@4.0.0": | |
925, | |
"leafletjs@5.0.0": | |
909, | |
"leafletjs@5.1.0": | |
920, | |
"leafletjs@6.0.0": | |
950, | |
"leafletjs-halogen@0.1.0": | |
1590, | |
"leafletjs-halogen@0.2.0": | |
1717, | |
"leafletjs-halogen@1.0.0": | |
1249, | |
"leafletjs-halogen@2.0.0": | |
1233, | |
"leafletjs-halogen@3.0.0": | |
1332, | |
"learn@0.1.0": | |
-105, | |
"learn@0.2.0": | |
114, | |
"learn@0.3.0": | |
228, | |
"leibniz@1.0.0": | |
56, | |
"leibniz@1.1.0": | |
74, | |
"leibniz@2.0.0": | |
66, | |
"leibniz@3.0.0": | |
74, | |
"leibniz@4.0.0": | |
128, | |
"leibniz@4.1.0": | |
50, | |
"leibniz@5.0.0": | |
61, | |
"lenient-html-parser@0.1.0": | |
218, | |
"lenient-html-parser@0.2.0": | |
375, | |
"lenient-html-parser@0.3.0": | |
361, | |
"lenient-html-parser@0.3.1": | |
337, | |
"lenient-html-parser@0.3.2": | |
471, | |
"lenient-html-parser@1.0.0": | |
322, | |
"lenient-html-parser@2.0.0": | |
202, | |
"lenient-html-parser@3.0.0": | |
162, | |
"lenient-html-parser@3.0.1": | |
159, | |
"lenient-html-parser@4.0.0": | |
163, | |
"lens@0.0.1": | |
-70, | |
"lens@0.0.2": | |
-115, | |
"lens@0.0.3": | |
-110, | |
"lens@0.1.0": | |
-59, | |
"lens@0.1.1": | |
-74, | |
"lens@0.1.2": | |
-69, | |
"lens@0.1.3": | |
-82, | |
"lens@0.2.0": | |
-74, | |
"lens@0.2.1": | |
-76, | |
"lens@0.2.2": | |
-70, | |
"lens@0.2.3": | |
-151, | |
"lens@0.3.0": | |
-77, | |
"lens@0.3.1": | |
-69, | |
"lens@0.3.2": | |
-82, | |
"lens@0.3.3": | |
-77, | |
"lens@0.5.0": | |
75, | |
"lens@0.6.0": | |
148, | |
"lens@0.7.0": | |
87, | |
"lens@0.8.0": | |
54, | |
"lens@0.9.0": | |
82, | |
"lens@0.9.1": | |
76, | |
"lens@0.10.0": | |
69, | |
"lens@0.10.1": | |
65, | |
"lens@1.0.0": | |
74, | |
"lens@2.0.0": | |
-161, | |
"lens@3.0.0": | |
104, | |
"lens@4.0.0": | |
58, | |
"lens@5.0.0": | |
85, | |
"lens@5.0.1": | |
77, | |
"lens-simple@1.0.1": | |
64, | |
"lens-simple@2.0.0": | |
78, | |
"lens-simple@3.0.0": | |
95, | |
"lens-simple@4.0.0": | |
103, | |
"linalg@1.0.0": | |
130, | |
"linalg@1.1.0": | |
58, | |
"linalg@4.0.0": | |
84, | |
"linalg@5.0.0": | |
81, | |
"linalg@5.1.0": | |
80, | |
"line-reader@0.1.0": | |
790, | |
"line-reader@0.1.1": | |
774, | |
"line-reader@0.1.2": | |
882, | |
"line-reader@0.2.0": | |
749, | |
"line-wrapping@1.0.0": | |
75, | |
"line-wrapping@1.1.0": | |
82, | |
"line-wrapping@2.0.0": | |
152, | |
"linear-algebra@0.1.0": | |
106, | |
"linear-algebra@0.1.1": | |
110, | |
"linear-algebra@0.2.0": | |
109, | |
"linear-algebra@0.3.0": | |
199, | |
"linear-algebra@0.4.0": | |
101, | |
"linear-algebra@0.5.0": | |
94, | |
"list-zipper@0.1.0": | |
70, | |
"lists@0.3.4": | |
-83, | |
"lists@0.3.5": | |
-82, | |
"lists@0.3.7": | |
-123, | |
"lists@0.3.8": | |
-95, | |
"lists@0.3.9": | |
-55, | |
"lists@0.4.0": | |
-82, | |
"lists@0.5.0": | |
-72, | |
"lists@0.6.0": | |
80, | |
"lists@0.6.1": | |
85, | |
"lists@0.6.2": | |
79, | |
"lists@0.7.0": | |
78, | |
"lists@0.7.1": | |
141, | |
"lists@0.7.2": | |
71, | |
"lists@0.7.3": | |
73, | |
"lists@0.7.4": | |
78, | |
"lists@0.7.5": | |
75, | |
"lists@0.7.6": | |
77, | |
"lists@0.7.7": | |
131, | |
"lists@0.7.8": | |
61, | |
"lists@0.7.9": | |
86, | |
"lists@0.7.10": | |
78, | |
"lists@1.0.0": | |
68, | |
"lists@1.0.1": | |
75, | |
"lists@2.0.0": | |
100, | |
"lists@2.1.0": | |
171, | |
"lists@3.0.0": | |
91, | |
"lists@3.0.1": | |
111, | |
"lists@3.1.0": | |
113, | |
"lists@3.2.0": | |
118, | |
"lists@3.2.1": | |
120, | |
"lists@3.2.2": | |
190, | |
"lists@3.3.0": | |
105, | |
"lists@3.4.0": | |
99, | |
"lists@4.0.0": | |
95, | |
"lists@4.0.1": | |
152, | |
"lists@4.1.0": | |
96, | |
"lists@4.1.1": | |
93, | |
"lists@4.2.0": | |
97, | |
"lists@4.3.0": | |
169, | |
"lists@4.4.0": | |
86, | |
"lists@4.5.0": | |
82, | |
"lists@4.6.0": | |
93, | |
"lists@4.6.1": | |
94, | |
"lists@4.7.0": | |
93, | |
"lists@4.8.0": | |
97, | |
"lists@4.9.0": | |
152, | |
"lists@4.9.1": | |
156, | |
"lists@4.10.0": | |
85, | |
"lists@4.11.0": | |
72, | |
"lists@4.12.0": | |
88, | |
"lists@5.0.0": | |
82, | |
"lists@5.1.0": | |
85, | |
"lists@5.2.0": | |
87, | |
"lists@5.3.0": | |
87, | |
"lists@5.4.0": | |
158, | |
"lists@5.4.1": | |
72, | |
"lists@6.0.0": | |
69, | |
"lists@6.0.1": | |
90, | |
"lists@6.1.0": | |
82, | |
"lists@7.0.0": | |
81, | |
"lists-fast@1.0.0": | |
103, | |
"lists-fast@1.0.1": | |
101, | |
"lit-html@0.1.0": | |
437, | |
"lit-html@0.2.0": | |
330, | |
"literals@0.1.0": | |
51, | |
"literals@0.1.1": | |
77, | |
"literals@0.2.0": | |
68, | |
"literals@1.0.0": | |
71, | |
"literals@1.0.1": | |
68, | |
"literals@1.0.2": | |
68, | |
"lnforum-types@0.11.0": | |
-1063, | |
"localstorage@0.1.0": | |
89, | |
"localstorage@0.1.1": | |
106, | |
"localstorage@0.1.2": | |
115, | |
"localstorage@0.1.3": | |
108, | |
"localstorage@1.0.0": | |
80, | |
"localstorage@2.0.0": | |
-206, | |
"localstorage@3.0.1": | |
-347, | |
"localstorage@4.0.0": | |
593, | |
"location@1.0.0": | |
44, | |
"logging@0.0.1": | |
75, | |
"logging@0.0.2": | |
75, | |
"logging@0.0.3": | |
76, | |
"logging@0.1.0": | |
78, | |
"logging@1.0.0": | |
226, | |
"logging@1.1.0": | |
98, | |
"logging@2.0.0": | |
95, | |
"logging@3.0.0": | |
97, | |
"logging-bunyan@1.0.0": | |
78, | |
"logging-bunyan@2.0.0": | |
248, | |
"logging-bunyan@3.0.0": | |
356, | |
"logging-journald@0.0.1": | |
358, | |
"logging-journald@0.1.0": | |
494, | |
"logging-journald@0.2.1": | |
114, | |
"logging-journald@0.2.2": | |
118, | |
"logging-journald@0.2.3": | |
187, | |
"logging-journald@0.2.4": | |
181, | |
"logging-journald@0.2.5": | |
115, | |
"logging-journald@0.3.0": | |
117, | |
"logging-journald@0.3.1": | |
191, | |
"logging-journald@0.3.2": | |
105, | |
"logging-journald@0.4.0": | |
-73, | |
"logic@0.0.3": | |
121, | |
"logic@0.0.4": | |
120, | |
"logic@0.0.5": | |
121, | |
"logic@0.1.0": | |
124, | |
"logoot-core@0.0.2": | |
197, | |
"longs@0.1.0": | |
227, | |
"longs@0.1.1": | |
134, | |
"lowdb@0.1.1": | |
-79, | |
"luhncheck@0.0.1": | |
122, | |
"luhncheck@0.0.2": | |
118, | |
"luhncheck@0.0.3": | |
129, | |
"luhncheck@0.0.4": | |
130, | |
"luhncheck@0.0.5": | |
134, | |
"luhncheck@0.0.6": | |
203, | |
"lunapark@5.0.0": | |
421, | |
"lunapark@5.0.1": | |
404, | |
"lunapark@5.0.2": | |
414, | |
"lunapark@6.0.0": | |
381, | |
"lunapark@6.1.0": | |
385, | |
"lunapark@6.2.0": | |
394, | |
"lunapark@7.0.0": | |
370, | |
"lunar-calendar@0.1.0": | |
95, | |
"machines@0.1.0": | |
-46, | |
"machines@0.1.1": | |
-78, | |
"machines@0.1.2": | |
-64, | |
"machines@0.1.3": | |
-70, | |
"machines@0.1.4": | |
-75, | |
"machines@0.1.5": | |
-69, | |
"machines@0.1.6": | |
-117, | |
"machines@0.1.7": | |
-97, | |
"machines@0.2.0": | |
-47, | |
"machines@0.3.0": | |
-76, | |
"machines@0.4.0": | |
72, | |
"machines@0.5.0": | |
74, | |
"machines@0.6.0": | |
62, | |
"machines@0.6.1": | |
79, | |
"machines@0.7.0": | |
149, | |
"machines@0.8.0": | |
98, | |
"machines@0.8.1": | |
54, | |
"machines@1.0.0": | |
76, | |
"machines@2.0.0": | |
153, | |
"machines@2.0.1": | |
138, | |
"machines@3.0.0": | |
148, | |
"machines@4.0.0": | |
215, | |
"machines@5.0.0": | |
180, | |
"machines@5.1.0": | |
93, | |
"machines@6.0.0": | |
72, | |
"machines@6.1.0": | |
86, | |
"machines@7.0.0": | |
78, | |
"makkori@0.1.0": | |
641, | |
"makkori@1.0.0": | |
286, | |
"maps@0.2.0": | |
67, | |
"maps@0.3.0": | |
161, | |
"maps@0.3.1": | |
95, | |
"maps@0.3.2": | |
61, | |
"maps@0.3.3": | |
78, | |
"maps@0.3.4": | |
71, | |
"maps@0.4.0": | |
78, | |
"maps@0.4.1": | |
82, | |
"maps@0.4.2": | |
77, | |
"maps@0.5.0": | |
176, | |
"maps@0.5.1": | |
84, | |
"maps@0.5.2": | |
70, | |
"maps@0.5.3": | |
80, | |
"maps@0.5.4": | |
79, | |
"maps@0.5.5": | |
75, | |
"maps@0.5.6": | |
76, | |
"maps@0.5.7": | |
84, | |
"maps@1.0.0": | |
141, | |
"maps@1.1.0": | |
74, | |
"maps@1.2.0": | |
75, | |
"maps@2.0.0": | |
171, | |
"maps@2.0.1": | |
152, | |
"maps@2.0.2": | |
138, | |
"maps@2.1.0": | |
236, | |
"maps@2.1.1": | |
120, | |
"maps@2.1.2": | |
134, | |
"maps@3.0.0": | |
182, | |
"maps@3.0.1": | |
207, | |
"maps@3.1.0": | |
205, | |
"maps@3.2.0": | |
198, | |
"maps@3.3.0": | |
195, | |
"maps@3.3.1": | |
327, | |
"maps@3.4.0": | |
363, | |
"maps@3.5.0": | |
185, | |
"maps@3.5.1": | |
165, | |
"maps@3.5.2": | |
166, | |
"maps@3.6.0": | |
164, | |
"maps@3.6.1": | |
170, | |
"maps-eager@0.2.0": | |
137, | |
"maps-eager@0.3.0": | |
198, | |
"maps-eager@0.3.1": | |
81, | |
"markdown@0.12.0": | |
96, | |
"markdown@1.0.0": | |
73, | |
"markdown@1.1.0": | |
96, | |
"markdown@1.5.0": | |
74, | |
"markdown@1.5.1": | |
82, | |
"markdown@1.5.2": | |
141, | |
"markdown@1.6.0": | |
59, | |
"markdown@1.7.0": | |
108, | |
"markdown@1.7.1": | |
95, | |
"markdown@1.8.0": | |
94, | |
"markdown@1.9.0": | |
165, | |
"markdown@1.9.1": | |
90, | |
"markdown@1.10.0": | |
78, | |
"markdown@1.11.0": | |
97, | |
"markdown@1.11.1": | |
99, | |
"markdown@1.12.0": | |
95, | |
"markdown@1.12.1": | |
100, | |
"markdown@1.12.2": | |
99, | |
"markdown@2.0.0": | |
183, | |
"markdown@2.0.1": | |
102, | |
"markdown@3.0.0": | |
-84, | |
"markdown@3.1.0": | |
-101, | |
"markdown@3.1.1": | |
-97, | |
"markdown@3.1.2": | |
-102, | |
"markdown@4.0.0": | |
-104, | |
"markdown@5.0.0": | |
-108, | |
"markdown@7.0.0": | |
166, | |
"markdown@8.0.0": | |
447, | |
"markdown@8.0.1": | |
418, | |
"markdown@9.0.0": | |
-276, | |
"markdown@10.0.0": | |
603, | |
"markdown@11.0.0": | |
609, | |
"markdown@11.0.1": | |
605, | |
"markdown@12.0.0": | |
362, | |
"markdown-halogen@0.7.0": | |
292, | |
"markdown-halogen@0.8.0": | |
250, | |
"markdown-halogen@0.8.1": | |
212, | |
"markdown-halogen@0.8.2": | |
216, | |
"markdown-halogen@0.8.3": | |
214, | |
"markdown-halogen@0.8.4": | |
213, | |
"markdown-halogen@0.8.5": | |
219, | |
"markdown-halogen@0.9.0": | |
273, | |
"markdown-halogen@0.10.0": | |
-149, | |
"markdown-halogen@0.11.0": | |
-146, | |
"markdown-halogen@0.12.0": | |
-149, | |
"markdown-halogen@0.13.0": | |
-152, | |
"markdown-halogen@0.14.0": | |
-149, | |
"markdown-halogen@0.15.0": | |
-239, | |
"markdown-halogen@1.0.0": | |
-100, | |
"markdown-halogen@2.0.0": | |
-213, | |
"markdown-halogen@3.0.0": | |
-768, | |
"markdown-halogen@3.0.1": | |
-777, | |
"markdown-halogen@4.0.0": | |
-820, | |
"markdown-halogen@5.0.0": | |
-685, | |
"markdown-halogen@5.0.1": | |
-820, | |
"markdown-halogen@6.0.0": | |
1424, | |
"markdown-halogen@7.0.0": | |
1094, | |
"markdown-halogen@8.0.0": | |
1511, | |
"markdown-halogen@8.0.1": | |
1654, | |
"markdown-halogen@9.0.0": | |
1313, | |
"markdown-halogen@9.0.1": | |
1331, | |
"markdown-it@0.1.0": | |
214, | |
"markdown-it@0.2.0": | |
215, | |
"markdown-it@0.3.0": | |
219, | |
"markdown-it@0.4.0": | |
347, | |
"markdown-it@0.5.0": | |
4830, | |
"markdown-smolder@1.0.0": | |
-495, | |
"markdown-smolder@1.1.0": | |
-488, | |
"markdown-smolder@1.2.0": | |
-490, | |
"markdown-smolder@1.3.0": | |
-493, | |
"mason-prelude@0.3.0": | |
126, | |
"mason-prelude@0.4.0": | |
228, | |
"mason-prelude@0.5.0": | |
135, | |
"mason-prelude@0.6.0": | |
-97, | |
"mason-prelude@0.7.0": | |
-104, | |
"mason-prelude@0.7.1": | |
-99, | |
"mason-prelude@0.8.0": | |
-98, | |
"mason-prelude@0.8.1": | |
-184, | |
"mason-prelude@0.9.0": | |
-94, | |
"mason-prelude@0.9.1": | |
-82, | |
"mason-prelude@0.10.0": | |
-92, | |
"materialize@0.1.3": | |
369, | |
"materialize@0.1.4": | |
365, | |
"materialize@0.1.5": | |
367, | |
"materialize@0.1.6": | |
361, | |
"math@0.1.0": | |
130, | |
"math@0.1.1": | |
48, | |
"math@0.2.0": | |
57, | |
"math@1.0.0": | |
64, | |
"math@2.0.0": | |
65, | |
"math@2.1.0": | |
67, | |
"math@2.1.1": | |
70, | |
"math@3.0.0": | |
95, | |
"math-equation@0.0.0": | |
-453, | |
"math-equation@0.0.1": | |
-435, | |
"mathbox@0.1.0": | |
-460, | |
"mathbox@0.1.1": | |
-381, | |
"mathbox@0.1.2": | |
-382, | |
"mathbox@0.2.0": | |
-391, | |
"mathbox@0.3.0": | |
483, | |
"mathbox@0.4.0": | |
673, | |
"mathbox@0.5.0": | |
190, | |
"mathbox@0.6.0": | |
205, | |
"matrices@1.0.0": | |
64, | |
"matrices@1.0.1": | |
69, | |
"matrices@2.0.0": | |
99, | |
"matrices@3.0.0": | |
325, | |
"matrices@4.0.0": | |
112, | |
"matrices@5.0.0": | |
109, | |
"matrices@5.0.1": | |
122, | |
"matrix@1.0.0": | |
280, | |
"matrix@1.0.1": | |
277, | |
"matrix@1.0.2": | |
281, | |
"matrix@1.1.0": | |
376, | |
"matrix@1.2.0": | |
233, | |
"matrix@2.0.0": | |
443, | |
"matrix@2.1.0": | |
350, | |
"matryoshka@0.1.0": | |
-190, | |
"matryoshka@0.1.1": | |
-193, | |
"matryoshka@0.2.0": | |
-192, | |
"matryoshka@0.3.0": | |
354, | |
"matryoshka@0.4.0": | |
231, | |
"matryoshka@0.5.0": | |
89, | |
"matryoshka@1.0.0": | |
71, | |
"maybe@0.1.0": | |
54, | |
"maybe@0.1.1": | |
71, | |
"maybe@0.1.2": | |
66, | |
"maybe@0.1.3": | |
66, | |
"maybe@0.2.0": | |
124, | |
"maybe@0.2.1": | |
54, | |
"maybe@0.2.2": | |
53, | |
"maybe@0.3.0": | |
76, | |
"maybe@0.3.1": | |
62, | |
"maybe@0.3.2": | |
75, | |
"maybe@0.3.3": | |
70, | |
"maybe@0.3.4": | |
70, | |
"maybe@0.3.5": | |
146, | |
"maybe@1.0.0": | |
49, | |
"maybe@2.0.0": | |
79, | |
"maybe@2.0.1": | |
67, | |
"maybe@2.1.0": | |
71, | |
"maybe@2.1.1": | |
69, | |
"maybe@3.0.0": | |
74, | |
"maybe@3.1.0": | |
76, | |
"maybe@4.0.0": | |
81, | |
"maybe@4.0.1": | |
141, | |
"maybe@5.0.0": | |
56, | |
"maybe@6.0.0": | |
75, | |
"mdast-util-from-markdown@0.1.5": | |
273, | |
"mdast-util-from-markdown@0.2.0": | |
393, | |
"mdast-util-from-markdown@0.2.1": | |
360, | |
"media-types@0.1.0": | |
50, | |
"media-types@0.1.1": | |
53, | |
"media-types@1.0.0": | |
78, | |
"media-types@2.0.0": | |
124, | |
"media-types@3.0.0": | |
206, | |
"media-types@4.0.0": | |
57, | |
"media-types@4.0.1": | |
74, | |
"media-types@5.0.0": | |
131, | |
"media-types@6.0.0": | |
66, | |
"memoize@2.0.1": | |
74, | |
"memoize@3.0.0": | |
195, | |
"memoize@4.0.0": | |
163, | |
"memoize@4.0.1": | |
234, | |
"memoize@5.0.0": | |
127, | |
"merkle-tree@0.0.1": | |
94, | |
"merkle-tree@0.0.2": | |
197, | |
"merkle-tree@0.0.3": | |
85, | |
"merkle-tree@0.0.4": | |
97, | |
"mersenne@0.0.1": | |
77, | |
"mersenne@0.0.2": | |
85, | |
"mersenne@1.0.0": | |
106, | |
"mesos@0.0.0": | |
-285, | |
"metajelo@1.0.0": | |
453, | |
"metajelo@1.0.1": | |
328, | |
"metajelo@1.1.0": | |
311, | |
"metajelo@2.0.0": | |
308, | |
"metajelo@3.0.0": | |
315, | |
"metajelo@3.0.1": | |
430, | |
"metajelo@3.1.0": | |
298, | |
"metajelo-ui-css-classes@0.0.1": | |
-403, | |
"metajelo-ui-css-classes@0.0.2": | |
-413, | |
"metajelo-ui-css-classes@0.0.3": | |
-423, | |
"metajelo-ui-css-classes@0.1.0": | |
-426, | |
"metajelo-ui-css-classes@0.1.1": | |
-414, | |
"metajelo-ui-css-classes@0.1.2": | |
-535, | |
"metajelo-ui-css-classes@0.1.3": | |
-405, | |
"metajelo-ui-css-classes@0.1.6": | |
-414, | |
"metajelo-ui-css-classes@1.0.0": | |
-420, | |
"metajelo-ui-css-classes@1.0.1": | |
-413, | |
"metajelo-web@1.0.2": | |
-315, | |
"metajelo-web@2.0.0": | |
-399, | |
"metric@1.0.0": | |
51, | |
"metric@2.0.0": | |
49, | |
"metric@2.1.0": | |
70, | |
"metrics@1.0.0": | |
433, | |
"midi@1.2.0": | |
451, | |
"midi@2.0.0": | |
231, | |
"midi@2.1.0": | |
241, | |
"midi@2.2.0": | |
348, | |
"midi@2.2.1": | |
207, | |
"midi@2.3.0": | |
212, | |
"midi@2.3.1": | |
222, | |
"midi@2.3.2": | |
218, | |
"midi@2.3.3": | |
-214, | |
"midi@3.0.0": | |
238, | |
"midi@3.1.0": | |
194, | |
"midi@4.0.0": | |
96, | |
"milkis@0.1.0": | |
404, | |
"milkis@0.1.1": | |
388, | |
"milkis@0.2.0": | |
388, | |
"milkis@1.0.0": | |
494, | |
"milkis@2.0.0": | |
387, | |
"milkis@3.0.0": | |
700, | |
"milkis@4.0.0": | |
697, | |
"milkis@4.0.1": | |
700, | |
"milkis@5.0.0": | |
558, | |
"milkis@5.0.1": | |
647, | |
"milkis@5.0.2": | |
684, | |
"milkis@6.0.0": | |
241, | |
"milkis@6.0.1": | |
236, | |
"milkis@6.1.0": | |
255, | |
"milkis@6.2.0": | |
370, | |
"milkis@6.3.0": | |
230, | |
"milkis@6.3.1": | |
241, | |
"milkis@7.0.0": | |
243, | |
"milkis@7.0.1": | |
241, | |
"milkis@7.1.0": | |
244, | |
"milkis@7.2.0": | |
243, | |
"milkis@7.2.1": | |
338, | |
"milkis@7.4.0": | |
236, | |
"milkis@7.5.0": | |
10551, | |
"milkis@8.0.0": | |
135, | |
"milkis@9.0.0": | |
217, | |
"mime@0.0.1": | |
47, | |
"mime@0.0.2": | |
57, | |
"mini-redux@1.0.0": | |
75, | |
"mini-redux@1.0.1": | |
68, | |
"mini-redux@1.0.2": | |
69, | |
"mini-redux@1.1.0": | |
76, | |
"mini-redux@2.0.0": | |
136, | |
"mini-redux@2.1.0": | |
97, | |
"mini-redux@2.1.1": | |
68, | |
"mini-redux@2.1.2": | |
74, | |
"mini-redux@3.0.0": | |
70, | |
"mini-redux@3.0.1": | |
77, | |
"mini-redux@3.0.2": | |
70, | |
"minibench@1.0.0": | |
79, | |
"minibench@1.0.1": | |
136, | |
"minibench@2.0.0": | |
58, | |
"minibench@3.0.0": | |
70, | |
"minibench@4.0.0": | |
67, | |
"minibench@4.0.1": | |
89, | |
"minimatch@0.1.0": | |
58, | |
"minimatch@0.2.0": | |
111, | |
"minimist@0.0.1": | |
262, | |
"minimist@0.0.2": | |
229, | |
"minimist@0.1.0": | |
240, | |
"minimist@0.2.0": | |
236, | |
"minimist@0.3.0": | |
324, | |
"minimist@0.3.1": | |
229, | |
"minimist@0.4.0": | |
311, | |
"mkdirp@0.1.0": | |
-190, | |
"mkdirp@0.2.0": | |
311, | |
"mkdirp@0.3.0": | |
503, | |
"mmorph@1.0.0": | |
-74, | |
"mmorph@2.0.0": | |
73, | |
"mmorph@3.0.0": | |
237, | |
"mmorph@5.0.0": | |
97, | |
"mmorph@5.1.0": | |
117, | |
"mmorph@6.0.0": | |
96, | |
"mmorph@7.0.0": | |
81, | |
"mocha@0.0.2": | |
59, | |
"mocha@0.0.3": | |
71, | |
"mocha@0.0.4": | |
137, | |
"mocha@0.0.5": | |
48, | |
"mochi@0.1.0": | |
141, | |
"mockfree@0.1.0": | |
79, | |
"modular-arithmetic@1.0.0": | |
172, | |
"modular-arithmetic@1.0.1": | |
160, | |
"modular-arithmetic@2.0.0": | |
298, | |
"modular-arithmetic@3.0.0": | |
384, | |
"modular-arithmetic@3.1.0": | |
254, | |
"modular-arithmetic@4.0.0": | |
95, | |
"modules@2.1.0": | |
58, | |
"modules@2.2.0": | |
70, | |
"modules@3.0.0": | |
147, | |
"mol-draw@1.0.1": | |
158, | |
"mol-draw@1.0.6": | |
115, | |
"mol-draw@1.0.7": | |
126, | |
"mol-draw@1.0.8": | |
135, | |
"mol-draw@1.0.9": | |
129, | |
"mol-draw@1.0.10": | |
140, | |
"mol-draw@1.0.11": | |
137, | |
"mol-draw@1.0.12": | |
255, | |
"mol-draw@1.0.13": | |
115, | |
"mol-draw@1.0.14": | |
116, | |
"mol-draw@1.0.15": | |
129, | |
"mol-draw@1.0.16": | |
128, | |
"moldy@0.1.0": | |
69, | |
"moldy@1.0.0": | |
75, | |
"moldy@2.0.0": | |
210, | |
"moldy@2.1.0": | |
223, | |
"moldy@3.0.0": | |
109, | |
"moment@0.0.2": | |
70, | |
"monad-control@3.0.0": | |
228, | |
"monad-control@3.0.1": | |
204, | |
"monad-control@3.0.2": | |
203, | |
"monad-control@4.0.0": | |
420, | |
"monad-control@4.1.0": | |
287, | |
"monad-control@5.0.0": | |
210, | |
"monad-eff@0.1.0": | |
74, | |
"monad-logger@1.0.0": | |
412, | |
"monad-logger@1.1.0": | |
366, | |
"monad-logger@1.2.0": | |
368, | |
"monad-logger@1.3.0": | |
458, | |
"monad-logger@1.3.1": | |
357, | |
"monad-logger-writer@0.0.1": | |
48, | |
"monad-logger-writer@0.0.2": | |
73, | |
"monad-logger-writer@0.0.3": | |
71, | |
"monad-loops@0.1.0": | |
57, | |
"monad-loops@0.2.0": | |
90, | |
"monad-loops@0.2.1": | |
73, | |
"monad-loops@0.3.0": | |
167, | |
"monad-loops@0.3.1": | |
151, | |
"monad-loops@0.3.2": | |
114, | |
"monad-loops@0.3.3": | |
128, | |
"monad-loops@0.3.4": | |
125, | |
"monad-loops@0.3.5": | |
129, | |
"monad-loops@0.4.0": | |
183, | |
"monad-loops@0.5.0": | |
101, | |
"monad-supply@0.0.1": | |
155, | |
"monad-unlift@0.0.0": | |
471, | |
"monad-unlift@1.0.0": | |
335, | |
"monad-unlift@1.0.1": | |
379, | |
"monadic-streams@0.0.1": | |
65, | |
"monadplus-partial@0.1.0": | |
71, | |
"monadplus-partial@0.1.1": | |
125, | |
"monadplus-partial@0.2.0": | |
49, | |
"monadplus-partial@0.2.1": | |
74, | |
"monadplus-partial@0.2.2": | |
65, | |
"monadplus-partial@1.0.0": | |
67, | |
"money@4.1.0": | |
98, | |
"money@4.2.0": | |
160, | |
"money@4.3.0": | |
81, | |
"money@5.0.0": | |
135, | |
"money@6.0.0": | |
119, | |
"money@7.0.0": | |
223, | |
"mongodbf@0.0.4": | |
-64, | |
"mongodbf@0.0.5": | |
-137, | |
"mongodbf@0.1.0": | |
56, | |
"mongodbf@0.2.0": | |
87, | |
"monoid@0.1.5": | |
61, | |
"monoid@0.2.0": | |
76, | |
"monoid@0.3.0": | |
57, | |
"monoid@0.3.1": | |
109, | |
"monoid@0.3.2": | |
44, | |
"monoid@1.0.0": | |
59, | |
"monoid@2.0.0": | |
66, | |
"monoid@2.1.0": | |
69, | |
"monoid@2.2.0": | |
70, | |
"monoid@3.0.0": | |
114, | |
"monoid@3.1.0": | |
48, | |
"monoid@3.2.0": | |
57, | |
"monoid@3.3.0": | |
80, | |
"monoid@3.3.1": | |
61, | |
"monoid-extras@0.0.0": | |
95, | |
"monoid-extras@0.0.1": | |
177, | |
"monoidal@0.1.0": | |
77, | |
"monoidal@0.2.0": | |
62, | |
"monoidal@0.3.0": | |
76, | |
"monoidal@0.4.0": | |
77, | |
"monoidal@0.5.0": | |
81, | |
"monoidal@0.6.0": | |
75, | |
"monoidal@0.7.0": | |
76, | |
"monoidal@0.8.0": | |
161, | |
"monoidal@0.9.0": | |
120, | |
"monoidal@0.10.0": | |
55, | |
"monoidal@0.12.0": | |
77, | |
"monoidal@0.13.0": | |
89, | |
"monoidal@0.14.0": | |
93, | |
"monoidal@0.15.0": | |
93, | |
"monoidal@0.16.0": | |
136, | |
"moonshine@0.0.1": | |
547, | |
"moonshine@0.0.2": | |
-42, | |
"moonshine@0.0.3": | |
-52, | |
"moonshine@1.0.0": | |
-64, | |
"moonshine@2.0.0": | |
-66, | |
"morello@0.1.0": | |
-203, | |
"morello@0.1.1": | |
-193, | |
"morello@0.2.0": | |
-193, | |
"morello@0.3.2": | |
210, | |
"morello@0.4.0": | |
90, | |
"most@0.1.0": | |
455, | |
"mostly-dom@0.1.0": | |
-282, | |
"mote@0.1.0": | |
214, | |
"mote@0.2.0": | |
214, | |
"mote@1.0.0": | |
107, | |
"mote@1.1.0": | |
190, | |
"mote@2.0.0": | |
138, | |
"mote@3.0.0": | |
95, | |
"mote-runner@2.0.0": | |
219, | |
"mote-runner@3.0.0": | |
193, | |
"mote-runner@3.0.1": | |
194, | |
"motsunabe@1.0.0": | |
119, | |
"motsunabe@2.0.0": | |
120, | |
"msgpack@0.0.0": | |
1008, | |
"msgpack-msgpack@0.1.0": | |
247, | |
"msgpack-msgpack@0.2.0": | |
248, | |
"msgpack-msgpack@0.3.0": | |
262, | |
"msgpack-msgpack@0.4.0": | |
269, | |
"msgpack-msgpack@0.5.0": | |
411, | |
"multiset-hashed@0.0.1": | |
164, | |
"murmur3@1.0.0": | |
239, | |
"murmur3@1.0.1": | |
112, | |
"murmur3@1.0.2": | |
110, | |
"mustache@0.1.0": | |
84, | |
"mustache@2.0.0": | |
175, | |
"mustache@2.1.0": | |
175, | |
"mustache@3.0.0": | |
214, | |
"mustache@3.0.1": | |
211, | |
"mustache@3.0.2": | |
303, | |
"mysql@0.1.0": | |
305, | |
"mysql@0.1.1": | |
292, | |
"mysql@0.1.2": | |
294, | |
"mysql@0.1.3": | |
299, | |
"mysql@0.2.0": | |
414, | |
"mysql@0.2.1": | |
266, | |
"mysql@0.3.0": | |
566, | |
"mysql@1.0.0": | |
539, | |
"mysql@1.1.0": | |
542, | |
"mysql@2.0.0": | |
391, | |
"mysql@2.0.1": | |
582, | |
"mysql@2.1.0": | |
392, | |
"mysql@2.1.1": | |
358, | |
"mysql@3.0.0": | |
381, | |
"mysql@3.0.1": | |
343, | |
"mysql@3.1.0": | |
346, | |
"mysql@3.2.0": | |
345, | |
"mysql@3.3.0": | |
344, | |
"mysql@3.4.0": | |
440, | |
"mysql@3.4.1": | |
341, | |
"mysql@4.0.0": | |
340, | |
"mysql@4.1.0": | |
349, | |
"mysql@4.1.1": | |
345, | |
"mysql@5.0.0": | |
274, | |
"mysql@6.0.0": | |
100, | |
"mysql@6.0.1": | |
99, | |
"nano-id@1.0.0": | |
160, | |
"nano-id@1.0.1": | |
133, | |
"nano-id@1.1.0": | |
131, | |
"naporitan@0.1.0": | |
91, | |
"naporitan@0.2.0": | |
88, | |
"naporitan@1.0.0": | |
192, | |
"naporitan@2.0.0": | |
46, | |
"naturals@1.0.0": | |
55, | |
"naturals@1.0.1": | |
69, | |
"naturals@1.0.2": | |
68, | |
"naturals@1.1.0": | |
69, | |
"naturals@2.0.0": | |
69, | |
"naturals@2.1.0": | |
68, | |
"naturals@2.2.0": | |
302, | |
"naturals@3.0.0": | |
78, | |
"navigator@0.1.0": | |
46, | |
"neo4j@0.1.0": | |
87, | |
"neon@0.0.1": | |
65, | |
"neon@0.0.2": | |
67, | |
"neon@0.0.3": | |
110, | |
"neon@0.0.4": | |
203, | |
"neon@0.0.5": | |
47, | |
"neon@0.0.6": | |
59, | |
"neon@0.0.7": | |
81, | |
"neon@0.0.8": | |
82, | |
"neon@0.0.9": | |
82, | |
"neon@0.0.10": | |
70, | |
"neon@0.0.11": | |
70, | |
"neon@0.0.12": | |
70, | |
"neon@0.0.13": | |
117, | |
"neon@0.0.14": | |
44, | |
"neon@0.0.15": | |
54, | |
"neon@0.0.16": | |
67, | |
"neon@0.0.17": | |
66, | |
"neon@0.0.18": | |
65, | |
"neon@0.0.19": | |
106, | |
"neon@0.0.20": | |
42, | |
"neon@0.0.21": | |
59, | |
"neon@0.0.22": | |
66, | |
"neon@0.0.23": | |
66, | |
"neon@0.0.24": | |
91, | |
"neon@0.0.25": | |
97, | |
"neon@0.0.26": | |
48, | |
"neon@0.0.27": | |
64, | |
"neon@0.0.28": | |
69, | |
"neon@0.0.29": | |
65, | |
"neon@0.0.30": | |
66, | |
"neon@0.0.31": | |
74, | |
"neon@0.0.32": | |
67, | |
"neon@0.0.33": | |
129, | |
"neon@0.0.34": | |
48, | |
"neon@0.0.35": | |
52, | |
"neon@0.0.36": | |
67, | |
"neon@0.1.0": | |
65, | |
"neon@0.1.1": | |
65, | |
"neon@0.2.0": | |
131, | |
"neon@0.2.1": | |
196, | |
"neon@0.3.0": | |
90, | |
"neon@0.4.2": | |
77, | |
"neon@0.4.3": | |
94, | |
"neon@0.4.4": | |
-87, | |
"neon@0.5.0": | |
-87, | |
"neon@0.5.1": | |
-84, | |
"neon@0.5.2": | |
-185, | |
"neon@0.5.3": | |
-81, | |
"neon@0.5.4": | |
-72, | |
"neon@0.6.0": | |
407, | |
"neovim@0.0.1": | |
68, | |
"neovim@0.0.2": | |
186, | |
"neovim@0.0.3": | |
180, | |
"neovim@0.0.4": | |
303, | |
"neovim@0.0.5": | |
165, | |
"neovim@0.0.6": | |
162, | |
"nested-functor@0.1.0": | |
56, | |
"nested-functor@0.2.0": | |
78, | |
"nested-functor@0.2.1": | |
58, | |
"newtype@0.1.0": | |
79, | |
"newtype@1.0.0": | |
69, | |
"newtype@1.1.0": | |
116, | |
"newtype@1.2.0": | |
44, | |
"newtype@1.3.0": | |
54, | |
"newtype@2.0.0": | |
70, | |
"newtype@3.0.0": | |
68, | |
"newtype@4.0.0": | |
68, | |
"newtype@5.0.0": | |
112, | |
"newtype-operator@1.0.0": | |
57, | |
"nextui@0.1.0": | |
156, | |
"node-bcrypt@1.0.0": | |
484, | |
"node-buffer@0.0.1": | |
59, | |
"node-buffer@0.1.0": | |
77, | |
"node-buffer@0.1.1": | |
75, | |
"node-buffer@0.2.0": | |
131, | |
"node-buffer@0.2.1": | |
62, | |
"node-buffer@0.2.2": | |
50, | |
"node-buffer@1.0.0": | |
72, | |
"node-buffer@2.0.0": | |
72, | |
"node-buffer@2.0.1": | |
81, | |
"node-buffer@3.0.0": | |
70, | |
"node-buffer@3.0.1": | |
149, | |
"node-buffer@4.0.0": | |
52, | |
"node-buffer@4.1.0": | |
69, | |
"node-buffer@5.0.0": | |
68, | |
"node-buffer@6.0.0": | |
89, | |
"node-buffer@7.0.0": | |
71, | |
"node-buffer@7.0.1": | |
84, | |
"node-buffer@8.0.0": | |
103, | |
"node-buffer-blob@1.0.0": | |
100, | |
"node-child-process@0.0.1": | |
47, | |
"node-child-process@0.2.0": | |
109, | |
"node-child-process@0.3.0": | |
94, | |
"node-child-process@0.3.1": | |
171, | |
"node-child-process@0.3.2": | |
86, | |
"node-child-process@0.4.0": | |
88, | |
"node-child-process@0.4.1": | |
91, | |
"node-child-process@0.4.2": | |
95, | |
"node-child-process@0.5.0": | |
101, | |
"node-child-process@0.5.1": | |
179, | |
"node-child-process@0.6.0": | |
-92, | |
"node-child-process@0.6.1": | |
80, | |
"node-child-process@1.0.0": | |
75, | |
"node-child-process@2.0.0": | |
-198, | |
"node-child-process@3.0.0": | |
388, | |
"node-child-process@3.0.1": | |
-335, | |
"node-child-process@4.0.0": | |
403, | |
"node-child-process@5.0.0": | |
303, | |
"node-child-process@6.0.0": | |
167, | |
"node-child-process@7.0.0": | |
140, | |
"node-child-process@7.1.0": | |
154, | |
"node-child-process@8.0.0": | |
120, | |
"node-child-process@9.0.0": | |
123, | |
"node-coroutines@1.0.0": | |
303, | |
"node-coroutines@2.0.0": | |
416, | |
"node-crypto@0.1.0": | |
47, | |
"node-crypto@0.2.0": | |
56, | |
"node-crypto@0.2.1": | |
73, | |
"node-crypto@0.2.2": | |
66, | |
"node-datagram@2.0.0": | |
84, | |
"node-datagram@3.0.0": | |
151, | |
"node-datagram@4.0.0": | |
78, | |
"node-domain@0.0.1": | |
44, | |
"node-electron@0.0.2": | |
-390, | |
"node-events@0.0.1": | |
53, | |
"node-events@0.0.2": | |
73, | |
"node-events@0.0.3": | |
61, | |
"node-events@0.0.4": | |
71, | |
"node-events@0.0.5": | |
90, | |
"node-events@0.0.6": | |
109, | |
"node-fs@0.1.2": | |
-65, | |
"node-fs@0.1.3": | |
-80, | |
"node-fs@0.2.0": | |
79, | |
"node-fs@0.2.1": | |
77, | |
"node-fs@0.3.0": | |
-75, | |
"node-fs@0.4.0": | |
85, | |
"node-fs@0.5.0": | |
81, | |
"node-fs@0.6.0": | |
189, | |
"node-fs@0.7.0": | |
85, | |
"node-fs@0.7.1": | |
78, | |
"node-fs@0.8.0": | |
88, | |
"node-fs@0.8.1": | |
85, | |
"node-fs@0.9.0": | |
86, | |
"node-fs@0.9.1": | |
85, | |
"node-fs@0.9.2": | |
186, | |
"node-fs@0.10.0": | |
82, | |
"node-fs@0.10.1": | |
69, | |
"node-fs@0.10.2": | |
87, | |
"node-fs@0.11.0": | |
84, | |
"node-fs@1.0.0": | |
82, | |
"node-fs@2.0.0": | |
-203, | |
"node-fs@3.0.0": | |
446, | |
"node-fs@4.0.0": | |
327, | |
"node-fs@4.0.1": | |
434, | |
"node-fs@5.0.0": | |
195, | |
"node-fs@5.0.1": | |
195, | |
"node-fs@6.0.0": | |
138, | |
"node-fs@6.1.0": | |
142, | |
"node-fs@6.2.0": | |
250, | |
"node-fs@7.0.0": | |
112, | |
"node-fs@7.0.1": | |
102, | |
"node-fs@8.0.0": | |
116, | |
"node-fs@8.1.0": | |
114, | |
"node-fs@8.1.1": | |
124, | |
"node-fs-aff@0.1.0": | |
118, | |
"node-fs-aff@0.1.1": | |
111, | |
"node-fs-aff@0.1.2": | |
187, | |
"node-fs-aff@0.2.0": | |
94, | |
"node-fs-aff@0.2.1": | |
93, | |
"node-fs-aff@0.3.0": | |
110, | |
"node-fs-aff@0.3.1": | |
108, | |
"node-fs-aff@0.4.0": | |
119, | |
"node-fs-aff@0.5.0": | |
121, | |
"node-fs-aff@0.6.0": | |
114, | |
"node-fs-aff@1.0.0": | |
172, | |
"node-fs-aff@2.0.0": | |
-262, | |
"node-fs-aff@3.0.0": | |
396, | |
"node-fs-aff@4.0.0": | |
402, | |
"node-fs-aff@5.0.0": | |
542, | |
"node-fs-aff@6.0.0": | |
316, | |
"node-fs-aff@7.0.0": | |
148, | |
"node-fs-aff@8.0.0": | |
119, | |
"node-fs-aff@9.0.0": | |
214, | |
"node-fs-aff@9.1.0": | |
108, | |
"node-fs-extra@0.1.0": | |
320, | |
"node-fs-extra@0.1.1": | |
328, | |
"node-fs-extra@0.1.2": | |
328, | |
"node-he@0.1.0": | |
56, | |
"node-he@0.2.0": | |
71, | |
"node-he@0.3.0": | |
134, | |
"node-http@0.1.0": | |
91, | |
"node-http@0.1.1": | |
78, | |
"node-http@0.1.2": | |
90, | |
"node-http@0.1.3": | |
104, | |
"node-http@0.1.4": | |
100, | |
"node-http@0.1.5": | |
102, | |
"node-http@0.1.6": | |
104, | |
"node-http@0.1.7": | |
223, | |
"node-http@0.2.0": | |
85, | |
"node-http@0.3.0": | |
82, | |
"node-http@0.3.1": | |
88, | |
"node-http@0.4.0": | |
95, | |
"node-http@0.4.1": | |
92, | |
"node-http@1.0.0": | |
81, | |
"node-http@1.1.0": | |
83, | |
"node-http@1.2.0": | |
153, | |
"node-http@1.3.0": | |
73, | |
"node-http@2.0.0": | |
308, | |
"node-http@3.0.0": | |
239, | |
"node-http@3.0.1": | |
262, | |
"node-http@4.0.0": | |
319, | |
"node-http@4.1.0": | |
477, | |
"node-http@4.2.0": | |
380, | |
"node-http@5.0.0": | |
143, | |
"node-http@5.0.1": | |
188, | |
"node-http@5.0.2": | |
187, | |
"node-http@6.0.0": | |
161, | |
"node-http@7.0.0": | |
136, | |
"node-http@8.0.0": | |
132, | |
"node-irc@1.0.0": | |
-233, | |
"node-irc@1.0.1": | |
-114, | |
"node-mongodb@0.0.1": | |
81, | |
"node-mongodb@0.0.2": | |
100, | |
"node-mongodb@0.0.3": | |
100, | |
"node-mongodb@0.0.6": | |
136, | |
"node-mongodb@0.0.7": | |
-397, | |
"node-mongodb@0.0.8": | |
677, | |
"node-mongodb@0.11.0": | |
518, | |
"node-net@1.0.0": | |
722, | |
"node-net@2.0.0": | |
152, | |
"node-net@2.0.1": | |
151, | |
"node-net@3.0.0": | |
121, | |
"node-net@4.0.0": | |
122, | |
"node-openurl@0.0.1": | |
438, | |
"node-os@1.0.0": | |
62, | |
"node-os@1.1.0": | |
63, | |
"node-os@2.0.0": | |
330, | |
"node-os@2.1.0": | |
326, | |
"node-os@3.0.0": | |
155, | |
"node-os@3.1.0": | |
139, | |
"node-path@0.1.0": | |
56, | |
"node-path@0.2.0": | |
137, | |
"node-path@0.3.0": | |
47, | |
"node-path@0.4.0": | |
52, | |
"node-path@0.4.1": | |
61, | |
"node-path@1.0.0": | |
73, | |
"node-path@2.0.0": | |
60, | |
"node-path@3.0.0": | |
73, | |
"node-path@4.0.0": | |
113, | |
"node-path@5.0.0": | |
45, | |
"node-postgres@0.1.0": | |
104, | |
"node-postgres@0.2.0": | |
116, | |
"node-postgres@0.2.1": | |
97, | |
"node-postgres@0.2.2": | |
99, | |
"node-postgres@1.0.0": | |
139, | |
"node-postgres@2.0.0": | |
271, | |
"node-postgres@3.0.0": | |
350, | |
"node-postgres@4.0.0": | |
299, | |
"node-postgres@4.1.0": | |
303, | |
"node-postgres@5.0.0": | |
243, | |
"node-process@0.1.0": | |
141, | |
"node-process@0.1.1": | |
74, | |
"node-process@0.1.2": | |
90, | |
"node-process@0.2.0": | |
100, | |
"node-process@0.3.0": | |
98, | |
"node-process@0.4.0": | |
98, | |
"node-process@0.4.1": | |
205, | |
"node-process@0.5.0": | |
89, | |
"node-process@1.0.0": | |
60, | |
"node-process@2.0.0": | |
-199, | |
"node-process@3.0.0": | |
384, | |
"node-process@4.0.0": | |
402, | |
"node-process@5.0.0": | |
518, | |
"node-process@6.0.0": | |
200, | |
"node-process@7.0.0": | |
106, | |
"node-process@8.0.0": | |
77, | |
"node-process@8.1.0": | |
92, | |
"node-process@8.2.0": | |
100, | |
"node-process@9.0.0": | |
95, | |
"node-process@10.0.0": | |
86, | |
"node-readable@0.0.1": | |
87, | |
"node-readable@1.0.0": | |
165, | |
"node-readable@1.0.1": | |
74, | |
"node-readable@2.0.0": | |
65, | |
"node-readable@2.1.0": | |
83, | |
"node-readable@2.2.0": | |
83, | |
"node-readable@3.0.0": | |
92, | |
"node-readline@0.1.1": | |
63, | |
"node-readline@0.1.2": | |
69, | |
"node-readline@0.2.0": | |
77, | |
"node-readline@0.3.0": | |
128, | |
"node-readline@0.3.1": | |
45, | |
"node-readline@0.4.0": | |
100, | |
"node-readline@0.4.1": | |
101, | |
"node-readline@0.5.0": | |
99, | |
"node-readline@1.0.0": | |
84, | |
"node-readline@2.0.0": | |
467, | |
"node-readline@3.0.0": | |
446, | |
"node-readline@3.0.1": | |
749, | |
"node-readline@3.1.0": | |
602, | |
"node-readline@4.0.0": | |
198, | |
"node-readline@4.0.1": | |
237, | |
"node-readline@5.0.0": | |
126, | |
"node-readline@6.0.0": | |
111, | |
"node-readline@7.0.0": | |
194, | |
"node-readline-aff@0.1.0": | |
39, | |
"node-readline-aff@0.1.1": | |
50, | |
"node-readline-aff@0.1.2": | |
764, | |
"node-readline-aff@0.2.0": | |
298, | |
"node-readline-aff@0.3.0": | |
272, | |
"node-redis@0.1.0": | |
-157, | |
"node-sentry@1.2.0": | |
-246, | |
"node-sqlite3@0.2.0": | |
170, | |
"node-sqlite3@0.3.0": | |
-156, | |
"node-sqlite3@0.4.0": | |
-165, | |
"node-sqlite3@0.5.0": | |
499, | |
"node-sqlite3@1.0.0": | |
467, | |
"node-sqlite3@2.0.0": | |
469, | |
"node-sqlite3@3.0.0": | |
415, | |
"node-sqlite3@3.1.0": | |
267, | |
"node-sqlite3@4.0.0": | |
262, | |
"node-sqlite3@4.1.0": | |
279, | |
"node-sqlite3@5.0.0": | |
278, | |
"node-sqlite3@6.0.0": | |
277, | |
"node-sqlite3@7.0.0": | |
128, | |
"node-sqlite3@8.0.0": | |
218, | |
"node-stream-buffers@0.1.0": | |
81, | |
"node-stream-buffers@0.1.1": | |
73, | |
"node-streams@0.1.0": | |
65, | |
"node-streams@0.1.1": | |
65, | |
"node-streams@0.1.2": | |
74, | |
"node-streams@0.1.3": | |
67, | |
"node-streams@0.1.4": | |
128, | |
"node-streams@0.2.0": | |
88, | |
"node-streams@0.3.0": | |
55, | |
"node-streams@0.4.0": | |
84, | |
"node-streams@0.4.1": | |
80, | |
"node-streams@0.5.0": | |
70, | |
"node-streams@0.6.0": | |
80, | |
"node-streams@1.0.0": | |
85, | |
"node-streams@2.0.0": | |
124, | |
"node-streams@3.0.0": | |
52, | |
"node-streams@3.1.0": | |
85, | |
"node-streams@3.2.0": | |
81, | |
"node-streams@3.3.0": | |
89, | |
"node-streams@4.0.0": | |
74, | |
"node-streams@4.0.1": | |
91, | |
"node-streams@5.0.0": | |
73, | |
"node-streams@6.0.0": | |
169, | |
"node-streams@7.0.0": | |
77, | |
"node-streams-aff@1.0.0": | |
90, | |
"node-streams-aff@1.1.0": | |
100, | |
"node-streams-aff@2.0.0": | |
99, | |
"node-streams-aff@3.0.0": | |
102, | |
"node-streams-aff@4.0.0": | |
103, | |
"node-streams-aff@4.0.1": | |
98, | |
"node-telegram-bot-api@0.1.0": | |
110, | |
"node-telegram-bot-api@0.2.0": | |
455, | |
"node-telegram-bot-api@0.3.0": | |
422, | |
"node-telegram-bot-api@0.4.0": | |
-384, | |
"node-telegram-bot-api@0.5.0": | |
-374, | |
"node-telegram-bot-api@0.6.0": | |
589, | |
"node-telegram-bot-api@0.7.0": | |
447, | |
"node-telegram-bot-api@0.7.1": | |
440, | |
"node-telegram-bot-api@1.0.0": | |
491, | |
"node-telegram-bot-api@1.1.0": | |
468, | |
"node-telegram-bot-api@2.0.0": | |
322, | |
"node-telegram-bot-api@3.0.0": | |
384, | |
"node-telegram-bot-api@4.0.0": | |
221, | |
"node-thunk@0.1.0": | |
44, | |
"node-thunk@0.1.1": | |
70, | |
"node-thunk@0.1.2": | |
71, | |
"node-url@0.1.0": | |
79, | |
"node-url@0.1.1": | |
68, | |
"node-url@0.1.2": | |
116, | |
"node-url@1.0.0": | |
48, | |
"node-url@2.0.0": | |
79, | |
"node-url@3.0.0": | |
70, | |
"node-url@4.0.0": | |
77, | |
"node-url@5.0.0": | |
73, | |
"node-url@6.0.0": | |
140, | |
"node-uuid@0.1.0": | |
69, | |
"node-uuid@0.2.0": | |
-95, | |
"node-uuid@0.3.0": | |
-105, | |
"node-uuid@0.3.1": | |
-104, | |
"node-uuid@0.4.0": | |
-108, | |
"node-uuid@0.4.1": | |
-158, | |
"node-uuid@0.5.0": | |
195, | |
"node-uuid@0.6.0": | |
94, | |
"node-uuid@0.6.1": | |
82, | |
"node-webkit@0.0.1": | |
52, | |
"node-webkit@0.0.2": | |
85, | |
"node-webkit@0.0.3": | |
78, | |
"node-webkit@0.0.4": | |
64, | |
"node-webkit@0.1.0": | |
-73, | |
"node-webkit@0.1.1": | |
-81, | |
"node-webkit@0.1.2": | |
-136, | |
"node-websocket@0.0.2": | |
675, | |
"node-websocket@0.0.3": | |
658, | |
"nodemailer@0.1.0": | |
478, | |
"nodemailer@1.0.0": | |
309, | |
"nodemailer@2.0.0": | |
370, | |
"nodemailer@2.0.1": | |
341, | |
"nodemailer@2.0.2": | |
315, | |
"nodemailer@3.0.0": | |
263, | |
"nodemailer@4.0.0": | |
91, | |
"nodemailer@4.0.1": | |
96, | |
"nodetrout@0.0.1": | |
536, | |
"nonbili-dom@0.1.0": | |
416, | |
"nonbili-dom@0.2.0": | |
406, | |
"nonbili-dom@0.2.1": | |
511, | |
"nonbili-dom@0.3.0": | |
392, | |
"nonempty@1.1.1": | |
51, | |
"nonempty@2.0.0": | |
103, | |
"nonempty@3.0.0": | |
67, | |
"nonempty@4.0.0": | |
75, | |
"nonempty@4.1.0": | |
75, | |
"nonempty@4.1.1": | |
140, | |
"nonempty@4.2.0": | |
52, | |
"nonempty@4.3.0": | |
89, | |
"nonempty@5.0.0": | |
86, | |
"nonempty@6.0.0": | |
99, | |
"nonempty@6.1.0": | |
98, | |
"nonempty@7.0.0": | |
80, | |
"nonempty-arrays@0.0.2": | |
-121, | |
"nonempty-arrays@0.0.3": | |
-50, | |
"nonempty-arrays@0.1.0": | |
-74, | |
"nonempty-arrays@0.2.0": | |
73, | |
"nonempty-arrays@0.3.0": | |
92, | |
"now@1.0.0": | |
71, | |
"now@2.0.0": | |
226, | |
"now@3.0.0": | |
385, | |
"now@4.0.0": | |
145, | |
"now@5.0.0": | |
106, | |
"now@6.0.0": | |
87, | |
"npm-package-json@1.0.0": | |
502, | |
"npm-package-json@1.1.0": | |
605, | |
"npm-package-json@1.2.0": | |
481, | |
"npm-package-json@2.0.0": | |
128, | |
"nullable@0.1.0": | |
60, | |
"nullable@0.1.1": | |
66, | |
"nullable@0.2.0": | |
125, | |
"nullable@0.2.1": | |
49, | |
"nullable@1.0.0": | |
50, | |
"nullable@1.0.1": | |
71, | |
"nullable@2.0.0": | |
63, | |
"nullable@3.0.0": | |
82, | |
"nullable@4.0.0": | |
70, | |
"nullable@4.1.0": | |
144, | |
"nullable@4.1.1": | |
51, | |
"nullable@5.0.0": | |
61, | |
"nullable@6.0.0": | |
72, | |
"nullable-safe@1.0.0": | |
78, | |
"nullable-safe@1.1.0": | |
73, | |
"number-format@0.1.0": | |
71, | |
"number-format@0.2.0": | |
62, | |
"number-format@0.2.1": | |
77, | |
"number-format@0.3.0": | |
139, | |
"numbers@1.0.0": | |
45, | |
"numbers@2.0.0": | |
52, | |
"numbers@3.0.0": | |
70, | |
"numbers@4.0.0": | |
65, | |
"numbers@4.1.0": | |
66, | |
"numbers@4.2.0": | |
73, | |
"numbers@5.0.0": | |
143, | |
"numbers@6.0.0": | |
67, | |
"numbers@7.0.0": | |
55, | |
"numbers@8.0.0": | |
71, | |
"numbers@9.0.0": | |
70, | |
"numbox@0.0.1": | |
89, | |
"numbox@0.0.2": | |
82, | |
"numbox@0.0.3": | |
168, | |
"numbox@0.0.4": | |
97, | |
"numerics@0.1.0": | |
1984, | |
"numerics@0.1.1": | |
1959, | |
"numerics@0.1.2": | |
250, | |
"numerics-012@0.1.0": | |
1969, | |
"numerics-012@0.1.1": | |
2002, | |
"oak@0.1.0": | |
487, | |
"oak@0.1.1": | |
348, | |
"oak@0.1.2": | |
336, | |
"oak@0.1.3": | |
349, | |
"oak@0.1.4": | |
344, | |
"oak@0.1.5": | |
345, | |
"oak@0.1.6": | |
344, | |
"oak@0.1.7": | |
450, | |
"oak@0.2.0": | |
349, | |
"oak@0.3.0": | |
328, | |
"oak@0.4.0": | |
340, | |
"oak@0.4.1": | |
347, | |
"oak@0.4.2": | |
348, | |
"oak@0.5.0": | |
343, | |
"oak@0.5.1": | |
350, | |
"oak@0.6.0": | |
165, | |
"oak@0.6.1": | |
189, | |
"oak@0.6.4": | |
177, | |
"oak@0.6.5": | |
188, | |
"oak@0.6.6": | |
186, | |
"oak@0.6.7": | |
187, | |
"oak@0.6.8": | |
268, | |
"oak@0.6.9": | |
176, | |
"oak@0.7.0": | |
170, | |
"oak@0.8.0": | |
180, | |
"oak@0.8.1": | |
187, | |
"oak@1.0.0": | |
167, | |
"oak@1.1.0": | |
169, | |
"oak@1.1.2": | |
170, | |
"oak@1.1.3": | |
285, | |
"oak@1.1.4": | |
162, | |
"oak@1.1.5": | |
153, | |
"oak@1.1.6": | |
167, | |
"oak@1.1.7": | |
172, | |
"oak@1.1.8": | |
171, | |
"oak@1.1.9": | |
176, | |
"oak@2.1.0": | |
168, | |
"oak-ajax@0.6.2": | |
405, | |
"oak-ajax@0.6.3": | |
374, | |
"oak-ajax@0.7.0": | |
352, | |
"oak-ajax@0.7.1": | |
358, | |
"oak-ajax@0.8.0": | |
390, | |
"oak-ajax@1.0.0": | |
414, | |
"oak-debug@0.6.10": | |
61, | |
"oak-debug@0.7.0": | |
371, | |
"oak-debug@0.8.1": | |
257, | |
"oak-debug@1.0.0": | |
202, | |
"object-maps@0.1.1": | |
137, | |
"oboe@0.1.0": | |
-56, | |
"oboe@0.2.0": | |
-71, | |
"oboe@0.3.0": | |
138, | |
"observable@1.0.0": | |
72, | |
"observable@1.1.0": | |
66, | |
"observable@1.2.0": | |
73, | |
"observable@1.3.0": | |
80, | |
"observable@1.4.0": | |
83, | |
"observable@2.0.0": | |
76, | |
"observable@2.1.0": | |
153, | |
"observable@2.2.0": | |
73, | |
"observable@3.0.0": | |
202, | |
"observable-channel@1.0.0": | |
77, | |
"observable-channel@2.0.0": | |
209, | |
"observable-classy@0.1.0": | |
75, | |
"observable-lift@0.1.0": | |
152, | |
"observable-lift@0.2.0": | |
84, | |
"observable-lift@0.2.1": | |
53, | |
"observable-time@1.0.0": | |
74, | |
"observable-time@2.0.0": | |
224, | |
"ocarina@0.0.0": | |
-408, | |
"ocarina@0.0.1": | |
-414, | |
"ocarina@0.0.2": | |
-480, | |
"ocarina@0.0.3": | |
-583, | |
"ocarina@0.0.4": | |
-444, | |
"ocarina@0.1.0": | |
-453, | |
"ocarina@0.1.1": | |
-464, | |
"ocarina@0.1.2": | |
-471, | |
"ocarina@0.1.3": | |
-469, | |
"ocarina@0.1.4": | |
-550, | |
"ocarina@0.1.5": | |
-445, | |
"ocarina@0.2.0": | |
-462, | |
"ocarina@0.2.1": | |
-469, | |
"ocarina@0.2.2": | |
-564, | |
"ocarina@0.2.3": | |
-454, | |
"ocarina@0.2.4": | |
-448, | |
"ocarina@0.3.0": | |
-467, | |
"ocarina@0.3.1": | |
-476, | |
"ocarina@0.3.2": | |
-470, | |
"ocarina@0.3.3": | |
-487, | |
"ocarina@0.3.4": | |
-619, | |
"ocarina@0.3.5": | |
-443, | |
"ocarina@0.3.6": | |
-445, | |
"ocarina@0.3.7": | |
-468, | |
"ocarina@0.3.8": | |
-469, | |
"ocarina@0.3.9": | |
-465, | |
"ocarina@0.3.10": | |
-585, | |
"ocarina@0.3.11": | |
-450, | |
"ocarina@0.3.12": | |
-454, | |
"ocarina@0.3.13": | |
-471, | |
"ocarina@0.3.14": | |
-468, | |
"ocarina@0.3.15": | |
-465, | |
"ocarina@0.4.0": | |
-471, | |
"ocarina@0.4.1": | |
-557, | |
"ocarina@0.4.2": | |
-447, | |
"ocarina@0.4.3": | |
-461, | |
"ocarina@0.4.4": | |
-467, | |
"ocarina@0.4.5": | |
-596, | |
"ocarina@0.4.6": | |
-452, | |
"ocarina@0.4.7": | |
-455, | |
"ocarina@0.4.8": | |
-466, | |
"ocarina@0.4.9": | |
-467, | |
"ocarina@0.5.0": | |
-468, | |
"ocarina@0.5.1": | |
-471, | |
"ocarina@0.5.2": | |
-565, | |
"ocarina@0.5.3": | |
-446, | |
"ocarina@0.5.4": | |
-452, | |
"ocarina@0.5.5": | |
-465, | |
"ocarina@0.5.6": | |
-473, | |
"ocarina@0.5.7": | |
-568, | |
"ocarina@0.5.8": | |
-473, | |
"ocarina@0.5.9": | |
-449, | |
"ocarina@0.5.10": | |
-415, | |
"ocarina@0.5.11": | |
-417, | |
"ocarina@0.6.0": | |
-417, | |
"ocarina@0.6.1": | |
-420, | |
"ocarina@0.6.2": | |
-523, | |
"ocarina@1.2.0": | |
-468, | |
"ocarina@1.2.1": | |
-453, | |
"ocarina@1.3.0": | |
-471, | |
"ocarina@1.5.2": | |
-461, | |
"ocelot@0.16.1": | |
845, | |
"ocelot@0.16.2": | |
829, | |
"ocelot@0.16.3": | |
942, | |
"ocelot@0.16.4": | |
791, | |
"ocelot@0.16.5": | |
804, | |
"ocelot@0.16.6": | |
807, | |
"ocelot@0.16.7": | |
888, | |
"ocelot@0.16.8": | |
805, | |
"ocelot@0.16.9": | |
784, | |
"ocelot@0.16.10": | |
809, | |
"ocelot@0.17.0": | |
822, | |
"ocelot@0.18.0": | |
815, | |
"ocelot@0.18.1": | |
953, | |
"ocelot@0.18.2": | |
803, | |
"ocelot@0.18.3": | |
787, | |
"ocelot@0.19.0": | |
811, | |
"ocelot@0.19.1": | |
820, | |
"ochadzuke@0.1.0": | |
478, | |
"ogmarkup@3.0.0": | |
83, | |
"ogmarkup@3.1.0": | |
179, | |
"ogmarkup@4.0.0": | |
71, | |
"ogmarkup@5.0.0": | |
308, | |
"ohyes@0.1.0": | |
203, | |
"ohyes@1.0.0": | |
176, | |
"ohyes@1.1.0": | |
180, | |
"ohyes@2.0.0": | |
271, | |
"ohyes@2.1.0": | |
-367, | |
"oidc-crypt-utils@1.0.0": | |
153, | |
"oidc-crypt-utils@1.1.0": | |
150, | |
"oidc-crypt-utils@3.0.0": | |
89, | |
"oidc-crypt-utils@4.0.0": | |
91, | |
"oidc-crypt-utils@5.0.0": | |
411, | |
"oidc-crypt-utils@6.0.0": | |
545, | |
"oidc-crypt-utils@7.0.0": | |
796, | |
"oidc-crypt-utils@7.0.1": | |
805, | |
"oldschool@0.1.0": | |
159, | |
"oo-ffi@0.0.1": | |
53, | |
"oo-ffi@0.0.2": | |
78, | |
"oo-ffi@0.0.3": | |
64, | |
"oo-ffi@0.0.4": | |
75, | |
"oo-ffi@0.0.5": | |
110, | |
"oo-ffi@0.0.6": | |
44, | |
"oo-ffi@1.0.0": | |
62, | |
"open-folds@1.0.1": | |
70, | |
"open-folds@2.0.0": | |
102, | |
"open-folds@3.0.0": | |
208, | |
"open-folds@3.1.0": | |
102, | |
"open-folds@4.0.0": | |
56, | |
"open-folds@5.0.0": | |
105, | |
"open-folds@5.1.0": | |
106, | |
"open-folds@5.2.0": | |
107, | |
"open-folds@6.0.0": | |
93, | |
"open-folds@6.1.0": | |
94, | |
"open-folds@6.2.0": | |
198, | |
"open-folds@6.3.0": | |
90, | |
"open-memoize@2.0.1": | |
50, | |
"open-memoize@3.0.0": | |
155, | |
"open-memoize@4.0.0": | |
193, | |
"open-memoize@4.0.1": | |
188, | |
"open-memoize@5.0.0": | |
135, | |
"open-memoize@5.2.0": | |
181, | |
"open-memoize@6.0.0": | |
95, | |
"open-memoize@6.1.0": | |
83, | |
"open-mkdirp-aff@1.1.0": | |
156, | |
"open-pairing@1.0.0": | |
77, | |
"open-pairing@1.1.0": | |
78, | |
"open-pairing@1.2.0": | |
81, | |
"open-pairing@1.3.0": | |
79, | |
"open-pairing@1.4.0": | |
157, | |
"open-pairing@2.0.0": | |
-164, | |
"open-pairing@3.0.0": | |
-220, | |
"open-pairing@4.0.0": | |
318, | |
"open-pairing@5.0.0": | |
129, | |
"open-pairing@5.1.0": | |
129, | |
"open-pairing@6.0.0": | |
99, | |
"open-pairing@6.1.0": | |
99, | |
"openapi@0.0.2": | |
285, | |
"openapi@0.0.3": | |
142, | |
"openapi@0.0.4": | |
141, | |
"openapi@0.0.5": | |
144, | |
"openapi@0.0.6": | |
152, | |
"openapi@0.0.7": | |
151, | |
"openapi@0.0.8": | |
154, | |
"optic@0.3.0": | |
-76, | |
"optic@0.4.0": | |
162, | |
"optic@0.5.0": | |
75, | |
"optic@0.7.0": | |
75, | |
"optic@0.8.0": | |
91, | |
"optic@0.9.0": | |
87, | |
"optic@0.9.1": | |
157, | |
"optimizely-api@0.1.0": | |
-429, | |
"optimizely-api@0.2.0": | |
-393, | |
"optimizely-api@0.3.0": | |
-409, | |
"optimizely-api@0.3.1": | |
-417, | |
"option@1.0.0": | |
641, | |
"option@1.0.1": | |
648, | |
"option@1.0.2": | |
733, | |
"option@1.1.0": | |
619, | |
"option@2.0.0": | |
619, | |
"option@2.1.0": | |
642, | |
"option@3.0.0": | |
640, | |
"option@3.1.0": | |
641, | |
"option@3.1.1": | |
645, | |
"option@3.1.2": | |
723, | |
"option@4.0.0": | |
630, | |
"option@5.0.0": | |
635, | |
"option@5.0.1": | |
637, | |
"option@6.0.0": | |
698, | |
"option@6.0.1": | |
548, | |
"option@6.1.0": | |
549, | |
"option@7.0.0": | |
566, | |
"option@8.0.0": | |
567, | |
"option@9.0.0": | |
140, | |
"optional@1.0.0": | |
292, | |
"optional@2.0.0": | |
254, | |
"options@0.0.1": | |
53, | |
"options@0.1.0": | |
61, | |
"options@0.2.0": | |
86, | |
"options@0.2.1": | |
73, | |
"options@0.3.0": | |
75, | |
"options@0.4.0": | |
174, | |
"options@0.5.0": | |
91, | |
"options@0.5.1": | |
71, | |
"options@0.5.2": | |
77, | |
"options@0.6.0": | |
84, | |
"options@1.0.0": | |
81, | |
"options@2.0.0": | |
228, | |
"options@3.0.0": | |
225, | |
"options@3.1.0": | |
392, | |
"options@4.0.0": | |
135, | |
"options@5.0.0": | |
136, | |
"options@6.0.0": | |
105, | |
"options@7.0.0": | |
93, | |
"options-extra@0.1.0": | |
115, | |
"options-extra@0.2.0": | |
201, | |
"optlicative@4.0.3": | |
711, | |
"optlicative@5.0.0": | |
142, | |
"optlicative@5.1.0": | |
154, | |
"optlicative@5.2.0": | |
163, | |
"optlicative@6.0.0": | |
164, | |
"optlicative@6.0.1": | |
167, | |
"optparse@0.2.0": | |
179, | |
"optparse@0.2.1": | |
295, | |
"optparse@1.0.0": | |
170, | |
"optparse@2.0.0": | |
168, | |
"optparse@3.0.0": | |
177, | |
"optparse@3.0.1": | |
182, | |
"optparse@4.1.0": | |
-216, | |
"optparse@5.0.0": | |
-367, | |
"ordered-collections@1.0.0": | |
207, | |
"ordered-collections@1.1.0": | |
86, | |
"ordered-collections@1.2.0": | |
84, | |
"ordered-collections@1.3.0": | |
94, | |
"ordered-collections@1.4.0": | |
97, | |
"ordered-collections@1.5.0": | |
98, | |
"ordered-collections@1.6.0": | |
105, | |
"ordered-collections@1.6.1": | |
180, | |
"ordered-collections@2.0.0": | |
90, | |
"ordered-collections@2.0.1": | |
76, | |
"ordered-collections@2.0.2": | |
90, | |
"ordered-collections@3.0.0": | |
87, | |
"ordered-set@0.2.0": | |
88, | |
"ordered-set@0.4.0": | |
199, | |
"orders@0.1.2": | |
64, | |
"orders@1.0.0": | |
80, | |
"orders@2.0.0": | |
123, | |
"orders@2.0.1": | |
46, | |
"orders@3.0.0": | |
58, | |
"orders@4.0.0": | |
72, | |
"orders@5.0.0": | |
69, | |
"orders@6.0.0": | |
69, | |
"ordinals@1.0.0": | |
105, | |
"ordinals@2.0.0": | |
80, | |
"outwatch@0.7.0": | |
806, | |
"owoify@1.0.0": | |
84, | |
"owoify@1.1.0": | |
78, | |
"owoify@1.1.1": | |
91, | |
"owoify@1.1.2": | |
100, | |
"p5@0.1.0": | |
320, | |
"p5@0.2.0": | |
318, | |
"p5@0.3.0": | |
418, | |
"p5@0.4.0": | |
316, | |
"p5@0.5.0": | |
296, | |
"p5@0.6.0": | |
316, | |
"p5@0.7.0": | |
319, | |
"p5@0.7.1": | |
321, | |
"p5@0.8.0": | |
330, | |
"p5@0.9.0": | |
321, | |
"p5@0.10.0": | |
412, | |
"p5@0.11.0": | |
304, | |
"painting@0.0.0": | |
-159, | |
"pair@0.1.0": | |
71, | |
"pair@0.1.1": | |
89, | |
"pairing@1.0.0": | |
79, | |
"pairing@1.1.0": | |
151, | |
"pairing@1.2.0": | |
61, | |
"pairing@1.3.0": | |
67, | |
"pairing@1.4.0": | |
76, | |
"pairing@2.0.0": | |
286, | |
"pairing@3.0.0": | |
-222, | |
"pairing@4.0.0": | |
369, | |
"pairing@5.0.0": | |
116, | |
"pairing@5.1.0": | |
108, | |
"pairs@1.0.0": | |
46, | |
"pairs@2.0.0": | |
88, | |
"pairs@3.0.0": | |
74, | |
"pairs@4.0.0": | |
195, | |
"pairs@5.0.0": | |
354, | |
"pairs@6.0.0": | |
268, | |
"pairs@7.0.0": | |
138, | |
"pairs@8.0.0": | |
92, | |
"pairs@9.0.0": | |
98, | |
"pako@0.1.0": | |
152, | |
"pako@0.1.1": | |
296, | |
"pako@0.2.0": | |
296, | |
"pako@0.3.0": | |
55, | |
"pako@0.4.0": | |
611, | |
"panda@0.9.1": | |
486, | |
"panda@0.9.2": | |
483, | |
"panda@0.10.0": | |
500, | |
"panda@0.10.1": | |
508, | |
"panda@0.10.2": | |
580, | |
"panda@0.11.0": | |
462, | |
"parallel@0.1.0": | |
50, | |
"parallel@0.2.0": | |
70, | |
"parallel@0.2.1": | |
77, | |
"parallel@0.4.0": | |
78, | |
"parallel@0.5.0": | |
78, | |
"parallel@0.5.1": | |
82, | |
"parallel@1.0.0": | |
135, | |
"parallel@1.1.0": | |
68, | |
"parallel@2.0.0": | |
150, | |
"parallel@2.1.0": | |
119, | |
"parallel@3.0.0": | |
143, | |
"parallel@3.1.0": | |
135, | |
"parallel@3.2.0": | |
133, | |
"parallel@3.3.0": | |
223, | |
"parallel@3.3.1": | |
122, | |
"parallel@4.0.0": | |
81, | |
"parallel@5.0.0": | |
81, | |
"parallel@6.0.0": | |
80, | |
"parseint@0.0.0": | |
67, | |
"parseint@1.0.0": | |
131, | |
"parseint@1.1.0": | |
55, | |
"parseint@1.1.1": | |
57, | |
"parsers@0.0.1": | |
223, | |
"parsers@0.1.0": | |
196, | |
"parsers@0.1.1": | |
193, | |
"parsers@0.1.2": | |
196, | |
"parsers@0.1.3": | |
194, | |
"parsers@0.1.4": | |
317, | |
"parsers@0.1.5": | |
188, | |
"parsers@0.1.6": | |
176, | |
"parsers@0.1.7": | |
173, | |
"parsers@0.2.0": | |
326, | |
"parsing@0.1.1": | |
-64, | |
"parsing@0.1.2": | |
-75, | |
"parsing@0.1.3": | |
-151, | |
"parsing@0.1.4": | |
-102, | |
"parsing@0.1.5": | |
-70, | |
"parsing@0.2.0": | |
76, | |
"parsing@0.3.0": | |
90, | |
"parsing@0.3.1": | |
82, | |
"parsing@0.4.0": | |
95, | |
"parsing@0.5.0": | |
89, | |
"parsing@0.5.1": | |
174, | |
"parsing@0.6.1": | |
75, | |
"parsing@0.7.0": | |
64, | |
"parsing@0.7.1": | |
79, | |
"parsing@0.7.2": | |
84, | |
"parsing@0.8.0": | |
95, | |
"parsing@0.8.1": | |
172, | |
"parsing@1.0.0": | |
84, | |
"parsing@2.0.0": | |
121, | |
"parsing@2.1.0": | |
120, | |
"parsing@3.0.0": | |
174, | |
"parsing@3.0.1": | |
161, | |
"parsing@3.1.0": | |
153, | |
"parsing@3.2.0": | |
149, | |
"parsing@3.2.1": | |
280, | |
"parsing@4.0.0": | |
184, | |
"parsing@4.1.0": | |
152, | |
"parsing@4.2.0": | |
160, | |
"parsing@4.2.1": | |
171, | |
"parsing@4.2.2": | |
251, | |
"parsing@4.3.0": | |
171, | |
"parsing@4.3.1": | |
174, | |
"parsing@5.0.0": | |
259, | |
"parsing@5.0.1": | |
146, | |
"parsing@5.0.2": | |
142, | |
"parsing@5.0.3": | |
152, | |
"parsing@5.1.0": | |
157, | |
"parsing@6.0.0": | |
103, | |
"parsing@6.0.1": | |
186, | |
"parsing@6.0.2": | |
99, | |
"parsing@7.0.0": | |
84, | |
"parsing@7.0.1": | |
92, | |
"parsing@7.1.0": | |
103, | |
"parsing@7.2.0": | |
99, | |
"parsing@8.0.0": | |
100, | |
"parsing@8.1.0": | |
106, | |
"parsing@8.2.0": | |
178, | |
"parsing@8.3.0": | |
88, | |
"parsing@8.4.0": | |
85, | |
"parsing@9.0.0": | |
81, | |
"parsing@9.1.0": | |
96, | |
"parsing@10.0.0": | |
102, | |
"parsing@10.1.0": | |
94, | |
"parsing-dataview@1.0.0": | |
300, | |
"parsing-dataview@1.0.1": | |
392, | |
"parsing-dataview@1.0.2": | |
281, | |
"parsing-dataview@1.1.0": | |
243, | |
"parsing-dataview@1.1.1": | |
258, | |
"parsing-dataview@2.0.0": | |
114, | |
"parsing-dataview@2.0.1": | |
113, | |
"parsing-dataview@2.1.0": | |
120, | |
"parsing-dataview@3.0.0": | |
103, | |
"parsing-dataview@3.1.0": | |
220, | |
"parsing-expect@0.0.1": | |
185, | |
"parsing-expect@0.0.2": | |
178, | |
"parsing-expect@0.0.3": | |
193, | |
"parsing-foreign@0.0.1": | |
301, | |
"parsing-foreign@0.0.2": | |
297, | |
"parsing-hexadecimal@0.0.1": | |
187, | |
"parsing-hexadecimal@0.0.2": | |
350, | |
"parsing-hexadecimal@0.0.3": | |
-187, | |
"parsing-repetition@0.0.1": | |
175, | |
"parsing-repetition@0.0.2": | |
183, | |
"parsing-repetition@0.0.3": | |
207, | |
"parsing-repetition@0.0.4": | |
207, | |
"parsing-repetition@0.0.5": | |
214, | |
"parsing-repetition@0.0.6": | |
293, | |
"parsing-repetition@0.0.7": | |
41, | |
"parsing-repetition@0.0.8": | |
114, | |
"parsing-replace@1.0.0": | |
197, | |
"parsing-replace@1.0.1": | |
202, | |
"parsing-replace@1.0.2": | |
204, | |
"parsing-replace@2.0.0": | |
109, | |
"parsing-replace@2.0.1": | |
110, | |
"parsing-replace@2.0.2": | |
233, | |
"parsing-uuid@0.0.1": | |
210, | |
"parsing-uuid@0.0.3": | |
215, | |
"parsing-validation@0.0.1": | |
182, | |
"parsing-validation@0.0.2": | |
187, | |
"parsing-validation@0.0.3": | |
190, | |
"parsing-validation@0.0.4": | |
187, | |
"parsing-validation@0.0.5": | |
288, | |
"parsing-validation@0.1.0": | |
184, | |
"parsing-validation@0.1.1": | |
172, | |
"parsing-validation@0.1.2": | |
176, | |
"parsing-validation@0.1.3": | |
117, | |
"partial@1.0.0": | |
56, | |
"partial@1.1.0": | |
74, | |
"partial@1.1.1": | |
71, | |
"partial@1.1.2": | |
127, | |
"partial@1.2.0": | |
60, | |
"partial@1.2.1": | |
49, | |
"partial@2.0.0": | |
58, | |
"partial@2.0.1": | |
71, | |
"partial@3.0.0": | |
61, | |
"partial@4.0.0": | |
74, | |
"partial-isomorphisms@1.0.0": | |
143, | |
"partial-order@0.0.1": | |
122, | |
"path@0.1.0": | |
-65, | |
"path@0.2.0": | |
-63, | |
"path@0.2.1": | |
-74, | |
"path@0.2.2": | |
-78, | |
"path@0.2.3": | |
-64, | |
"path@0.2.4": | |
-77, | |
"path@0.2.5": | |
-76, | |
"path@0.2.6": | |
-151, | |
"path@0.2.7": | |
-74, | |
"pathy@0.1.0": | |
89, | |
"pathy@0.1.1": | |
83, | |
"pathy@0.1.2": | |
87, | |
"pathy@0.1.3": | |
84, | |
"pathy@0.1.4": | |
85, | |
"pathy@0.2.0": | |
178, | |
"pathy@0.2.1": | |
85, | |
"pathy@0.2.2": | |
59, | |
"pathy@0.3.0": | |
80, | |
"pathy@0.3.1": | |
83, | |
"pathy@0.3.2": | |
80, | |
"pathy@0.3.3": | |
83, | |
"pathy@1.0.0": | |
68, | |
"pathy@2.0.0": | |
129, | |
"pathy@3.0.0": | |
184, | |
"pathy@3.0.1": | |
134, | |
"pathy@3.0.2": | |
146, | |
"pathy@4.0.0": | |
259, | |
"pathy@4.1.0": | |
387, | |
"pathy@5.0.0": | |
205, | |
"pathy@6.0.0": | |
117, | |
"pathy@7.0.0": | |
126, | |
"pathy@7.0.1": | |
149, | |
"pathy@8.0.0": | |
95, | |
"pathy@8.1.0": | |
94, | |
"pathy@9.0.0": | |
168, | |
"paxl@0.0.1": | |
481, | |
"paxl@0.0.2": | |
439, | |
"payload@0.1.0": | |
399, | |
"payload@0.1.1": | |
410, | |
"payload@0.1.2": | |
411, | |
"payload@0.1.3": | |
413, | |
"payload@0.1.4": | |
523, | |
"payload@0.2.0": | |
419, | |
"payload@0.3.0": | |
415, | |
"payload@0.3.1": | |
420, | |
"payload@0.4.0": | |
207, | |
"peregrine@0.0.1": | |
192, | |
"periodic@1.0.0": | |
481, | |
"permutations@0.1.0": | |
95, | |
"permutations@0.1.1": | |
621, | |
"permutations@0.2.0": | |
479, | |
"permutations@0.2.1": | |
480, | |
"permutations@0.2.2": | |
115, | |
"pg@0.4.0": | |
290, | |
"pg@0.5.0": | |
393, | |
"pha@0.0.1": | |
254, | |
"pha@0.0.2": | |
240, | |
"pha@0.0.3": | |
250, | |
"pha@0.0.4": | |
258, | |
"pha@0.0.5": | |
264, | |
"pha@0.0.6": | |
204, | |
"pha@0.0.7": | |
204, | |
"pha@0.0.8": | |
308, | |
"pha@0.1.0": | |
199, | |
"pha@0.1.1": | |
195, | |
"pha@0.3.1": | |
213, | |
"pha@0.3.3": | |
210, | |
"pha@0.4.0": | |
448, | |
"pha@0.5.0": | |
561, | |
"pha@0.5.5": | |
436, | |
"pha@0.6.1": | |
261, | |
"pha@0.7.0": | |
271, | |
"pha@0.7.1": | |
277, | |
"pha@0.7.2": | |
294, | |
"pha@0.7.3": | |
302, | |
"pha@0.8.0": | |
168, | |
"pha@0.8.1": | |
259, | |
"pha@0.9.0": | |
105, | |
"phantom@0.1.0": | |
40, | |
"phantom@0.1.1": | |
70, | |
"phantom@0.1.2": | |
63, | |
"phantom@0.1.21": | |
72, | |
"phantom@1.0.0": | |
94, | |
"phantom@1.0.1": | |
103, | |
"phantom@1.2.0": | |
259, | |
"phantom@2.0.0": | |
463, | |
"phantom@3.0.0": | |
314, | |
"phantom@3.0.1": | |
308, | |
"phantom@3.0.2": | |
311, | |
"phantom@3.1.0": | |
312, | |
"phaser@0.0.1": | |
227, | |
"phaser@0.0.2": | |
129, | |
"phaser@0.0.3": | |
118, | |
"phaser@0.1.0": | |
124, | |
"phaser@0.2.0": | |
127, | |
"phaser@0.3.0": | |
129, | |
"phaser@0.4.0": | |
158, | |
"phaser@0.5.0": | |
138, | |
"phaser@0.6.0": | |
211, | |
"phinajs@0.1.0": | |
174, | |
"phinajs@0.1.1": | |
171, | |
"phinajs@0.1.2": | |
174, | |
"phinajs@0.1.3": | |
186, | |
"phinajs@0.1.4": | |
184, | |
"phinajs@0.1.5": | |
185, | |
"phinajs@0.1.6": | |
192, | |
"phinajs@0.1.7": | |
301, | |
"phinajs@0.1.8": | |
176, | |
"phinajs@0.1.9": | |
156, | |
"phoenix@0.1.0": | |
73, | |
"phoenix@2.0.0": | |
226, | |
"phoenix@2.0.1": | |
226, | |
"phoenix@2.0.2": | |
233, | |
"phoenix@3.0.0": | |
265, | |
"phoenix@4.0.0": | |
304, | |
"phylio@1.0.0": | |
94, | |
"phylio@1.0.1": | |
93, | |
"pino@0.1.0": | |
125, | |
"pipe-op@1.0.0": | |
58, | |
"pipes@4.0.0": | |
239, | |
"pipes@4.0.1": | |
386, | |
"pipes@4.1.0": | |
261, | |
"pipes@6.0.0": | |
188, | |
"pipes@7.0.0": | |
110, | |
"pipes@7.0.1": | |
116, | |
"pipes@8.0.0": | |
93, | |
"pipes-aff@0.0.1": | |
434, | |
"pipes-aff@0.0.2": | |
531, | |
"pipes-aff@0.1.0": | |
426, | |
"pipes-aff@0.2.0": | |
409, | |
"pipes-aff@0.3.0": | |
-494, | |
"pipes-aff@0.4.0": | |
-404, | |
"pipes-aff@0.5.0": | |
-403, | |
"plan@1.0.0": | |
369, | |
"platform@0.1.0": | |
78, | |
"platform@0.2.0": | |
74, | |
"platform@0.3.0": | |
172, | |
"platform@0.4.0": | |
82, | |
"platform@1.0.0": | |
52, | |
"platform@2.0.0": | |
215, | |
"platform@3.0.0": | |
249, | |
"point-free@0.1.1": | |
61, | |
"point-free@0.1.2": | |
67, | |
"point-free@0.1.3": | |
67, | |
"point-free@1.0.0": | |
125, | |
"pointed@0.1.0": | |
104, | |
"pointed@0.1.1": | |
77, | |
"pointed-list@0.1.0": | |
91, | |
"pointed-list@0.1.1": | |
82, | |
"pointed-list@0.1.2": | |
86, | |
"pointed-list@0.1.3": | |
83, | |
"pointed-list@0.1.4": | |
158, | |
"pointed-list@0.1.6": | |
83, | |
"pointed-list@0.2.0": | |
73, | |
"pointed-list@0.2.1": | |
90, | |
"pointed-list@0.2.2": | |
87, | |
"pointed-list@0.2.3": | |
84, | |
"pointed-list@0.2.4": | |
161, | |
"pointed-list@0.3.0": | |
75, | |
"pointed-list@0.4.0": | |
62, | |
"pointed-list@0.5.1": | |
76, | |
"polyform@0.1.0": | |
320, | |
"polyform@0.2.0": | |
318, | |
"polyform@0.2.1": | |
309, | |
"polyform@0.3.0": | |
315, | |
"polyform@0.3.1": | |
433, | |
"polyform@0.3.2": | |
296, | |
"polyform@0.3.3": | |
293, | |
"polyform@0.4.0": | |
307, | |
"polyform@0.4.1": | |
315, | |
"polyform@0.4.2": | |
306, | |
"polyform@0.5.0": | |
314, | |
"polyform@0.5.2": | |
390, | |
"polyform@0.6.0": | |
293, | |
"polyform@0.6.1": | |
295, | |
"polyform@0.6.2": | |
313, | |
"polyform@0.6.3": | |
315, | |
"polyform@0.6.4": | |
393, | |
"polyform@0.6.6": | |
309, | |
"polyform@0.6.7": | |
354, | |
"polyform@0.7.0": | |
260, | |
"polyform@0.8.0": | |
246, | |
"polyform@0.8.2": | |
254, | |
"polyform@0.9.0": | |
114, | |
"polyform-validators@0.0.2": | |
464, | |
"polyform-validators@0.0.3": | |
555, | |
"polyform-validators@0.0.4": | |
437, | |
"polyform-validators@0.0.5": | |
439, | |
"polyform-validators@0.0.6": | |
458, | |
"polyform-validators@0.1.0": | |
456, | |
"polymorphic-vectors@1.0.0": | |
71, | |
"polymorphic-vectors@1.0.1": | |
123, | |
"polymorphic-vectors@1.1.0": | |
73, | |
"polymorphic-vectors@1.1.1": | |
67, | |
"polymorphic-vectors@1.1.2": | |
76, | |
"polymorphic-vectors@2.0.0": | |
75, | |
"polymorphic-vectors@2.0.1": | |
150, | |
"polymorphic-vectors@3.0.0": | |
83, | |
"polymorphic-vectors@4.0.0": | |
87, | |
"polynomials@1.0.0": | |
160, | |
"polynomials@1.0.1": | |
160, | |
"posix-types@0.1.0": | |
60, | |
"posix-types@0.1.1": | |
75, | |
"posix-types@1.0.0": | |
65, | |
"posix-types@2.0.0": | |
123, | |
"posix-types@3.0.0": | |
79, | |
"posix-types@4.0.0": | |
44, | |
"posix-types@5.0.0": | |
60, | |
"posix-types@6.0.0": | |
70, | |
"postgresql-client@0.0.1": | |
-200, | |
"postgresql-client@0.0.2": | |
-198, | |
"postgresql-client@0.0.3": | |
-197, | |
"postgresql-client@0.0.4": | |
-318, | |
"postgresql-client@0.0.5": | |
-186, | |
"postgresql-client@0.0.6": | |
-180, | |
"postgresql-client@0.0.7": | |
-189, | |
"postgresql-client@0.0.8": | |
-201, | |
"postgresql-client@0.0.9": | |
-195, | |
"postgresql-client@0.0.10": | |
-220, | |
"postgresql-client@0.0.11": | |
-233, | |
"postgresql-client@0.0.12": | |
-325, | |
"postgresql-client@0.0.13": | |
-202, | |
"postgresql-client@0.0.14": | |
-199, | |
"postgresql-client@0.0.15": | |
-220, | |
"postgresql-client@0.0.16": | |
-216, | |
"postgresql-client@0.0.17": | |
-217, | |
"postgresql-client@0.0.18": | |
-314, | |
"postgresql-client@0.0.19": | |
-212, | |
"postgresql-client@0.0.20": | |
-205, | |
"postgresql-client@0.0.21": | |
-214, | |
"postgresql-client@0.0.22": | |
-226, | |
"postgresql-client@0.0.23": | |
-225, | |
"postgresql-client@0.0.24": | |
-227, | |
"postgresql-client@0.0.25": | |
-228, | |
"postgresql-client@0.0.26": | |
-340, | |
"postgresql-client@0.0.27": | |
470, | |
"postgresql-client@1.0.0": | |
454, | |
"postgresql-client@2.0.0": | |
521, | |
"postgresql-client@2.1.0": | |
524, | |
"postgresql-client@2.2.0": | |
581, | |
"postgresql-client@2.3.0": | |
705, | |
"postgresql-client@2.4.0": | |
367, | |
"postgresql-client@2.4.1": | |
362, | |
"postgresql-client@2.4.2": | |
377, | |
"postgresql-client@2.4.3": | |
385, | |
"postgresql-client@2.4.4": | |
393, | |
"postgresql-client@3.0.0": | |
376, | |
"postgresql-client@3.0.1": | |
601, | |
"postgresql-client@3.0.2": | |
462, | |
"postgresql-client@3.0.3": | |
446, | |
"postgresql-client@3.1.0": | |
470, | |
"postgresql-client@3.1.1": | |
463, | |
"pouchdb@0.1.1": | |
71, | |
"pprint@0.1.0": | |
73, | |
"pprint@1.0.0": | |
134, | |
"pprint@1.0.1": | |
68, | |
"pprint@1.0.2": | |
59, | |
"pprint@2.0.0": | |
111, | |
"pprint@3.0.0": | |
90, | |
"pprint@4.0.0": | |
155, | |
"pprint@5.0.0": | |
135, | |
"pqueue@0.1.0": | |
150, | |
"pqueue@0.1.1": | |
70, | |
"pqueue@0.1.2": | |
64, | |
"pqueue@0.1.3": | |
83, | |
"pqueue@0.2.0": | |
85, | |
"pqueue@0.3.0": | |
79, | |
"pqueue@0.4.0": | |
319, | |
"pqueue@0.4.1": | |
204, | |
"pqueue@0.4.2": | |
140, | |
"pqueue@1.0.0": | |
401, | |
"pqueue@2.0.0": | |
112, | |
"pray@0.0.1": | |
74, | |
"precise@1.0.0": | |
221, | |
"precise@1.0.1": | |
222, | |
"precise@1.1.0": | |
353, | |
"precise@1.2.0": | |
57, | |
"precise@1.2.1": | |
56, | |
"precise@1.3.0": | |
83, | |
"precise@1.3.1": | |
81, | |
"precise@1.3.2": | |
82, | |
"precise@1.4.0": | |
82, | |
"precise@2.0.0": | |
431, | |
"precise@2.0.1": | |
61, | |
"precise@3.0.0": | |
143, | |
"precise@3.0.1": | |
154, | |
"precise@4.0.0": | |
129, | |
"precise@5.0.0": | |
100, | |
"precise@5.1.0": | |
101, | |
"precise@6.0.0": | |
91, | |
"precise-datetime@1.0.0": | |
385, | |
"precise-datetime@2.0.0": | |
242, | |
"precise-datetime@2.1.0": | |
243, | |
"precise-datetime@3.0.0": | |
249, | |
"precise-datetime@3.1.0": | |
255, | |
"precise-datetime@4.0.0": | |
260, | |
"precise-datetime@4.1.0": | |
257, | |
"precise-datetime@5.0.0": | |
310, | |
"precise-datetime@5.0.1": | |
234, | |
"precise-datetime@5.0.2": | |
215, | |
"precise-datetime@5.0.3": | |
224, | |
"precise-datetime@5.0.4": | |
236, | |
"precise-datetime@5.1.0": | |
235, | |
"precise-datetime@5.1.1": | |
237, | |
"precise-datetime@6.0.0": | |
146, | |
"precise-datetime@6.0.1": | |
242, | |
"precise-datetime@7.0.0": | |
106, | |
"prelewd@0.0.1": | |
419, | |
"prelewd@0.1.0": | |
478, | |
"prelude@0.1.0": | |
61, | |
"prelude@0.1.1": | |
69, | |
"prelude@0.1.2": | |
66, | |
"prelude@0.1.3": | |
111, | |
"prelude@0.1.4": | |
44, | |
"prelude@0.1.5": | |
49, | |
"prelude@1.0.0": | |
65, | |
"prelude@1.0.1": | |
73, | |
"prelude@1.1.0": | |
57, | |
"prelude@2.0.0": | |
127, | |
"prelude@2.1.0": | |
47, | |
"prelude@2.2.0": | |
56, | |
"prelude@2.3.0": | |
69, | |
"prelude@2.4.0": | |
74, | |
"prelude@2.5.0": | |
61, | |
"prelude@3.0.0": | |
76, | |
"prelude@3.1.0": | |
119, | |
"prelude@3.1.1": | |
49, | |
"prelude@3.2.0": | |
54, | |
"prelude@3.3.0": | |
68, | |
"prelude@4.0.0": | |
69, | |
"prelude@4.0.1": | |
71, | |
"prelude@4.1.0": | |
56, | |
"prelude@4.1.1": | |
173, | |
"prelude@5.0.0": | |
50, | |
"prelude@5.0.1": | |
50, | |
"prelude@6.0.0": | |
58, | |
"prelude@6.0.1": | |
69, | |
"presto@0.1.0": | |
-535, | |
"presto@0.2.0": | |
-487, | |
"presto@0.2.2": | |
-571, | |
"presto@0.2.3": | |
-479, | |
"presto@0.3.0": | |
295, | |
"presto@0.4.0": | |
346, | |
"presto@0.4.1": | |
299, | |
"prettier@0.0.1": | |
61, | |
"prettier@0.0.2": | |
74, | |
"prettier@0.1.0": | |
65, | |
"prettier@0.2.0": | |
142, | |
"prettier@0.3.0": | |
51, | |
"prettier-printer@1.0.0": | |
-399, | |
"prettier-printer@1.0.1": | |
-363, | |
"prettier-printer@1.1.0": | |
-362, | |
"prettier-printer@1.2.0": | |
-363, | |
"prettier-printer@2.0.0": | |
90, | |
"prettier-printer@2.0.1": | |
165, | |
"prettier-printer@3.0.0": | |
85, | |
"pretty-logs@0.1.0": | |
44, | |
"prng@0.0.1": | |
104, | |
"prng@0.1.0": | |
99, | |
"probability@0.0.0": | |
74, | |
"probability@0.0.1": | |
154, | |
"probability@0.0.2": | |
158, | |
"probability@1.0.0": | |
137, | |
"probability@2.0.0": | |
221, | |
"probability@3.0.0": | |
214, | |
"probability@3.1.0": | |
219, | |
"probability@3.1.1": | |
308, | |
"probability@3.1.2": | |
206, | |
"probability@4.0.0": | |
188, | |
"probability@4.0.1": | |
200, | |
"probability@4.0.2": | |
202, | |
"probability@4.1.0": | |
203, | |
"probability@5.0.0": | |
175, | |
"probability@5.1.0": | |
173, | |
"profunctor@0.0.1": | |
121, | |
"profunctor@0.0.2": | |
76, | |
"profunctor@0.1.0": | |
61, | |
"profunctor@0.2.0": | |
83, | |
"profunctor@0.2.1": | |
72, | |
"profunctor@0.3.0": | |
76, | |
"profunctor@0.3.1": | |
80, | |
"profunctor@0.3.2": | |
70, | |
"profunctor@1.0.0": | |
108, | |
"profunctor@2.0.0": | |
78, | |
"profunctor@3.0.0": | |
84, | |
"profunctor@3.1.0": | |
92, | |
"profunctor@3.2.0": | |
86, | |
"profunctor@4.0.0": | |
174, | |
"profunctor@4.1.0": | |
69, | |
"profunctor@5.0.0": | |
54, | |
"profunctor@6.0.0": | |
57, | |
"profunctor-lenses@0.1.0": | |
82, | |
"profunctor-lenses@0.2.0": | |
90, | |
"profunctor-lenses@0.3.0": | |
87, | |
"profunctor-lenses@0.3.1": | |
109, | |
"profunctor-lenses@0.3.2": | |
235, | |
"profunctor-lenses@0.3.3": | |
97, | |
"profunctor-lenses@0.3.4": | |
91, | |
"profunctor-lenses@0.3.5": | |
100, | |
"profunctor-lenses@0.4.0": | |
92, | |
"profunctor-lenses@0.4.1": | |
92, | |
"profunctor-lenses@0.4.2": | |
-94, | |
"profunctor-lenses@0.5.0": | |
-178, | |
"profunctor-lenses@0.5.1": | |
-82, | |
"profunctor-lenses@0.5.2": | |
-77, | |
"profunctor-lenses@0.5.3": | |
-81, | |
"profunctor-lenses@0.5.4": | |
-93, | |
"profunctor-lenses@1.0.0": | |
78, | |
"profunctor-lenses@2.0.0": | |
252, | |
"profunctor-lenses@2.1.0": | |
239, | |
"profunctor-lenses@2.2.0": | |
368, | |
"profunctor-lenses@2.3.0": | |
-198, | |
"profunctor-lenses@2.4.0": | |
214, | |
"profunctor-lenses@2.5.0": | |
222, | |
"profunctor-lenses@2.6.0": | |
-202, | |
"profunctor-lenses@3.0.0": | |
294, | |
"profunctor-lenses@3.1.0": | |
332, | |
"profunctor-lenses@3.2.0": | |
299, | |
"profunctor-lenses@3.3.0": | |
416, | |
"profunctor-lenses@3.4.0": | |
324, | |
"profunctor-lenses@3.5.0": | |
321, | |
"profunctor-lenses@3.6.0": | |
333, | |
"profunctor-lenses@3.6.1": | |
328, | |
"profunctor-lenses@3.7.0": | |
318, | |
"profunctor-lenses@3.8.0": | |
411, | |
"profunctor-lenses@4.0.0": | |
167, | |
"profunctor-lenses@5.0.0": | |
157, | |
"profunctor-lenses@6.0.0": | |
180, | |
"profunctor-lenses@6.1.0": | |
179, | |
"profunctor-lenses@6.1.1": | |
283, | |
"profunctor-lenses@6.2.0": | |
178, | |
"profunctor-lenses@6.3.0": | |
165, | |
"profunctor-lenses@7.0.0": | |
90, | |
"profunctor-lenses@7.0.1": | |
100, | |
"profunctor-lenses@8.0.0": | |
87, | |
"projections@0.0.2": | |
56, | |
"projections@0.1.0": | |
76, | |
"promises@0.1.0": | |
260, | |
"promises@0.2.0": | |
130, | |
"promises@1.0.0": | |
289, | |
"promises@1.0.1": | |
287, | |
"promises@2.0.0": | |
295, | |
"promises@3.0.0": | |
144, | |
"promises@3.1.0": | |
149, | |
"promises@3.1.1": | |
146, | |
"propel@0.1.0": | |
614, | |
"properties@0.1.0": | |
45, | |
"properties@0.2.0": | |
53, | |
"proportion@0.1.0": | |
101, | |
"proportion@0.2.0": | |
99, | |
"proportion@0.3.0": | |
101, | |
"protobuf@0.9.0": | |
55, | |
"protobuf@0.9.1": | |
152, | |
"protobuf@0.9.2": | |
271, | |
"protobuf@0.9.3": | |
242, | |
"protobuf@1.0.0": | |
239, | |
"protobuf@1.1.0": | |
244, | |
"protobuf@1.1.1": | |
245, | |
"protobuf@1.2.0": | |
251, | |
"protobuf@1.3.0": | |
338, | |
"protobuf@1.4.0": | |
229, | |
"protobuf@1.5.0": | |
222, | |
"protobuf@1.6.0": | |
240, | |
"protobuf@1.7.0": | |
246, | |
"protobuf@1.7.1": | |
242, | |
"protobuf@1.8.0": | |
372, | |
"protobuf@2.0.0": | |
-224, | |
"protobuf@2.1.0": | |
-212, | |
"protobuf@2.1.1": | |
-221, | |
"protobuf@2.1.2": | |
-235, | |
"protobuf@3.0.0": | |
119, | |
"protobuf@4.0.0": | |
119, | |
"proxy@0.1.0": | |
57, | |
"proxy@1.0.0": | |
127, | |
"proxy@2.0.0": | |
45, | |
"proxy@2.1.0": | |
51, | |
"proxy@3.0.0": | |
58, | |
"proxy@3.0.1": | |
71, | |
"proxy@3.0.2": | |
68, | |
"proxying@0.1.0": | |
-144, | |
"proxying@1.0.0": | |
182, | |
"proxying@1.0.1": | |
85, | |
"proxying@1.1.0": | |
84, | |
"ps-cst@1.2.0": | |
310, | |
"psa-utils@1.0.0": | |
75, | |
"psa-utils@1.0.1": | |
109, | |
"psa-utils@2.0.0": | |
278, | |
"psa-utils@2.1.0": | |
233, | |
"psa-utils@3.0.0": | |
305, | |
"psa-utils@4.0.0": | |
314, | |
"psa-utils@5.0.0": | |
238, | |
"psa-utils@5.0.1": | |
241, | |
"psa-utils@5.1.0": | |
242, | |
"psa-utils@6.0.0": | |
336, | |
"psa-utils@7.0.0": | |
215, | |
"psa-utils@8.0.0": | |
108, | |
"psc-ide@0.1.2": | |
112, | |
"psc-ide@1.2.0": | |
125, | |
"psc-ide@2.0.0": | |
121, | |
"psc-ide@2.1.0": | |
130, | |
"psc-ide@3.0.0": | |
131, | |
"psc-ide@3.0.1": | |
214, | |
"psc-ide@4.0.0": | |
92, | |
"psc-ide@4.0.1": | |
81, | |
"psc-ide@5.0.0": | |
89, | |
"psc-ide@5.0.1": | |
97, | |
"psc-ide@5.0.2": | |
96, | |
"psc-ide@5.0.3": | |
-280, | |
"psc-ide@5.0.4": | |
-277, | |
"psc-ide@6.0.0": | |
-387, | |
"psc-ide@7.0.0": | |
711, | |
"psc-ide@7.0.1": | |
622, | |
"psc-ide@8.0.0": | |
734, | |
"psc-ide@8.0.1": | |
737, | |
"psc-ide@9.0.0": | |
874, | |
"psc-ide@9.0.1": | |
720, | |
"psc-ide@10.0.0": | |
716, | |
"psc-ide@10.1.0": | |
740, | |
"psc-ide@11.0.0": | |
742, | |
"psc-ide@11.1.0": | |
741, | |
"psc-ide@12.0.0": | |
868, | |
"psc-ide@13.0.0": | |
713, | |
"psc-ide@13.0.1": | |
345, | |
"psc-ide@14.0.0": | |
359, | |
"psc-ide@15.0.0": | |
418, | |
"psc-ide@15.0.1": | |
418, | |
"psc-ide@16.0.0": | |
409, | |
"psc-ide@17.0.0": | |
491, | |
"psc-ide@18.0.0": | |
149, | |
"psc-ide@19.0.0": | |
126, | |
"psci-support@1.0.0": | |
53, | |
"psci-support@2.0.0": | |
72, | |
"psci-support@3.0.0": | |
77, | |
"psci-support@4.0.0": | |
124, | |
"psci-support@5.0.0": | |
46, | |
"psci-support@6.0.0": | |
52, | |
"pseudo-random@0.1.0": | |
135, | |
"pseudo-random@0.2.0": | |
110, | |
"pseudo-random@0.2.1": | |
105, | |
"pseudo-random@0.2.2": | |
178, | |
"pshendry-halogen@0.1.0": | |
-216, | |
"pshendry-halogen@0.1.1": | |
-200, | |
"pshendry-halogen@0.1.2": | |
-201, | |
"pshendry-halogen@0.1.3": | |
-221, | |
"pshendry-halogen@0.1.4": | |
-209, | |
"pshendry-halogen@0.1.5": | |
-213, | |
"pshendry-halogen@0.1.6": | |
-215, | |
"pshendry-halogen@0.1.7": | |
-359, | |
"pshendry-halogen@0.1.8": | |
-198, | |
"pshendry-halogen@0.1.9": | |
-197, | |
"pshendry-halogen@0.1.10": | |
-207, | |
"pshendry-halogen@0.1.11": | |
-216, | |
"pshendry-halogen@0.1.12": | |
-216, | |
"pshendry-halogen@0.1.13": | |
-220, | |
"pshendry-halogen@0.1.14": | |
-332, | |
"pshendry-halogen@0.2.0": | |
-532, | |
"puchitomato@0.1.0": | |
210, | |
"pure-css@0.0.0": | |
54, | |
"pure-css@0.0.1": | |
72, | |
"pure-style@0.1.0": | |
142, | |
"pure-style@0.1.1": | |
137, | |
"pure-style@1.0.0": | |
346, | |
"pure-style@1.1.0": | |
158, | |
"pure-style@1.2.0": | |
164, | |
"pure-style@2.0.0": | |
120, | |
"pure-style@2.0.1": | |
125, | |
"pure-style@3.0.0": | |
128, | |
"pure-style@4.0.0": | |
115, | |
"pure-style@4.0.1": | |
184, | |
"purescript-compiler-backend-utilities@0.0.1": | |
297, | |
"purversion@0.0.4": | |
296, | |
"purversion@0.0.5": | |
312, | |
"purversion@0.0.6": | |
317, | |
"purview@1.0.0": | |
744, | |
"purview@1.1.0": | |
831, | |
"pux@0.0.1": | |
88, | |
"pux@0.1.0": | |
89, | |
"pux@0.2.0": | |
103, | |
"pux@0.3.0": | |
85, | |
"pux@1.0.0": | |
116, | |
"pux@2.0.0": | |
185, | |
"pux@2.0.1": | |
106, | |
"pux@2.0.2": | |
102, | |
"pux@3.0.0": | |
118, | |
"pux@3.1.0": | |
101, | |
"pux@4.0.0": | |
178, | |
"pux@4.0.1": | |
91, | |
"pux@4.1.0": | |
86, | |
"pux@5.0.0": | |
69, | |
"pux@5.0.1": | |
85, | |
"pux@5.0.2": | |
84, | |
"pux@5.0.3": | |
86, | |
"pux@6.0.0": | |
-219, | |
"pux@6.0.1": | |
-279, | |
"pux@7.0.0": | |
550, | |
"pux@7.1.0": | |
527, | |
"pux@7.2.0": | |
542, | |
"pux@8.0.0": | |
-464, | |
"pux@8.1.0": | |
-464, | |
"pux@8.2.0": | |
-466, | |
"pux@8.3.0": | |
-590, | |
"pux@8.4.0": | |
-446, | |
"pux@8.5.0": | |
-451, | |
"pux@8.6.0": | |
-456, | |
"pux@8.7.0": | |
-460, | |
"pux@8.8.0": | |
-464, | |
"pux@8.9.0": | |
-466, | |
"pux@9.0.0": | |
656, | |
"pux@9.1.0": | |
532, | |
"pux@9.2.0": | |
527, | |
"pux@9.3.0": | |
548, | |
"pux@10.0.0": | |
655, | |
"pux@11.0.0": | |
531, | |
"pux@12.0.0": | |
425, | |
"pux@13.0.0": | |
307, | |
"pux-clappr@0.1.0": | |
707, | |
"pux-clappr@0.2.0": | |
716, | |
"pux-clappr@0.2.1": | |
775, | |
"pux-css@1.0.0": | |
-227, | |
"pux-devtool@1.0.0": | |
110, | |
"pux-devtool@1.1.0": | |
101, | |
"pux-devtool@2.0.0": | |
-106, | |
"pux-devtool@2.0.1": | |
-118, | |
"pux-devtool@2.0.2": | |
-115, | |
"pux-devtool@2.0.3": | |
-119, | |
"pux-devtool@3.0.0": | |
-94, | |
"pux-devtool@3.0.1": | |
-200, | |
"pux-devtool@4.0.0": | |
-683, | |
"pux-devtool@4.1.0": | |
-648, | |
"pux-document-title@1.0.0": | |
-251, | |
"pux-echarts@0.1.0": | |
1061, | |
"pux-echarts@1.0.0": | |
874, | |
"pux-form@1.0.0": | |
1212, | |
"pux-form@1.0.1": | |
1061, | |
"pux-form@2.0.0": | |
1043, | |
"pux-form@2.1.0": | |
657, | |
"pux-form@2.2.0": | |
308, | |
"pux-redux@0.2.0": | |
630, | |
"pux-redux@0.2.1": | |
623, | |
"pux-redux@0.2.2": | |
726, | |
"pux-smolder-dom@1.0.0": | |
725, | |
"pux-spectacle@1.0.1": | |
75, | |
"pux-spectacle@1.1.0": | |
91, | |
"pux-spectacle@1.2.0": | |
88, | |
"pux-spectacle@2.0.0": | |
922, | |
"pux-spectacle-codeslide@1.0.0": | |
83, | |
"pux-spectacle-codeslide@2.0.0": | |
887, | |
"puxing-bob@0.0.3": | |
-642, | |
"puxing-bob@0.1.0": | |
-649, | |
"pwned-passwords@1.0.0": | |
328, | |
"pwned-passwords@2.0.0": | |
168, | |
"qieyun@0.1.0": | |
182, | |
"qieyun@0.2.0": | |
46, | |
"qieyun@0.3.0": | |
55, | |
"qieyun@0.4.0": | |
58, | |
"qieyun@0.5.0": | |
77, | |
"qrcode@0.0.0": | |
-302, | |
"qrcode@0.0.1": | |
-264, | |
"qrcode@0.0.2": | |
-266, | |
"qrcode-js@0.1.0": | |
150, | |
"qrcode-js@0.2.0": | |
106, | |
"qrcode-js@1.0.0": | |
-228, | |
"qrcode-js@2.0.0": | |
496, | |
"qrcode-js-halogen@0.1.0": | |
105, | |
"qrcode-js-halogen@1.0.0": | |
-271, | |
"qrcode-js-halogen@1.1.0": | |
-271, | |
"qrcode-js-halogen@2.0.0": | |
-838, | |
"qrcode-js-halogen@2.0.1": | |
-696, | |
"qrcode-js-halogen@3.0.0": | |
-655, | |
"qualified-do@1.0.0": | |
72, | |
"qualified-do@2.0.0": | |
90, | |
"qualified-do@2.1.0": | |
81, | |
"qualified-do@2.2.0": | |
89, | |
"quantities@1.0.0": | |
64, | |
"quantities@1.1.0": | |
153, | |
"quantities@2.0.0": | |
155, | |
"quantities@2.1.0": | |
128, | |
"quantities@2.2.0": | |
151, | |
"quantities@3.0.0": | |
138, | |
"quantities@3.1.0": | |
141, | |
"quantities@3.2.0": | |
233, | |
"quantities@3.3.0": | |
139, | |
"quantities@3.4.0": | |
124, | |
"quantities@3.5.0": | |
128, | |
"quantities@3.5.1": | |
112, | |
"quantities@3.5.2": | |
113, | |
"quantities@3.5.3": | |
113, | |
"quantities@3.5.4": | |
114, | |
"quantities@3.6.0": | |
188, | |
"quantities@4.0.0": | |
97, | |
"quantities@4.0.1": | |
102, | |
"quantities@4.1.0": | |
93, | |
"quantities@4.1.1": | |
111, | |
"quantities@5.0.0": | |
315, | |
"quantities@5.0.1": | |
310, | |
"quantities@5.0.2": | |
304, | |
"quantities@5.0.3": | |
401, | |
"quantities@5.1.0": | |
255, | |
"quantities@5.2.0": | |
250, | |
"quantities@6.0.0": | |
254, | |
"quantities@6.1.0": | |
263, | |
"quantities@6.2.0": | |
412, | |
"quantities@6.3.0": | |
415, | |
"quantities@6.4.0": | |
411, | |
"quantities@6.4.1": | |
527, | |
"quantities@7.0.0": | |
394, | |
"quantities@7.1.0": | |
384, | |
"quantities@7.2.0": | |
402, | |
"quantities@8.0.0": | |
162, | |
"quantities@8.0.1": | |
168, | |
"quantities@8.0.2": | |
271, | |
"quantities@8.1.0": | |
152, | |
"quantities@8.1.1": | |
149, | |
"quantities@8.2.0": | |
151, | |
"quantities@8.3.0": | |
162, | |
"quantities@8.3.1": | |
165, | |
"quantities@9.0.0": | |
167, | |
"quantities@10.0.0": | |
259, | |
"quantities@11.0.0": | |
199, | |
"quantities@12.0.0": | |
-104, | |
"quantities@12.0.1": | |
128, | |
"quantities@12.1.0": | |
97, | |
"quasar@1.0.0": | |
-143, | |
"quasar@1.1.0": | |
-142, | |
"quasar@1.2.0": | |
-142, | |
"quasar@2.0.0": | |
256, | |
"quasar@3.0.0": | |
-236, | |
"quasar@4.0.0": | |
-220, | |
"quasar@5.0.0": | |
-227, | |
"quasar@6.0.0": | |
-237, | |
"quasar@7.0.0": | |
-237, | |
"quasar@8.0.0": | |
-238, | |
"quasar@9.0.0": | |
-235, | |
"quasar@10.0.0": | |
-342, | |
"quasar@11.0.0": | |
-833, | |
"quasar@12.0.0": | |
-829, | |
"quasar@13.0.0": | |
-843, | |
"quasar@14.0.0": | |
-944, | |
"quasar@14.0.1": | |
-826, | |
"quasar@15.0.0": | |
-792, | |
"quasar@16.0.0": | |
-832, | |
"quasar@17.0.0": | |
-820, | |
"quasar@18.0.0": | |
-820, | |
"quasar@19.0.0": | |
-932, | |
"quasar@20.0.0": | |
-791, | |
"quasar@21.0.0": | |
-788, | |
"quasar@22.0.0": | |
1361, | |
"quasar@23.0.0": | |
1353, | |
"quasar@24.0.0": | |
1469, | |
"quasar@25.0.0": | |
1325, | |
"quasar@25.0.1": | |
1334, | |
"quasar@26.0.0": | |
1411, | |
"quasar@27.0.0": | |
1350, | |
"quasar@28.0.0": | |
1468, | |
"quasar@29.0.0": | |
1292, | |
"quasar@30.0.0": | |
1302, | |
"quasar@31.0.0": | |
1284, | |
"quasar@31.1.0": | |
1294, | |
"quasar@32.0.0": | |
1416, | |
"quasar@33.0.0": | |
1252, | |
"quasar@34.0.0": | |
1258, | |
"quasar@35.0.0": | |
1284, | |
"quasar@35.0.1": | |
1292, | |
"quasar@36.0.0": | |
1400, | |
"quasar@37.0.0": | |
1280, | |
"quasar@38.0.0": | |
1199, | |
"quasar@38.0.1": | |
1223, | |
"quasar@38.0.2": | |
1214, | |
"quasar@38.0.3": | |
1346, | |
"quasar@38.0.4": | |
1205, | |
"quasar@38.0.5": | |
1181, | |
"quasar@38.0.6": | |
1204, | |
"quasar@38.1.0": | |
1208, | |
"quasar@38.2.0": | |
1305, | |
"quasar@39.0.0": | |
1361, | |
"quasar@40.0.0": | |
1304, | |
"quasar@40.1.0": | |
1338, | |
"quasar@40.1.1": | |
1336, | |
"quasar@40.1.2": | |
1439, | |
"quasar@41.0.0": | |
1319, | |
"quasar@41.0.1": | |
1307, | |
"quasar@42.0.0": | |
1437, | |
"quasar@42.0.1": | |
1300, | |
"quasar@43.0.0": | |
1204, | |
"quasar@43.1.0": | |
1228, | |
"quasar@43.1.1": | |
1365, | |
"quasar@44.0.0": | |
1184, | |
"quasar@45.0.0": | |
1145, | |
"quaternions@0.1.0": | |
-55, | |
"quaternions@0.1.1": | |
-85, | |
"quaternions@1.0.0": | |
644, | |
"quaternions@2.0.0": | |
733, | |
"quaternions@2.1.0": | |
660, | |
"quaternions@3.0.0": | |
42, | |
"quaternions@3.0.1": | |
65, | |
"quaternions@4.0.0": | |
66, | |
"query-params@0.0.1": | |
248, | |
"query-params@1.0.0": | |
347, | |
"query-params@1.0.1": | |
238, | |
"query-params@1.0.2": | |
230, | |
"query-params@2.0.0": | |
-312, | |
"querydsl@0.1.0": | |
139, | |
"querydsl@0.1.1": | |
247, | |
"querydsl@0.1.2": | |
237, | |
"querydsl@0.2.0": | |
327, | |
"querydsl@0.3.0": | |
453, | |
"querydsl@0.5.0": | |
340, | |
"querydsl@0.6.0": | |
342, | |
"querydsl@0.7.0": | |
378, | |
"querydsl@0.7.1": | |
339, | |
"querydsl@0.7.2": | |
394, | |
"querydsl@0.8.0": | |
437, | |
"querydsl@0.9.0": | |
411, | |
"querydsl@0.9.1": | |
381, | |
"querydsl@0.9.5": | |
385, | |
"querydsl@0.9.6": | |
406, | |
"querydsl@0.10.0": | |
303, | |
"querydsl@0.10.1": | |
306, | |
"queue@0.0.1": | |
551, | |
"queue@0.0.2": | |
423, | |
"queue@0.1.0": | |
417, | |
"queue@0.2.0": | |
415, | |
"queue@0.3.0": | |
431, | |
"queue@0.4.0": | |
433, | |
"queue@0.5.0": | |
429, | |
"queue@0.6.0": | |
527, | |
"queue@0.7.0": | |
414, | |
"queue@0.8.0": | |
405, | |
"queue@1.0.0": | |
444, | |
"queue@1.1.0": | |
453, | |
"queue@1.1.1": | |
450, | |
"queue@2.0.0": | |
452, | |
"queue@2.0.1": | |
561, | |
"queue@3.0.0": | |
446, | |
"queue@4.0.0": | |
435, | |
"queue@4.0.1": | |
439, | |
"queue@4.0.2": | |
458, | |
"queue@4.1.0": | |
485, | |
"queue@4.2.0": | |
463, | |
"queue@5.0.0": | |
459, | |
"queue@6.0.0": | |
559, | |
"queue@7.0.0": | |
205, | |
"queue@7.1.0": | |
204, | |
"queue@7.1.1": | |
222, | |
"queue@7.1.2": | |
220, | |
"queue@7.1.3": | |
304, | |
"queue@8.0.0": | |
250, | |
"queue@8.0.1": | |
225, | |
"queue@8.0.2": | |
239, | |
"quick-format@0.0.1": | |
153, | |
"quick-format@0.0.2": | |
154, | |
"quickcheck@0.2.1": | |
-136, | |
"quickcheck@0.2.2": | |
-71, | |
"quickcheck@0.3.0": | |
-50, | |
"quickcheck@0.3.1": | |
-69, | |
"quickcheck@0.3.2": | |
71, | |
"quickcheck@0.4.0": | |
71, | |
"quickcheck@0.5.0": | |
164, | |
"quickcheck@0.5.1": | |
71, | |
"quickcheck@0.5.2": | |
62, | |
"quickcheck@0.6.0": | |
75, | |
"quickcheck@0.7.0": | |
83, | |
"quickcheck@0.8.0": | |
79, | |
"quickcheck@0.9.0": | |
83, | |
"quickcheck@0.10.0": | |
158, | |
"quickcheck@0.10.1": | |
87, | |
"quickcheck@0.11.0": | |
62, | |
"quickcheck@0.12.0": | |
72, | |
"quickcheck@0.12.1": | |
84, | |
"quickcheck@0.12.2": | |
80, | |
"quickcheck@1.0.0": | |
74, | |
"quickcheck@2.0.0": | |
128, | |
"quickcheck@3.0.0": | |
277, | |
"quickcheck@3.1.0": | |
144, | |
"quickcheck@3.1.1": | |
137, | |
"quickcheck@4.0.0": | |
169, | |
"quickcheck@4.1.0": | |
180, | |
"quickcheck@4.2.0": | |
184, | |
"quickcheck@4.3.0": | |
188, | |
"quickcheck@4.4.0": | |
211, | |
"quickcheck@4.5.0": | |
326, | |
"quickcheck@4.6.0": | |
150, | |
"quickcheck@4.6.1": | |
149, | |
"quickcheck@4.6.2": | |
150, | |
"quickcheck@4.7.0": | |
150, | |
"quickcheck@5.0.0": | |
144, | |
"quickcheck@6.0.0": | |
142, | |
"quickcheck@6.1.0": | |
143, | |
"quickcheck@7.0.0": | |
197, | |
"quickcheck@7.1.0": | |
96, | |
"quickcheck@8.0.0": | |
79, | |
"quickcheck@8.0.1": | |
81, | |
"quickcheck-combinators@0.0.0": | |
142, | |
"quickcheck-combinators@0.1.0": | |
133, | |
"quickcheck-combinators@0.1.1": | |
133, | |
"quickcheck-combinators@0.1.2": | |
187, | |
"quickcheck-combinators@0.1.3": | |
116, | |
"quickcheck-laws@0.1.0": | |
79, | |
"quickcheck-laws@0.1.1": | |
87, | |
"quickcheck-laws@1.0.0": | |
75, | |
"quickcheck-laws@2.0.0": | |
346, | |
"quickcheck-laws@2.1.0": | |
182, | |
"quickcheck-laws@3.0.0": | |
271, | |
"quickcheck-laws@3.0.1": | |
403, | |
"quickcheck-laws@4.0.0": | |
129, | |
"quickcheck-laws@5.0.0": | |
135, | |
"quickcheck-laws@5.0.1": | |
135, | |
"quickcheck-laws@5.1.0": | |
243, | |
"quickcheck-laws@6.0.0": | |
94, | |
"quickcheck-laws@6.0.1": | |
94, | |
"quickcheck-laws@7.0.0": | |
91, | |
"quickcheck-mbt@0.0.2": | |
145, | |
"quickcheck-mbt@0.0.3": | |
145, | |
"quickcheck-mbt@0.0.4": | |
146, | |
"quickcheck-mbt@0.0.5": | |
227, | |
"quickcheck-mbt@0.0.6": | |
194, | |
"quickcheck-mbt@0.0.7": | |
186, | |
"quickcheck-mbt@0.0.8": | |
194, | |
"quickcheck-mbt@0.0.9": | |
205, | |
"quickcheck-state-machine@0.0.2": | |
147, | |
"quickcheck-state-machine@0.0.3": | |
232, | |
"quickcheck-state-machine@0.0.4": | |
131, | |
"quickcheck-state-machine@0.0.5": | |
130, | |
"quickcheck-state-machine@0.0.6": | |
194, | |
"quickcheck-state-machine@0.0.7": | |
252, | |
"quickcheck-state-machine@0.0.8": | |
223, | |
"quickcheck-state-machine@0.0.9": | |
205, | |
"quickcheck-utf8@0.0.0": | |
245, | |
"quickserve@0.1.0": | |
564, | |
"quickserve@0.2.0": | |
542, | |
"quickserve@1.0.0": | |
557, | |
"quickserve@2.0.0": | |
596, | |
"quickserve@3.0.0": | |
545, | |
"quill@0.1.0": | |
577, | |
"quill@0.2.0": | |
357, | |
"quill@0.3.0": | |
282, | |
"quotient@0.0.1": | |
62, | |
"quotient@0.0.2": | |
65, | |
"quotient@0.0.3": | |
66, | |
"quotient@0.0.4": | |
68, | |
"quotient@0.0.5": | |
545, | |
"quotient@0.0.6": | |
413, | |
"quotient@1.0.0": | |
391, | |
"quotient@2.0.0": | |
123, | |
"quotient@3.0.0": | |
141, | |
"ractive@0.1.0": | |
125, | |
"ractive@0.1.2": | |
219, | |
"ractive@0.1.3": | |
-247, | |
"ractive@0.1.4": | |
-232, | |
"radox@0.0.4": | |
102, | |
"radox@0.0.5": | |
118, | |
"radox@0.0.6": | |
118, | |
"radox@0.0.7": | |
117, | |
"radox@0.0.8": | |
118, | |
"radox@1.0.0": | |
365, | |
"random@0.1.0": | |
42, | |
"random@0.1.1": | |
54, | |
"random@0.1.2": | |
50, | |
"random@0.1.3": | |
73, | |
"random@0.2.0": | |
65, | |
"random@0.2.1": | |
75, | |
"random@0.2.2": | |
68, | |
"random@0.2.3": | |
151, | |
"random@1.0.0": | |
51, | |
"random@2.0.0": | |
65, | |
"random@3.0.0": | |
68, | |
"random@4.0.0": | |
69, | |
"random@5.0.0": | |
68, | |
"random@6.0.0": | |
70, | |
"random-secure@1.0.0": | |
307, | |
"random-secure@2.0.0": | |
167, | |
"random-words@0.0.1": | |
646, | |
"rate-limit@0.0.1": | |
167, | |
"rationals@0.3.2": | |
61, | |
"rationals@0.4.0": | |
64, | |
"rationals@1.0.0": | |
71, | |
"rationals@2.0.0": | |
123, | |
"rationals@2.1.0": | |
84, | |
"rationals@2.1.1": | |
45, | |
"rationals@2.1.2": | |
56, | |
"rationals@3.0.0": | |
69, | |
"rationals@3.1.0": | |
71, | |
"rationals@3.1.1": | |
72, | |
"rationals@4.0.0": | |
69, | |
"rationals@5.0.0": | |
69, | |
"rationals@5.0.1": | |
118, | |
"rave@0.1.0": | |
-287, | |
"rave@0.1.1": | |
214, | |
"rdf@0.1.0": | |
108, | |
"rdkafka@0.1.0": | |
387, | |
"rdkafka@0.1.1": | |
497, | |
"react@0.0.2": | |
38, | |
"react@0.0.3": | |
56, | |
"react@0.0.4": | |
58, | |
"react@0.0.5": | |
78, | |
"react@0.1.0": | |
66, | |
"react@0.1.1": | |
69, | |
"react@0.1.2": | |
90, | |
"react@0.2.0": | |
100, | |
"react@0.3.0": | |
97, | |
"react@0.4.0": | |
91, | |
"react@0.4.1": | |
105, | |
"react@0.4.2": | |
108, | |
"react@0.4.3": | |
109, | |
"react@0.5.0": | |
106, | |
"react@0.6.0": | |
58, | |
"react@0.7.0": | |
137, | |
"react@0.7.1": | |
48, | |
"react@1.0.0": | |
54, | |
"react@1.1.0": | |
56, | |
"react@1.2.0": | |
73, | |
"react@1.3.0": | |
61, | |
"react@2.0.0": | |
73, | |
"react@3.0.0": | |
135, | |
"react@4.0.0": | |
63, | |
"react@4.1.0": | |
66, | |
"react@4.2.0": | |
56, | |
"react@4.3.0": | |
76, | |
"react@4.4.0": | |
81, | |
"react@5.0.0": | |
78, | |
"react@5.0.1": | |
161, | |
"react@5.1.0": | |
86, | |
"react@6.0.0": | |
51, | |
"react@6.1.0": | |
61, | |
"react@7.0.0": | |
75, | |
"react@7.0.1": | |
76, | |
"react@8.0.0": | |
74, | |
"react@9.0.0": | |
65, | |
"react@10.0.0": | |
81, | |
"react@10.0.1": | |
120, | |
"react-addons-css-transition-group@0.1.0": | |
45, | |
"react-addons-css-transition-group@0.2.0": | |
49, | |
"react-addons-css-transition-group@0.2.1": | |
504, | |
"react-addons-perf@0.1.0": | |
69, | |
"react-aria@0.1.0": | |
159, | |
"react-aria@0.2.0": | |
145, | |
"react-basic@0.2.0": | |
67, | |
"react-basic@0.3.0": | |
136, | |
"react-basic@0.4.0": | |
62, | |
"react-basic@0.5.0": | |
59, | |
"react-basic@0.6.0": | |
66, | |
"react-basic@0.7.0": | |
81, | |
"react-basic@0.7.1": | |
96, | |
"react-basic@0.8.0": | |
67, | |
"react-basic@0.9.0": | |
82, | |
"react-basic@0.10.0": | |
130, | |
"react-basic@0.10.1": | |
70, | |
"react-basic@0.10.2": | |
58, | |
"react-basic@1.0.0": | |
94, | |
"react-basic@1.1.0": | |
83, | |
"react-basic@1.1.1": | |
81, | |
"react-basic@1.1.2": | |
150, | |
"react-basic@1.2.0": | |
73, | |
"react-basic@2.0.0": | |
236, | |
"react-basic@2.0.1": | |
264, | |
"react-basic@2.0.2": | |
237, | |
"react-basic@2.1.0": | |
238, | |
"react-basic@3.0.0": | |
331, | |
"react-basic@4.0.0": | |
338, | |
"react-basic@4.0.1": | |
327, | |
"react-basic@4.0.2": | |
329, | |
"react-basic@4.0.3": | |
344, | |
"react-basic@5.0.0": | |
345, | |
"react-basic@5.0.1": | |
350, | |
"react-basic@6.0.0": | |
352, | |
"react-basic@6.1.0": | |
440, | |
"react-basic@6.2.0": | |
336, | |
"react-basic@7.0.0": | |
328, | |
"react-basic@8.0.0": | |
348, | |
"react-basic@8.0.1": | |
371, | |
"react-basic@9.0.0": | |
466, | |
"react-basic@9.0.1": | |
381, | |
"react-basic@10.0.0": | |
351, | |
"react-basic@11.0.0": | |
355, | |
"react-basic@11.1.0": | |
368, | |
"react-basic@12.0.0": | |
308, | |
"react-basic@13.0.0": | |
312, | |
"react-basic@14.0.0": | |
319, | |
"react-basic@15.0.0": | |
153, | |
"react-basic@16.0.0": | |
40, | |
"react-basic@17.0.0": | |
51, | |
"react-basic-classic@1.0.0": | |
262, | |
"react-basic-classic@1.0.1": | |
232, | |
"react-basic-classic@2.0.0": | |
203, | |
"react-basic-classic@3.0.0": | |
87, | |
"react-basic-compat@1.0.0": | |
253, | |
"react-basic-compat@1.0.1": | |
245, | |
"react-basic-dnd@1.0.0": | |
336, | |
"react-basic-dnd@2.0.0": | |
255, | |
"react-basic-dnd@3.0.0": | |
376, | |
"react-basic-dnd@5.0.0": | |
417, | |
"react-basic-dnd@6.0.0": | |
629, | |
"react-basic-dnd@6.1.0": | |
446, | |
"react-basic-dnd@6.1.1": | |
428, | |
"react-basic-dnd@6.1.2": | |
444, | |
"react-basic-dnd@6.1.3": | |
453, | |
"react-basic-dnd@6.1.4": | |
454, | |
"react-basic-dnd@6.1.5": | |
582, | |
"react-basic-dnd@7.0.0": | |
388, | |
"react-basic-dnd@8.0.0": | |
699, | |
"react-basic-dnd@9.0.0": | |
126, | |
"react-basic-dnd@10.0.0": | |
128, | |
"react-basic-dnd@10.1.0": | |
127, | |
"react-basic-dom@1.0.0": | |
244, | |
"react-basic-dom@2.0.0": | |
332, | |
"react-basic-dom@2.0.1": | |
224, | |
"react-basic-dom@3.0.0": | |
225, | |
"react-basic-dom@3.1.0": | |
228, | |
"react-basic-dom@3.2.0": | |
244, | |
"react-basic-dom@3.3.0": | |
239, | |
"react-basic-dom@4.0.0": | |
160, | |
"react-basic-dom@4.0.1": | |
159, | |
"react-basic-dom@4.1.0": | |
265, | |
"react-basic-dom@4.2.0": | |
147, | |
"react-basic-dom@5.0.0": | |
102, | |
"react-basic-dom@5.0.1": | |
106, | |
"react-basic-dom@6.0.0": | |
111, | |
"react-basic-emotion@1.0.0": | |
424, | |
"react-basic-emotion@2.0.0": | |
418, | |
"react-basic-emotion@3.0.0": | |
500, | |
"react-basic-emotion@4.0.0": | |
396, | |
"react-basic-emotion@4.0.1": | |
399, | |
"react-basic-emotion@4.1.0": | |
426, | |
"react-basic-emotion@4.2.0": | |
411, | |
"react-basic-emotion@4.2.1": | |
532, | |
"react-basic-emotion@4.2.2": | |
390, | |
"react-basic-emotion@4.3.0": | |
392, | |
"react-basic-emotion@4.4.0": | |
406, | |
"react-basic-emotion@5.0.0": | |
412, | |
"react-basic-emotion@6.0.0": | |
172, | |
"react-basic-emotion@6.0.1": | |
175, | |
"react-basic-emotion@7.0.0": | |
200, | |
"react-basic-emotion@7.1.0": | |
108, | |
"react-basic-hooks@0.1.0": | |
354, | |
"react-basic-hooks@0.2.0": | |
369, | |
"react-basic-hooks@0.3.0": | |
364, | |
"react-basic-hooks@0.4.0": | |
497, | |
"react-basic-hooks@0.5.0": | |
392, | |
"react-basic-hooks@0.6.0": | |
384, | |
"react-basic-hooks@0.6.1": | |
411, | |
"react-basic-hooks@0.7.0": | |
403, | |
"react-basic-hooks@0.7.1": | |
538, | |
"react-basic-hooks@1.0.0": | |
407, | |
"react-basic-hooks@1.0.1": | |
513, | |
"react-basic-hooks@2.0.0": | |
380, | |
"react-basic-hooks@2.0.1": | |
658, | |
"react-basic-hooks@2.0.2": | |
379, | |
"react-basic-hooks@2.0.3": | |
512, | |
"react-basic-hooks@3.0.0": | |
386, | |
"react-basic-hooks@4.0.0": | |
613, | |
"react-basic-hooks@4.1.0": | |
395, | |
"react-basic-hooks@4.1.1": | |
616, | |
"react-basic-hooks@4.2.0": | |
733, | |
"react-basic-hooks@4.2.1": | |
604, | |
"react-basic-hooks@4.2.2": | |
587, | |
"react-basic-hooks@5.0.0": | |
624, | |
"react-basic-hooks@5.0.1": | |
626, | |
"react-basic-hooks@5.1.0": | |
790, | |
"react-basic-hooks@5.2.0": | |
605, | |
"react-basic-hooks@6.0.0": | |
298, | |
"react-basic-hooks@6.1.0": | |
307, | |
"react-basic-hooks@6.1.1": | |
325, | |
"react-basic-hooks@6.2.0": | |
318, | |
"react-basic-hooks@6.3.0": | |
319, | |
"react-basic-hooks@7.0.0": | |
265, | |
"react-basic-hooks@7.0.1": | |
132, | |
"react-basic-hooks@8.0.0": | |
102, | |
"react-basic-hooks@8.1.2": | |
107, | |
"react-basic-native@0.1.0": | |
423, | |
"react-basic-native@0.1.1": | |
390, | |
"react-basic-native@0.1.2": | |
389, | |
"react-basic-native@0.1.3": | |
510, | |
"react-basic-storybook@1.0.0": | |
45, | |
"react-basic-storybook@2.0.0": | |
108, | |
"react-basic-textf@0.1.0": | |
402, | |
"react-basic-textf@0.1.1": | |
423, | |
"react-basic-textf@0.2.0": | |
407, | |
"react-basic-textf@0.3.0": | |
508, | |
"react-dom@0.1.0": | |
98, | |
"react-dom@0.2.0": | |
93, | |
"react-dom@1.0.0": | |
59, | |
"react-dom@2.0.0": | |
414, | |
"react-dom@3.0.0": | |
425, | |
"react-dom@4.0.0": | |
676, | |
"react-dom@4.1.0": | |
650, | |
"react-dom@5.0.0": | |
757, | |
"react-dom@6.0.0": | |
246, | |
"react-dom@6.0.1": | |
244, | |
"react-dom@6.1.0": | |
262, | |
"react-dom@7.0.0": | |
140, | |
"react-dom@8.0.0": | |
120, | |
"react-enzyme@1.0.1": | |
402, | |
"react-enzyme@1.1.0": | |
268, | |
"react-enzyme@1.1.1": | |
265, | |
"react-event-listener@0.0.0": | |
217, | |
"react-explore@1.0.0": | |
311, | |
"react-explore@1.1.0": | |
307, | |
"react-explore@2.0.0": | |
154, | |
"react-explore@2.1.0": | |
261, | |
"react-halo@0.0.1": | |
294, | |
"react-halo@0.1.0": | |
281, | |
"react-halo@0.1.1": | |
278, | |
"react-halo@0.1.2": | |
296, | |
"react-halo@0.2.0": | |
297, | |
"react-halo@0.2.1": | |
293, | |
"react-halo@0.2.2": | |
293, | |
"react-halo@0.2.3": | |
400, | |
"react-halo@1.0.0": | |
242, | |
"react-halo@1.1.0": | |
239, | |
"react-halo@1.2.0": | |
265, | |
"react-halo@1.2.1": | |
269, | |
"react-halo@2.0.0": | |
178, | |
"react-halo@3.0.0": | |
252, | |
"react-hocs@0.0.1": | |
1155, | |
"react-hocs@0.1.0": | |
1119, | |
"react-hocs@0.2.0": | |
1133, | |
"react-hocs@0.3.0": | |
1031, | |
"react-hocs@0.3.1": | |
1145, | |
"react-hocs@0.4.0": | |
1007, | |
"react-hocs@0.5.0": | |
1005, | |
"react-hocs@0.5.1": | |
1028, | |
"react-hocs@0.6.0": | |
460, | |
"react-hocs@0.6.1": | |
739, | |
"react-hocs@0.6.2": | |
880, | |
"react-hocs@0.7.0": | |
722, | |
"react-hocs@0.7.1": | |
712, | |
"react-hocs@0.7.2": | |
732, | |
"react-hocs@0.8.0": | |
737, | |
"react-icons@1.0.0": | |
124, | |
"react-icons@1.0.1": | |
126, | |
"react-icons@1.0.2": | |
248, | |
"react-icons@1.0.3": | |
120, | |
"react-icons@1.0.4": | |
113, | |
"react-icons@1.0.5": | |
115, | |
"react-icons@1.0.6": | |
127, | |
"react-icons@1.0.7": | |
129, | |
"react-icons@1.0.8": | |
131, | |
"react-ix@0.1.1": | |
765, | |
"react-ix@0.1.2": | |
862, | |
"react-ix@0.2.0": | |
526, | |
"react-ix@0.3.0": | |
525, | |
"react-ix@0.3.1": | |
548, | |
"react-ix@0.4.0": | |
546, | |
"react-ix@0.5.0": | |
551, | |
"react-ix@0.5.1": | |
667, | |
"react-ix@0.5.2": | |
538, | |
"react-ix@0.5.3": | |
590, | |
"react-keybind@0.8.1": | |
259, | |
"react-keybind@0.9.4": | |
6651, | |
"react-material-ui@0.1.0": | |
743, | |
"react-material-ui@1.0.0": | |
637, | |
"react-mui@3.1.0": | |
451, | |
"react-mui@3.6.0": | |
459, | |
"react-mui@3.9.2": | |
453, | |
"react-mui@3.9.3": | |
455, | |
"react-mui@3.9.313": | |
-420, | |
"react-queue@0.0.0": | |
901, | |
"react-queue@0.0.1": | |
800, | |
"react-queue@0.0.2": | |
700, | |
"react-queue@0.0.3": | |
555, | |
"react-queue@0.0.4": | |
569, | |
"react-queue@0.0.5": | |
564, | |
"react-queue@0.0.6": | |
558, | |
"react-queue@0.0.7": | |
566, | |
"react-queue@0.0.8": | |
704, | |
"react-queue@0.1.0": | |
542, | |
"react-queue@1.0.0": | |
372, | |
"react-queue@1.0.1": | |
370, | |
"react-queue@1.0.2": | |
440, | |
"react-queue@1.1.0": | |
399, | |
"react-queue@1.2.0": | |
404, | |
"react-queue@1.2.1": | |
564, | |
"react-queue@1.3.0": | |
386, | |
"react-queue@1.3.1": | |
311, | |
"react-queue@1.3.2": | |
312, | |
"react-radox@0.0.1": | |
129, | |
"react-radox@0.0.2": | |
129, | |
"react-radox@0.0.3": | |
129, | |
"react-radox@0.0.4": | |
224, | |
"react-radox@0.0.5": | |
129, | |
"react-redox@0.1.1": | |
1259, | |
"react-redox@0.2.0": | |
1250, | |
"react-redox@0.2.1": | |
1250, | |
"react-redox@0.3.0": | |
1254, | |
"react-redox@0.4.0": | |
1421, | |
"react-redox@0.5.0": | |
1231, | |
"react-redox@0.5.1": | |
1289, | |
"react-redox@0.5.2": | |
1284, | |
"react-redox@0.5.3": | |
1306, | |
"react-redox@0.5.4": | |
1293, | |
"react-redox@0.6.0": | |
1408, | |
"react-redox@0.7.1": | |
1271, | |
"react-redox@0.8.0": | |
1197, | |
"react-redox@0.8.1": | |
1198, | |
"react-redox@0.9.0": | |
1115, | |
"react-redox@0.9.1": | |
1240, | |
"react-redox@0.9.2": | |
784, | |
"react-redox@0.9.3": | |
789, | |
"react-redox@0.10.0": | |
776, | |
"react-redox@0.10.1": | |
811, | |
"react-redox@0.10.2": | |
950, | |
"react-redox@1.0.0": | |
790, | |
"react-redox@2.0.0": | |
834, | |
"react-redox@2.0.1": | |
836, | |
"react-redox@3.2.0": | |
822, | |
"react-redux@0.1.0": | |
-108, | |
"react-redux@1.0.0": | |
183, | |
"react-redux@2.0.0": | |
381, | |
"react-redux@3.0.0": | |
340, | |
"react-redux@4.0.0": | |
341, | |
"react-redux@5.0.0": | |
502, | |
"react-redux@5.1.0": | |
503, | |
"react-redux@6.1.0": | |
145, | |
"react-router@0.1.0": | |
-359, | |
"react-router@0.1.1": | |
-259, | |
"react-router@0.2.0": | |
-266, | |
"react-router@0.2.1": | |
-275, | |
"react-router@0.2.2": | |
-269, | |
"react-router@1.0.0": | |
-273, | |
"react-select-basic@0.1.0": | |
340, | |
"react-select-basic@0.2.0": | |
255, | |
"react-select-basic@1.0.0": | |
497, | |
"react-simple@0.0.2": | |
41, | |
"react-simple@0.0.3": | |
66, | |
"react-simple@0.0.4": | |
68, | |
"react-simple@0.0.5": | |
68, | |
"react-simple@0.0.6": | |
66, | |
"react-simple@0.1.0": | |
68, | |
"react-simple@0.1.1": | |
116, | |
"react-simple@0.1.2": | |
47, | |
"react-spaces@0.1.0": | |
376, | |
"react-spaces@0.2.0": | |
315, | |
"react-spaces@0.3.0": | |
315, | |
"react-spaces@0.4.0": | |
307, | |
"react-spaces@0.4.1": | |
426, | |
"react-spaces@0.4.2": | |
298, | |
"react-spaces@0.4.3": | |
308, | |
"react-spaces@0.4.4": | |
311, | |
"react-spaces@0.4.5": | |
308, | |
"react-spaces@0.4.6": | |
310, | |
"react-spaces@0.5.0": | |
440, | |
"react-spaces@1.0.0": | |
298, | |
"react-spaces@1.0.1": | |
311, | |
"react-stylesheet@0.0.2": | |
474, | |
"react-testing-library@0.1.0": | |
318, | |
"react-testing-library@1.0.0": | |
315, | |
"react-testing-library@2.0.0": | |
318, | |
"react-testing-library@3.0.0": | |
305, | |
"react-testing-library@3.1.0": | |
208, | |
"react-testing-library@3.1.4": | |
218, | |
"react-testing-library@4.0.1": | |
140, | |
"react-transition-group@0.1.0": | |
67, | |
"react-transition-group@0.1.1": | |
198, | |
"react-transition-group-2@0.0.0": | |
392, | |
"react-virtuoso@1.0.0": | |
133, | |
"reactnative@1.0.0": | |
311, | |
"reactnative@2.39.0": | |
164, | |
"reactnative@2.42.0": | |
171, | |
"reactnative@3.0.0": | |
345, | |
"reactnative@3.0.1": | |
340, | |
"reactnative@4.0.0": | |
338, | |
"reactnative@4.0.1": | |
340, | |
"reactnative@5.0.0": | |
294, | |
"reactnative@5.0.1": | |
175, | |
"reactnative@6.0.0": | |
104, | |
"reactnative@6.0.1": | |
108, | |
"reactnative@6.0.2": | |
110, | |
"reactnative@6.0.3": | |
107, | |
"read@1.0.0": | |
146, | |
"read@1.0.1": | |
126, | |
"read-generic@1.0.0": | |
197, | |
"read-generic@1.0.1": | |
111, | |
"read-generic@1.0.2": | |
113, | |
"read-generic@1.0.3": | |
123, | |
"read-generic@1.0.4": | |
122, | |
"read-generic@1.0.5": | |
122, | |
"read-generic@1.0.6": | |
121, | |
"read-generic@1.0.7": | |
125, | |
"recompose@1.0.0": | |
94, | |
"recompose@1.0.1": | |
105, | |
"recompose@1.1.0": | |
47, | |
"record@0.1.0": | |
81, | |
"record@0.2.0": | |
71, | |
"record@0.2.1": | |
72, | |
"record@0.2.2": | |
75, | |
"record@0.2.3": | |
73, | |
"record@0.2.4": | |
72, | |
"record@0.2.5": | |
144, | |
"record@0.2.6": | |
78, | |
"record@1.0.0": | |
93, | |
"record@2.0.0": | |
87, | |
"record@2.0.1": | |
128, | |
"record@2.0.2": | |
121, | |
"record@3.0.0": | |
68, | |
"record@4.0.0": | |
137, | |
"record-extra@0.1.0": | |
111, | |
"record-extra@0.2.0": | |
114, | |
"record-extra@0.3.0": | |
113, | |
"record-extra@0.4.0": | |
91, | |
"record-extra@1.0.0": | |
96, | |
"record-extra@2.0.0": | |
95, | |
"record-extra@2.0.1": | |
93, | |
"record-extra@2.0.2": | |
216, | |
"record-extra@2.0.3": | |
96, | |
"record-extra@3.0.0": | |
95, | |
"record-extra@3.0.1": | |
98, | |
"record-extra@4.0.0": | |
91, | |
"record-extra@5.0.0": | |
88, | |
"record-extra@5.0.1": | |
99, | |
"record-extra-srghma@0.1.0": | |
101, | |
"record-fold@0.1.0": | |
209, | |
"record-fold@0.3.0": | |
89, | |
"record-fold@0.4.0": | |
100, | |
"record-format@0.0.1": | |
116, | |
"record-format@0.1.0": | |
110, | |
"record-format@1.0.0": | |
111, | |
"record-format@2.0.0": | |
110, | |
"record-format@3.0.0": | |
97, | |
"record-prefix@0.1.0": | |
245, | |
"record-prefix@0.2.0": | |
125, | |
"record-prefix@0.2.1": | |
135, | |
"record-prefix@0.3.0": | |
137, | |
"record-prefix@1.0.0": | |
139, | |
"record-prefix@2.0.0": | |
210, | |
"record-show@0.1.0": | |
105, | |
"record-show@0.1.1": | |
186, | |
"record-show@0.2.0": | |
93, | |
"record-show@0.2.1": | |
108, | |
"record-show@0.3.0": | |
111, | |
"record-show@0.3.1": | |
111, | |
"record-show@0.4.0": | |
110, | |
"record-studio@0.1.0": | |
343, | |
"record-studio@0.2.1": | |
73, | |
"record-studio@1.0.0": | |
76, | |
"record-studio@1.0.1": | |
85, | |
"record-studio@1.0.2": | |
91, | |
"record-studio@1.0.3": | |
85, | |
"record-studio@1.0.4": | |
83, | |
"records@0.0.1": | |
56, | |
"records@0.0.2": | |
153, | |
"records@0.0.3": | |
58, | |
"records@1.0.0": | |
62, | |
"redis@0.0.1": | |
-260, | |
"redis@0.0.2": | |
-218, | |
"redis@0.0.3": | |
-207, | |
"redis-client@0.2.0": | |
554, | |
"redis-client@0.3.0": | |
526, | |
"redis-client@0.3.1": | |
637, | |
"redis-client@0.3.2": | |
504, | |
"redis-client@0.3.3": | |
516, | |
"redis-client@0.4.0": | |
513, | |
"redis-client@0.4.1": | |
515, | |
"redis-client@0.5.0": | |
515, | |
"redis-client@1.0.0": | |
354, | |
"redis-client@1.0.1": | |
325, | |
"redis-hotqueue@0.1.0": | |
623, | |
"redis-hotqueue@0.2.0": | |
602, | |
"redis-hotqueue@0.2.1": | |
502, | |
"redox@1.0.0": | |
252, | |
"redox@1.0.1": | |
361, | |
"redox@1.0.2": | |
241, | |
"redox@2.0.0": | |
299, | |
"redox@2.1.0": | |
301, | |
"redox@3.0.0": | |
299, | |
"redox@3.1.0": | |
299, | |
"redox@3.2.0": | |
434, | |
"redox@4.0.0": | |
292, | |
"redox@5.0.0": | |
304, | |
"redox@5.1.0": | |
326, | |
"redox@5.1.1": | |
326, | |
"redox@6.0.0": | |
330, | |
"redox@6.0.1": | |
335, | |
"redox@6.0.2": | |
458, | |
"redox@6.0.3": | |
315, | |
"redox@6.1.0": | |
298, | |
"redox@6.2.0": | |
308, | |
"redox@7.0.0": | |
479, | |
"redox@7.0.1": | |
482, | |
"redox@7.1.0": | |
587, | |
"redox@7.2.0": | |
459, | |
"redox@7.2.1": | |
470, | |
"redox@7.3.0": | |
477, | |
"redox@8.0.0": | |
196, | |
"redux@0.1.0": | |
-81, | |
"redux@0.1.1": | |
-84, | |
"redux@0.1.2": | |
81, | |
"redux@0.1.3": | |
192, | |
"redux@0.1.4": | |
80, | |
"redux@0.1.5": | |
74, | |
"redux@0.1.6": | |
179, | |
"redux@0.1.7": | |
169, | |
"redux-devtools@0.1.0": | |
191, | |
"redux-saga@0.1.0": | |
736, | |
"redux-utils@0.1.0": | |
191, | |
"redux-utils@0.2.0": | |
80, | |
"redux-utils@0.3.0": | |
88, | |
"refined@0.1.1": | |
457, | |
"refined@0.1.2": | |
440, | |
"refined@0.2.0": | |
338, | |
"refined@1.0.0": | |
425, | |
"reflection@1.0.1": | |
55, | |
"reflection@2.0.0": | |
65, | |
"reflection@3.0.0": | |
71, | |
"reflection@3.1.0": | |
74, | |
"reflection@4.0.0": | |
73, | |
"refract@0.0.2": | |
467, | |
"refract@0.0.3": | |
445, | |
"refractor@0.1.1": | |
-149, | |
"refractor@0.2.0": | |
92, | |
"refractor@0.3.0": | |
80, | |
"refractor@0.4.0": | |
82, | |
"refractor-coproduct@0.1.0": | |
82, | |
"refs@0.1.0": | |
60, | |
"refs@0.1.1": | |
76, | |
"refs@0.1.2": | |
69, | |
"refs@0.1.3": | |
126, | |
"refs@0.2.0": | |
46, | |
"refs@1.0.0": | |
71, | |
"refs@2.0.0": | |
70, | |
"refs@3.0.0": | |
74, | |
"refs@4.0.0": | |
70, | |
"refs@4.1.0": | |
121, | |
"refs@5.0.0": | |
51, | |
"refs@6.0.0": | |
66, | |
"refty@0.1.0": | |
405, | |
"refty@0.2.0": | |
351, | |
"refty@0.3.0": | |
354, | |
"refty@0.3.1": | |
389, | |
"refty@0.4.0": | |
219, | |
"refty@1.0.0": | |
253, | |
"refty@1.1.0": | |
261, | |
"refty@1.2.0": | |
257, | |
"rehtie@0.1.0": | |
74, | |
"rehtie@1.0.0": | |
71, | |
"remotecallback@2.0.1": | |
-223, | |
"remotedata@1.0.0": | |
-405, | |
"remotedata@1.0.1": | |
-263, | |
"remotedata@1.1.0": | |
-222, | |
"remotedata@2.0.0": | |
-209, | |
"remotedata@2.1.0": | |
433, | |
"remotedata@2.1.1": | |
565, | |
"remotedata@2.2.0": | |
429, | |
"remotedata@3.0.0": | |
587, | |
"remotedata@4.0.0": | |
188, | |
"remotedata@4.1.0": | |
283, | |
"remotedata@4.2.0": | |
219, | |
"remotedata@5.0.0": | |
110, | |
"repr@0.2.0": | |
138, | |
"repr@0.3.0": | |
179, | |
"repr@0.3.1": | |
110, | |
"requestanimationframe@0.0.1": | |
44, | |
"requestanimationframe@0.0.2": | |
73, | |
"requestanimationframe@0.0.3": | |
66, | |
"requestanimationframe@1.0.0": | |
129, | |
"requests@0.0.1": | |
-300, | |
"requests@0.0.2": | |
-371, | |
"requests@0.0.3": | |
-488, | |
"requests@0.0.4": | |
421, | |
"resource@1.0.0": | |
299, | |
"resource@2.0.0": | |
251, | |
"resource@2.0.1": | |
125, | |
"resourcet@0.1.0": | |
184, | |
"resourcet@1.0.0": | |
123, | |
"rest@0.1.0": | |
-228, | |
"restify@0.0.1": | |
507, | |
"restify-router@0.0.1": | |
732, | |
"restify-router@0.0.2": | |
735, | |
"result@0.1.0": | |
73, | |
"result@1.0.0": | |
71, | |
"result@1.0.1": | |
74, | |
"result@1.0.2": | |
76, | |
"result@1.0.3": | |
161, | |
"return@0.1.0": | |
211, | |
"return@0.1.1": | |
-119, | |
"return@0.1.2": | |
-78, | |
"return@0.1.3": | |
-76, | |
"return@0.1.4": | |
-76, | |
"return@0.2.0": | |
-71, | |
"ring-modules@2.1.0": | |
135, | |
"ring-modules@2.2.0": | |
48, | |
"ring-modules@3.0.0": | |
68, | |
"ring-modules@4.0.0": | |
68, | |
"ring-modules@5.0.0": | |
68, | |
"ring-modules@5.0.1": | |
67, | |
"rito@0.0.0": | |
-322, | |
"rito@0.0.2": | |
-388, | |
"rito@0.0.3": | |
-172, | |
"rito@0.1.0": | |
-181, | |
"rito@0.3.2": | |
-181, | |
"rmrk-parser@0.2.0": | |
188, | |
"rmrk-parser@0.2.1": | |
183, | |
"rmrk-parser@0.2.2": | |
292, | |
"rmrk-parser@0.2.3": | |
169, | |
"rmrk-parser@0.2.4": | |
183, | |
"rmrk-parser@0.2.5": | |
185, | |
"rmrk-parser@0.2.6": | |
185, | |
"rmrk-parser@0.2.7": | |
181, | |
"rmrk-parser@0.2.8": | |
187, | |
"rmrk-parser@0.2.10": | |
295, | |
"rmrk-parser@0.2.13": | |
169, | |
"roman@0.2.0": | |
229, | |
"roman@0.2.1": | |
125, | |
"rotjs@0.0.1": | |
81, | |
"rout@1.0.0": | |
141, | |
"rout@2.0.0": | |
325, | |
"rout@2.1.0": | |
208, | |
"rout@2.1.1": | |
332, | |
"rout@2.2.0": | |
180, | |
"rout@3.0.0": | |
131, | |
"routing@0.1.0": | |
86, | |
"routing@0.2.0": | |
117, | |
"routing@0.2.1": | |
119, | |
"routing@0.3.0": | |
115, | |
"routing@0.4.0": | |
193, | |
"routing@1.0.0": | |
70, | |
"routing@2.0.0": | |
-191, | |
"routing@3.0.0": | |
-369, | |
"routing@3.1.0": | |
-363, | |
"routing@4.0.0": | |
-363, | |
"routing@5.0.0": | |
454, | |
"routing@5.1.0": | |
454, | |
"routing@6.0.0": | |
565, | |
"routing@6.1.0": | |
452, | |
"routing@6.1.1": | |
457, | |
"routing@6.1.2": | |
455, | |
"routing@7.0.0": | |
449, | |
"routing@7.1.0": | |
488, | |
"routing@8.0.0": | |
259, | |
"routing@9.0.0": | |
279, | |
"routing@9.0.1": | |
282, | |
"routing@10.0.0": | |
137, | |
"routing@10.0.1": | |
136, | |
"routing@11.0.0": | |
109, | |
"routing-bob@0.0.1": | |
91, | |
"routing-bob@0.0.2": | |
167, | |
"routing-bob@0.0.3": | |
79, | |
"routing-bob@0.0.4": | |
90, | |
"routing-bob@0.0.5": | |
90, | |
"routing-bob@0.0.6": | |
88, | |
"routing-bob@0.0.7": | |
200, | |
"routing-bob@0.0.8": | |
80, | |
"routing-bob@0.0.9": | |
68, | |
"routing-bob@0.1.0": | |
77, | |
"routing-bob@0.1.1": | |
81, | |
"routing-bob@0.2.0": | |
-581, | |
"routing-bob@0.4.0": | |
248, | |
"routing-bob@0.4.1": | |
-526, | |
"routing-bob@0.4.2": | |
-404, | |
"routing-bob@0.5.0": | |
477, | |
"routing-bob@0.5.1": | |
472, | |
"routing-bob@0.6.0": | |
458, | |
"routing-bob@0.6.1": | |
458, | |
"routing-duplex@0.1.0": | |
121, | |
"routing-duplex@0.2.0": | |
212, | |
"routing-duplex@0.3.0": | |
118, | |
"routing-duplex@0.4.0": | |
112, | |
"routing-duplex@0.4.1": | |
125, | |
"routing-duplex@0.5.0": | |
91, | |
"routing-duplex@0.5.1": | |
91, | |
"routing-duplex@0.6.0": | |
87, | |
"routing-duplex@0.7.0": | |
95, | |
"row-extra@0.0.0": | |
80, | |
"row-extra@0.0.1": | |
116, | |
"rrb-list@0.0.1": | |
88, | |
"run@0.1.0": | |
373, | |
"run@0.2.0": | |
362, | |
"run@0.3.0": | |
349, | |
"run@0.4.0": | |
473, | |
"run@1.0.0": | |
344, | |
"run@1.0.1": | |
443, | |
"run@1.1.0": | |
330, | |
"run@2.0.0": | |
177, | |
"run@3.0.0": | |
209, | |
"run@3.0.1": | |
193, | |
"run@4.0.0": | |
118, | |
"run@5.0.0": | |
99, | |
"run-console-experiment@1.0.0": | |
492, | |
"run-console-experiment@1.0.1": | |
615, | |
"run-console-experiment@1.0.2": | |
478, | |
"run-console-experiment@1.0.3": | |
488, | |
"run-console-experiment@1.1.0": | |
488, | |
"run-console-experiment@1.1.1": | |
484, | |
"run-console-experiment@1.1.2": | |
485, | |
"run-console-experiment@2.0.0": | |
567, | |
"run-console-experiment@2.0.1": | |
439, | |
"run-external-state@1.0.0": | |
131, | |
"run-halogen@0.1.0": | |
385, | |
"run-profunctor-lenses@0.1.0": | |
260, | |
"run-streaming@0.1.0": | |
491, | |
"run-streaming@1.0.0": | |
453, | |
"run-streaming@2.0.0": | |
246, | |
"run-supply@1.0.0": | |
341, | |
"rwse-free@0.1.0": | |
86, | |
"rwse-free@0.1.1": | |
101, | |
"rwse-free@1.0.0": | |
322, | |
"rwse-free@2.0.0": | |
322, | |
"rwse-free@2.1.0": | |
344, | |
"rwse-free@3.0.0": | |
456, | |
"rwse-free@3.1.0": | |
433, | |
"rwse-free@3.1.1": | |
450, | |
"rwse-free@4.0.0": | |
465, | |
"rwse-free@4.1.0": | |
458, | |
"rwse-free@5.0.0": | |
336, | |
"rx@0.1.0": | |
-49, | |
"rx@0.2.0": | |
-56, | |
"rx@0.3.0": | |
-78, | |
"rx@0.4.0": | |
78, | |
"rx@0.5.0": | |
84, | |
"rx@0.6.0": | |
80, | |
"rx@0.7.0": | |
95, | |
"rx@0.7.1": | |
167, | |
"rx@0.8.0": | |
70, | |
"rx@0.8.1": | |
63, | |
"rx@0.8.2": | |
82, | |
"rx@0.9.0": | |
72, | |
"rx@0.9.1": | |
72, | |
"rx@1.0.0": | |
155, | |
"rx@2.0.0": | |
459, | |
"rx-state@0.1.0": | |
138, | |
"rx-state@0.1.1": | |
61, | |
"rx-state@0.2.0": | |
77, | |
"rxjs@0.1.0": | |
-324, | |
"rxjs@0.1.1": | |
-290, | |
"rxjs@0.2.0": | |
-296, | |
"rxjs@0.3.0": | |
589, | |
"rxjs@0.3.1": | |
583, | |
"rxps@1.0.0": | |
682, | |
"rxps@1.1.0": | |
555, | |
"rxps@1.1.1": | |
567, | |
"rxps@1.1.3": | |
574, | |
"rxps@1.1.4": | |
574, | |
"rxps@1.2.0": | |
716, | |
"rxps@1.3.0": | |
556, | |
"rxps@1.4.0": | |
568, | |
"rxps@1.4.1": | |
567, | |
"rxps@1.4.2": | |
578, | |
"rxps@1.4.3": | |
574, | |
"rxps@1.5.0": | |
578, | |
"rxps@1.6.0": | |
716, | |
"rxps@1.7.0": | |
553, | |
"rxps@1.8.0": | |
137, | |
"safe-coerce@0.0.1": | |
54, | |
"safe-coerce@0.0.2": | |
75, | |
"safe-coerce@1.0.0": | |
63, | |
"safe-coerce@2.0.0": | |
68, | |
"safe-printf@1.0.0": | |
117, | |
"safelist@1.0.0": | |
306, | |
"safelist@1.1.0": | |
280, | |
"safelist@2.0.0": | |
85, | |
"safelist@3.0.0": | |
89, | |
"safely@1.0.1": | |
73, | |
"safely@2.0.0": | |
302, | |
"safely@3.0.0": | |
193, | |
"safely@4.0.0": | |
99, | |
"safely@4.0.1": | |
215, | |
"sammy@0.1.0": | |
82, | |
"sammy@1.0.0": | |
64, | |
"sammy@2.0.0": | |
68, | |
"sammy@3.0.0": | |
128, | |
"scannable@0.1.0": | |
54, | |
"school-of-music@1.1.1": | |
93, | |
"school-of-music@1.2.0": | |
467, | |
"school-of-music@1.2.1": | |
413, | |
"school-of-music@1.2.2": | |
476, | |
"school-of-music@1.2.3": | |
352, | |
"school-of-music@1.2.4": | |
338, | |
"school-of-music@1.3.0": | |
106, | |
"screenfull@0.1.0": | |
373, | |
"screeps-classy@0.2.0": | |
226, | |
"screeps-classy@0.2.1": | |
227, | |
"screeps-classy@1.1.0": | |
228, | |
"screeps-classy@2.0.0": | |
332, | |
"screeps-classy@2.1.0": | |
216, | |
"screeps-classy@2.2.0": | |
224, | |
"screeps-classy@2.3.0": | |
227, | |
"screeps-classy@3.0.0": | |
333, | |
"screeps-classy@3.0.1": | |
363, | |
"scrypt@0.0.0": | |
563, | |
"scrypt@0.0.1": | |
423, | |
"scrypt@1.0.0": | |
244, | |
"scrypt@1.0.1": | |
306, | |
"sdom@0.1.0": | |
509, | |
"sdom@0.1.1": | |
504, | |
"sdom@0.1.2": | |
513, | |
"sdom@0.1.3": | |
678, | |
"sdom@0.1.4": | |
494, | |
"sdom@1.0.0": | |
275, | |
"search@0.1.0": | |
99, | |
"search@0.2.0": | |
-84, | |
"search@0.3.0": | |
91, | |
"search@0.4.0": | |
93, | |
"search@0.5.0": | |
96, | |
"search@0.6.0": | |
191, | |
"search@0.7.0": | |
92, | |
"search@0.7.1": | |
93, | |
"search@0.7.2": | |
97, | |
"search@1.0.0": | |
81, | |
"search@2.0.0": | |
346, | |
"search@3.0.0": | |
453, | |
"search-trie@1.0.0": | |
119, | |
"sec@0.1.0": | |
54, | |
"sec@0.1.1": | |
81, | |
"selda@0.1.0": | |
533, | |
"selection-foldable@0.1.0": | |
160, | |
"selection-foldable@0.1.1": | |
161, | |
"selection-foldable@0.1.2": | |
163, | |
"selection-foldable@0.1.3": | |
279, | |
"selection-foldable@0.2.0": | |
153, | |
"selective@0.1.0": | |
58, | |
"selective@0.1.1": | |
108, | |
"semigroups@0.0.1": | |
60, | |
"semigroups@0.0.2": | |
72, | |
"semigroups@0.0.4": | |
59, | |
"semirings@0.2.0": | |
204, | |
"semirings@1.0.0": | |
70, | |
"semirings@2.0.0": | |
112, | |
"semirings@3.0.0": | |
169, | |
"semirings@4.0.0": | |
180, | |
"semirings@5.0.0": | |
86, | |
"semirings@6.0.0": | |
84, | |
"semirings@7.0.0": | |
77, | |
"sentry-raven@0.1.0": | |
763, | |
"sentry-raven@0.1.1": | |
597, | |
"sentry-raven@0.1.2": | |
614, | |
"sentry-raven@0.2.0": | |
462, | |
"sequences@0.0.2": | |
73, | |
"sequences@0.1.0": | |
73, | |
"sequences@0.2.0": | |
155, | |
"sequences@0.2.1": | |
71, | |
"sequences@0.3.0": | |
53, | |
"sequences@0.3.1": | |
81, | |
"sequences@0.4.0": | |
71, | |
"sequences@0.4.1": | |
73, | |
"sequences@0.4.2": | |
73, | |
"sequences@0.4.3": | |
76, | |
"sequences@0.5.0": | |
154, | |
"sequences@0.6.0": | |
100, | |
"sequences@1.0.0": | |
62, | |
"sequences@1.0.1": | |
94, | |
"sequences@1.0.2": | |
84, | |
"sequences@1.0.3": | |
115, | |
"sequences@2.0.0": | |
93, | |
"sequences@2.1.0": | |
90, | |
"sequences@3.0.0": | |
172, | |
"sequences@3.0.2": | |
93, | |
"servant-support@1.0.3": | |
77, | |
"servant-support@1.0.4": | |
93, | |
"servant-support@2.0.0": | |
94, | |
"servant-support@2.0.1": | |
95, | |
"servant-support@3.0.0": | |
91, | |
"servant-support@3.0.1": | |
90, | |
"servant-support@4.0.0": | |
177, | |
"servant-support@5.0.0": | |
80, | |
"servant-support@5.0.1": | |
402, | |
"servant-support@6.0.0": | |
-423, | |
"servant-support@7.0.0": | |
-411, | |
"servant-support@8.0.0": | |
1017, | |
"servant-support@9.0.1": | |
735, | |
"servant-support-012@1.0.3": | |
179, | |
"servant-support-012@1.0.4": | |
81, | |
"servant-support-012@2.0.0": | |
75, | |
"servant-support-012@2.0.1": | |
91, | |
"servant-support-012@3.0.0": | |
95, | |
"servant-support-012@3.0.1": | |
95, | |
"servant-support-012@4.0.0": | |
91, | |
"servant-support-012@5.0.0": | |
92, | |
"servant-support-012@5.0.1": | |
508, | |
"servant-support-012@6.0.0": | |
-404, | |
"servant-support-012@7.0.0": | |
-399, | |
"servant-support-012@8.0.0": | |
761, | |
"servant-support-012@9.0.1": | |
729, | |
"server-sent-events@0.1.0": | |
613, | |
"server-sent-events@0.2.0": | |
198, | |
"server-sent-events@0.3.0": | |
237, | |
"server-sent-events@0.3.1": | |
111, | |
"setimmediate@0.0.0": | |
49, | |
"setimmediate@1.0.0": | |
71, | |
"setimmediate@1.0.1": | |
68, | |
"setimmediate@1.0.2": | |
68, | |
"sets@0.1.0": | |
-72, | |
"sets@0.1.1": | |
-75, | |
"sets@0.1.2": | |
-154, | |
"sets@0.2.0": | |
85, | |
"sets@0.3.0": | |
75, | |
"sets@0.3.1": | |
92, | |
"sets@0.3.2": | |
80, | |
"sets@0.4.0": | |
82, | |
"sets@0.4.1": | |
89, | |
"sets@0.4.2": | |
92, | |
"sets@0.5.0": | |
193, | |
"sets@0.5.1": | |
78, | |
"sets@0.5.2": | |
77, | |
"sets@0.5.3": | |
85, | |
"sets@0.5.4": | |
87, | |
"sets@0.5.5": | |
95, | |
"sets@0.5.6": | |
84, | |
"sets@0.5.7": | |
169, | |
"sets@1.0.0": | |
80, | |
"sets@2.0.0": | |
170, | |
"sets@2.0.1": | |
202, | |
"sets@3.0.0": | |
221, | |
"sets@3.1.0": | |
326, | |
"sets@3.2.0": | |
326, | |
"sets@3.2.1": | |
327, | |
"sexp@0.0.1": | |
162, | |
"sexp@0.1.0": | |
80, | |
"sexp@0.2.0": | |
67, | |
"sexp@0.2.1": | |
79, | |
"sexp@0.2.2": | |
75, | |
"sexp@1.0.0": | |
217, | |
"sexp@2.0.0": | |
206, | |
"sforce-remote-action@0.0.0": | |
512, | |
"sforce-remote-action@1.0.0": | |
446, | |
"sforce-remote-action@1.0.1": | |
362, | |
"shoronpo@0.1.0": | |
155, | |
"shoronpo@0.2.0": | |
150, | |
"shoronpo@0.3.0": | |
152, | |
"shoronpo@1.0.0": | |
103, | |
"shortid@0.0.1": | |
63, | |
"shortid@0.0.2": | |
127, | |
"shortid@0.0.3": | |
60, | |
"showdown@0.0.1": | |
52, | |
"signal@1.0.0": | |
71, | |
"signal@1.0.1": | |
61, | |
"signal@1.0.2": | |
71, | |
"signal@1.1.0": | |
94, | |
"signal@1.2.0": | |
80, | |
"signal@2.0.0": | |
145, | |
"signal@2.0.1": | |
58, | |
"signal@2.0.2": | |
51, | |
"signal@2.1.0": | |
70, | |
"signal@2.2.0": | |
65, | |
"signal@2.2.2": | |
63, | |
"signal@3.0.0": | |
72, | |
"signal@4.0.0": | |
73, | |
"signal@4.1.0": | |
133, | |
"signal@4.1.1": | |
90, | |
"signal@4.2.0": | |
100, | |
"signal@5.0.0": | |
100, | |
"signal@5.0.1": | |
100, | |
"signal@5.1.0": | |
92, | |
"signal@5.2.0": | |
85, | |
"signal@6.0.0": | |
79, | |
"signal@6.1.0": | |
179, | |
"signal@7.0.0": | |
-206, | |
"signal@8.0.0": | |
-244, | |
"signal@8.0.1": | |
-340, | |
"signal@8.1.0": | |
458, | |
"signal@9.0.0": | |
421, | |
"signal@10.0.0": | |
302, | |
"signal@10.1.0": | |
196, | |
"signal@11.0.0": | |
285, | |
"signal@11.0.1": | |
299, | |
"signal@11.0.2": | |
299, | |
"signal@11.0.3": | |
202, | |
"signal@12.0.1": | |
110, | |
"signal@13.0.0": | |
96, | |
"signal-aff@0.0.1": | |
-545, | |
"signal-loop@1.0.1": | |
60, | |
"signal-loop@2.0.0": | |
431, | |
"signal-socket@1.0.0": | |
-77, | |
"signal-socket@1.1.0": | |
83, | |
"signal-socket@2.0.0": | |
76, | |
"signal-socket@3.0.0": | |
533, | |
"signal-time-travel@1.0.0": | |
-382, | |
"signal-time-travel@1.1.0": | |
-325, | |
"signature-pad@0.1.0": | |
79, | |
"signature-pad@0.2.0": | |
91, | |
"signature-pad@0.3.0": | |
-321, | |
"signature-pad@0.4.0": | |
-215, | |
"signature-pad@1.0.0": | |
500, | |
"signature-pad-halogen@0.1.0": | |
-267, | |
"signature-pad-halogen@0.2.0": | |
-265, | |
"signature-pad-halogen@0.3.0": | |
-275, | |
"signature-pad-halogen@1.0.0": | |
-738, | |
"signature-pad-halogen@1.0.1": | |
-853, | |
"signature-pad-halogen@2.0.0": | |
-691, | |
"sijidou@0.1.0": | |
74, | |
"sijidou@1.0.0": | |
88, | |
"simple-ajax@0.1.0": | |
475, | |
"simple-ajax@0.2.0": | |
480, | |
"simple-ajax@0.3.0": | |
475, | |
"simple-ajax@0.4.0": | |
566, | |
"simple-ajax@0.4.1": | |
463, | |
"simple-ajax@0.5.0": | |
452, | |
"simple-ajax@1.0.0": | |
551, | |
"simple-ajax@2.0.0": | |
433, | |
"simple-ajax@3.0.0": | |
434, | |
"simple-ajax@4.0.0": | |
188, | |
"simple-assert@0.1.0": | |
56, | |
"simple-assert@0.2.0": | |
79, | |
"simple-assert@0.2.1": | |
73, | |
"simple-assert@0.3.0": | |
137, | |
"simple-child-process@0.1.0": | |
439, | |
"simple-csv@0.1.0": | |
132, | |
"simple-csv@0.2.0": | |
137, | |
"simple-datetime@0.1.0": | |
368, | |
"simple-datetime@0.1.1": | |
368, | |
"simple-dom@0.0.2": | |
164, | |
"simple-dom@0.0.3": | |
91, | |
"simple-dom@0.0.4": | |
63, | |
"simple-dom@0.1.0": | |
93, | |
"simple-dom@0.1.1": | |
104, | |
"simple-dom@0.1.2": | |
102, | |
"simple-dom@0.1.3": | |
127, | |
"simple-emitter@0.1.0": | |
212, | |
"simple-emitter@0.1.1": | |
305, | |
"simple-emitter@0.1.2": | |
195, | |
"simple-emitter@0.2.0": | |
194, | |
"simple-emitter@1.0.0": | |
125, | |
"simple-emitter@2.0.0": | |
100, | |
"simple-emitter@3.0.0": | |
86, | |
"simple-emitter@3.0.1": | |
82, | |
"simple-i18n@0.1.0": | |
111, | |
"simple-i18n@0.1.1": | |
253, | |
"simple-i18n@0.1.2": | |
111, | |
"simple-i18n@1.0.0": | |
84, | |
"simple-i18n@2.0.0": | |
91, | |
"simple-i18n@2.0.1": | |
85, | |
"simple-json@0.1.0": | |
378, | |
"simple-json@0.2.0": | |
368, | |
"simple-json@0.3.0": | |
372, | |
"simple-json@0.4.0": | |
495, | |
"simple-json@0.5.0": | |
350, | |
"simple-json@0.6.0": | |
350, | |
"simple-json@0.7.0": | |
358, | |
"simple-json@0.8.0": | |
360, | |
"simple-json@0.9.0": | |
363, | |
"simple-json@0.10.0": | |
345, | |
"simple-json@1.0.0": | |
436, | |
"simple-json@1.1.0": | |
251, | |
"simple-json@2.0.0": | |
242, | |
"simple-json@2.0.1": | |
254, | |
"simple-json@3.0.0": | |
248, | |
"simple-json@4.0.0": | |
142, | |
"simple-json@4.1.0": | |
223, | |
"simple-json@4.2.0": | |
136, | |
"simple-json@4.3.0": | |
126, | |
"simple-json@4.4.0": | |
141, | |
"simple-json@4.4.1": | |
145, | |
"simple-json@5.0.0": | |
144, | |
"simple-json@5.1.0": | |
144, | |
"simple-json@6.0.0": | |
142, | |
"simple-json@7.0.0": | |
268, | |
"simple-json@8.0.0": | |
99, | |
"simple-json@9.0.0": | |
86, | |
"simple-json-generics@0.1.0": | |
198, | |
"simple-json-utils@0.1.0": | |
249, | |
"simple-jwt@1.0.0": | |
167, | |
"simple-jwt@1.0.1": | |
161, | |
"simple-jwt@1.0.2": | |
158, | |
"simple-jwt@1.0.3": | |
293, | |
"simple-jwt@1.1.0": | |
145, | |
"simple-jwt@1.1.1": | |
161, | |
"simple-jwt@2.0.0": | |
159, | |
"simple-jwt@3.0.0": | |
117, | |
"simple-jwt@3.1.0": | |
139, | |
"simple-jwt@4.0.0": | |
111, | |
"simple-jwt@4.0.1": | |
254, | |
"simple-moment@0.1.0": | |
56, | |
"simple-moment@0.2.0": | |
68, | |
"simple-moment@0.2.1": | |
79, | |
"simple-moment@0.2.2": | |
75, | |
"simple-moment@0.3.0": | |
79, | |
"simple-moment@0.4.0": | |
162, | |
"simple-moment@0.5.0": | |
160, | |
"simple-parser@1.0.0": | |
145, | |
"simple-parser@2.0.0": | |
64, | |
"simple-parser@2.1.0": | |
75, | |
"simple-parser@2.2.0": | |
73, | |
"simple-parser@3.0.0": | |
77, | |
"simple-parser@4.0.0": | |
75, | |
"simple-parser@4.1.0": | |
162, | |
"simple-parser@5.0.0": | |
88, | |
"simple-parser@5.1.0": | |
69, | |
"simple-parser@5.1.1": | |
72, | |
"simple-parser@6.0.0": | |
67, | |
"simple-parser@6.0.1": | |
86, | |
"simple-parser@7.0.0": | |
175, | |
"simple-parser@8.0.0": | |
152, | |
"simple-repl@1.0.0": | |
235, | |
"simple-repl@2.0.0": | |
113, | |
"simple-repl@2.1.0": | |
76, | |
"simple-repl@3.0.0": | |
732, | |
"simple-repl@4.0.0": | |
741, | |
"simple-repl@4.0.1": | |
740, | |
"simple-repl@5.0.0": | |
759, | |
"simple-repl@6.0.0": | |
578, | |
"simple-repl@6.0.1": | |
392, | |
"simple-request@3.1.0": | |
80, | |
"simple-request@3.1.1": | |
83, | |
"simple-request@4.0.0": | |
85, | |
"simple-timestamp@1.0.0": | |
406, | |
"simple-timestamp@1.1.0": | |
535, | |
"simple-timestamp@1.2.0": | |
388, | |
"simple-timestamp@1.3.0": | |
395, | |
"simple-timestamp@2.0.0": | |
397, | |
"simple-timestamp@3.0.0": | |
405, | |
"simple-ulid@1.0.0": | |
161, | |
"simple-ulid@2.0.0": | |
206, | |
"simple-ulid@3.0.0": | |
84, | |
"simplecrypto@0.0.1": | |
43, | |
"simplecrypto@0.0.2": | |
80, | |
"simplecrypto@0.0.3": | |
70, | |
"simplecrypto@0.0.4": | |
74, | |
"simplecrypto@0.0.5": | |
70, | |
"simplecrypto@0.0.6": | |
78, | |
"simplecrypto@0.0.7": | |
99, | |
"simplecrypto@0.0.8": | |
119, | |
"simplecrypto@0.1.0": | |
49, | |
"simplecrypto@1.0.0": | |
68, | |
"simplecrypto@1.0.1": | |
67, | |
"sized-matrices@0.1.0": | |
110, | |
"sized-matrices@0.1.1": | |
104, | |
"sized-matrices@0.2.0": | |
144, | |
"sized-matrices@0.2.1": | |
174, | |
"sized-matrices@1.0.0": | |
547, | |
"sized-vectors@1.0.0": | |
62, | |
"sized-vectors@1.1.0": | |
87, | |
"sized-vectors@2.0.0": | |
112, | |
"sized-vectors@2.1.0": | |
114, | |
"sized-vectors@2.2.0": | |
112, | |
"sized-vectors@3.0.0": | |
197, | |
"sized-vectors@3.1.0": | |
85, | |
"sized-vectors@4.0.0": | |
84, | |
"sized-vectors@5.0.0": | |
335, | |
"sized-vectors@5.0.1": | |
302, | |
"sized-vectors@5.0.2": | |
303, | |
"sjcl@0.0.0": | |
147, | |
"sjcl@0.0.1": | |
558, | |
"sketch@1.0.0": | |
295, | |
"sketch@1.1.0": | |
289, | |
"sketch@1.1.1": | |
301, | |
"sketch@1.2.0": | |
302, | |
"sketch@1.2.2": | |
356, | |
"sketch@1.3.0": | |
357, | |
"skull@0.0.1": | |
-162, | |
"skull@0.0.2": | |
-293, | |
"skull@0.0.3": | |
-153, | |
"skull@0.0.4": | |
-154, | |
"skull@0.0.5": | |
-161, | |
"skull@0.0.6": | |
-162, | |
"skull@0.0.7": | |
-162, | |
"skull@0.0.8": | |
-161, | |
"skull@0.0.9": | |
-249, | |
"skull@0.0.10": | |
-145, | |
"skull@0.0.11": | |
-156, | |
"slamdown-smolder@1.0.0": | |
-507, | |
"slamdown-smolder@1.1.0": | |
-500, | |
"slamdown-smolder@1.2.0": | |
-619, | |
"slamdown-smolder@1.3.0": | |
-478, | |
"slamdown-smolder@2.0.0": | |
287, | |
"slamdown-smolder@2.0.1": | |
299, | |
"slices@0.1.0": | |
94, | |
"slices@0.1.1": | |
97, | |
"slices@0.2.0": | |
95, | |
"slides@0.5.0": | |
-498, | |
"slug@0.1.0": | |
406, | |
"slug@0.2.0": | |
217, | |
"slug@1.0.0": | |
204, | |
"slug@2.0.0": | |
173, | |
"slug@3.0.0": | |
117, | |
"slug@3.0.1": | |
2592, | |
"slug@3.0.2": | |
97, | |
"slug@3.0.3": | |
98, | |
"slug@3.0.4": | |
110, | |
"slug@3.0.5": | |
113, | |
"slug@3.0.6": | |
110, | |
"slug@3.0.7": | |
109, | |
"slug@3.0.8": | |
111, | |
"small-ffi@1.0.0": | |
126, | |
"small-ffi@1.0.1": | |
49, | |
"small-ffi@1.0.2": | |
56, | |
"small-ffi@2.0.0": | |
71, | |
"small-ffi@2.1.0": | |
66, | |
"small-ffi@2.1.2": | |
68, | |
"small-ffi@4.0.1": | |
133, | |
"smash@1.0.0": | |
543, | |
"smash@1.1.0": | |
394, | |
"smash@2.0.0": | |
393, | |
"smash@3.0.0": | |
179, | |
"smolder@1.0.0": | |
-66, | |
"smolder@1.0.1": | |
-73, | |
"smolder@1.0.2": | |
-71, | |
"smolder@2.0.0": | |
-67, | |
"smolder@3.0.0": | |
173, | |
"smolder@3.0.1": | |
69, | |
"smolder@4.0.0": | |
61, | |
"smolder@4.0.1": | |
75, | |
"smolder@5.0.0": | |
72, | |
"smolder@6.0.0": | |
175, | |
"smolder@6.0.1": | |
170, | |
"smolder@7.0.0": | |
328, | |
"smolder@8.0.0": | |
201, | |
"smolder@9.0.0": | |
218, | |
"smolder@10.0.0": | |
245, | |
"smolder@10.1.0": | |
241, | |
"smolder@10.2.0": | |
242, | |
"smolder@11.0.0": | |
251, | |
"smolder@11.0.1": | |
171, | |
"smolder@12.0.0": | |
136, | |
"smolder@12.1.0": | |
136, | |
"smolder@12.2.0": | |
131, | |
"smolder@12.3.0": | |
132, | |
"smolder-dom@1.0.0": | |
691, | |
"smolder-dom@1.1.0": | |
684, | |
"smolder-dom@2.0.0": | |
642, | |
"smolder-dom@3.0.0": | |
309, | |
"smolder-idom@0.1.0": | |
446, | |
"smolder-idom@0.1.1": | |
449, | |
"smolder-idom@0.1.2": | |
450, | |
"smolder-idom@0.1.3": | |
452, | |
"smolder-vdom@1.0.0": | |
-601, | |
"smsapi@0.1.1": | |
264, | |
"snabbdom@0.2.1": | |
-306, | |
"snabbdom@0.2.2": | |
-322, | |
"snabbdom@0.2.3": | |
-315, | |
"snabbdom@1.0.0": | |
728, | |
"snabbdom@1.0.1": | |
366, | |
"snail@2.0.0": | |
79, | |
"snail@3.0.0": | |
431, | |
"snail@3.1.0": | |
441, | |
"snail@4.0.0": | |
424, | |
"socketio@0.0.2": | |
-56, | |
"socketio-2@1.0.0": | |
160, | |
"socketio-2@1.1.0": | |
150, | |
"sockjs-client@0.1.1": | |
118, | |
"sockjs-node@0.1.0": | |
656, | |
"sockjs-node@0.1.1": | |
606, | |
"sodium@0.0.1": | |
404, | |
"sodium@0.0.2": | |
283, | |
"sodium@1.0.0": | |
401, | |
"sodium@2.0.0": | |
541, | |
"sodium@2.1.0": | |
262, | |
"solc@1.0.0": | |
765, | |
"solc@1.1.0": | |
797, | |
"son-of-a-j@0.1.0": | |
523, | |
"son-of-a-j@0.1.1": | |
526, | |
"son-of-a-j@0.2.0": | |
524, | |
"son-of-a-j@0.2.1": | |
652, | |
"son-of-a-j@0.2.2": | |
512, | |
"sorted-arrays@0.0.1": | |
82, | |
"sorted-arrays@0.1.0": | |
95, | |
"sorted-arrays@0.1.1": | |
93, | |
"sorted-arrays@0.1.3": | |
93, | |
"sorted-arrays@0.1.4": | |
186, | |
"sorted-arrays@0.1.5": | |
97, | |
"sorted-arrays@0.2.0": | |
73, | |
"soundfonts@1.1.5": | |
776, | |
"soundfonts@1.2.0": | |
695, | |
"soundfonts@2.0.0": | |
695, | |
"soundfonts@3.0.0": | |
492, | |
"soundfonts@3.0.1": | |
622, | |
"soundfonts@3.0.2": | |
479, | |
"soundfonts@3.1.1": | |
456, | |
"soundfonts@3.2.0": | |
325, | |
"soundfonts@3.3.0": | |
191, | |
"soundfonts@4.0.1": | |
162, | |
"soundfonts@4.1.0": | |
162, | |
"sparkle@0.1.0": | |
-196, | |
"sparkle@0.1.1": | |
-128, | |
"sparkle@0.2.0": | |
-104, | |
"sparkle@0.2.1": | |
-117, | |
"sparkle@0.2.2": | |
-128, | |
"sparkle@0.3.0": | |
-135, | |
"sparkle@0.3.1": | |
-134, | |
"sparkle@1.0.0": | |
248, | |
"sparkle@1.0.1": | |
344, | |
"sparkle@2.0.0": | |
-690, | |
"sparkle@3.0.0": | |
730, | |
"sparkle@4.0.0": | |
639, | |
"sparkle@4.1.0": | |
630, | |
"sparkle@4.1.1": | |
633, | |
"sparkle@4.2.0": | |
711, | |
"sparrow@0.0.6": | |
598, | |
"sparrow-queue@0.0.5": | |
772, | |
"sparse-matrices@1.0.0": | |
184, | |
"sparse-matrices@1.1.0": | |
187, | |
"sparse-matrices@1.2.0": | |
186, | |
"sparse-matrices@1.2.1": | |
149, | |
"sparse-polynomials@1.0.0": | |
227, | |
"sparse-polynomials@1.0.1": | |
116, | |
"sparse-polynomials@1.0.2": | |
114, | |
"sparse-polynomials@1.0.3": | |
124, | |
"sparse-polynomials@1.0.4": | |
84, | |
"sparse-polynomials@1.0.5": | |
81, | |
"spec@0.4.0": | |
70, | |
"spec@0.5.0": | |
150, | |
"spec@0.5.1": | |
79, | |
"spec@0.5.2": | |
64, | |
"spec@0.6.0": | |
91, | |
"spec@0.6.1": | |
88, | |
"spec@0.6.2": | |
179, | |
"spec@0.7.0": | |
85, | |
"spec@0.7.1": | |
70, | |
"spec@0.7.2": | |
86, | |
"spec@0.7.3": | |
85, | |
"spec@0.8.0": | |
74, | |
"spec@0.9.0": | |
436, | |
"spec@0.9.1": | |
507, | |
"spec@0.10.0": | |
434, | |
"spec@0.11.0": | |
-348, | |
"spec@0.12.0": | |
-372, | |
"spec@0.12.1": | |
-375, | |
"spec@0.12.2": | |
-372, | |
"spec@0.12.3": | |
-459, | |
"spec@0.12.4": | |
-634, | |
"spec@0.13.0": | |
522, | |
"spec@0.14.0": | |
464, | |
"spec@1.0.0": | |
-479, | |
"spec@2.0.0": | |
-298, | |
"spec@3.0.0": | |
310, | |
"spec@3.1.0": | |
308, | |
"spec@3.1.1": | |
412, | |
"spec@4.0.0": | |
295, | |
"spec@4.0.1": | |
285, | |
"spec@5.0.0": | |
134, | |
"spec@5.0.1": | |
141, | |
"spec@6.0.0": | |
310, | |
"spec@7.0.0": | |
109, | |
"spec@7.1.0": | |
109, | |
"spec-discovery@0.1.0": | |
-531, | |
"spec-discovery@0.2.0": | |
581, | |
"spec-discovery@0.3.0": | |
-499, | |
"spec-discovery@0.4.0": | |
-464, | |
"spec-discovery@0.5.0": | |
593, | |
"spec-discovery@0.6.0": | |
574, | |
"spec-discovery@1.0.0": | |
-573, | |
"spec-discovery@2.0.0": | |
-414, | |
"spec-discovery@3.0.0": | |
367, | |
"spec-discovery@3.1.0": | |
368, | |
"spec-discovery@3.2.0": | |
363, | |
"spec-discovery@4.0.0": | |
364, | |
"spec-discovery@5.0.0": | |
500, | |
"spec-discovery@6.0.0": | |
154, | |
"spec-discovery@7.0.0": | |
-266, | |
"spec-discovery@8.0.0": | |
152, | |
"spec-discovery@8.0.1": | |
152, | |
"spec-mocha@0.2.0": | |
534, | |
"spec-mocha@0.3.0": | |
-551, | |
"spec-mocha@0.3.1": | |
-481, | |
"spec-mocha@0.4.0": | |
-508, | |
"spec-mocha@1.0.0": | |
-452, | |
"spec-mocha@2.0.0": | |
-400, | |
"spec-mocha@3.0.0": | |
396, | |
"spec-mocha@4.0.0": | |
18562, | |
"spec-quickcheck@0.1.0": | |
-66, | |
"spec-quickcheck@0.1.1": | |
-168, | |
"spec-quickcheck@0.2.0": | |
99, | |
"spec-quickcheck@0.2.1": | |
66, | |
"spec-quickcheck@0.3.0": | |
111, | |
"spec-quickcheck@0.9.1": | |
89, | |
"spec-quickcheck@0.10.0": | |
-477, | |
"spec-quickcheck@1.0.0": | |
-526, | |
"spec-quickcheck@2.0.0": | |
-314, | |
"spec-quickcheck@3.0.0": | |
434, | |
"spec-quickcheck@3.1.0": | |
323, | |
"spec-quickcheck@4.0.0": | |
158, | |
"spec-quickcheck@5.0.0": | |
130, | |
"spec-reporter-xunit@0.1.1": | |
92, | |
"spec-reporter-xunit@0.2.0": | |
241, | |
"spec-reporter-xunit@0.3.0": | |
-438, | |
"spec-reporter-xunit@0.3.1": | |
-426, | |
"spec-reporter-xunit@0.4.0": | |
-356, | |
"spec-reporter-xunit@0.5.0": | |
387, | |
"specular@0.2.0": | |
253, | |
"specular@0.5.0": | |
258, | |
"specular@0.5.1": | |
356, | |
"specular@0.5.2": | |
248, | |
"specular@0.6.0": | |
250, | |
"specular@0.6.1": | |
265, | |
"specular@0.6.2": | |
263, | |
"specular@0.7.0": | |
268, | |
"specular@0.8.0": | |
367, | |
"specular@0.8.1": | |
242, | |
"specular@0.8.2": | |
252, | |
"specular@0.8.3": | |
266, | |
"specular@0.9.0": | |
261, | |
"specular@0.9.1": | |
258, | |
"specular@0.10.0": | |
397, | |
"specular@0.10.1": | |
245, | |
"specular@0.10.2": | |
240, | |
"specular@0.11.0": | |
256, | |
"specular@0.12.0": | |
443, | |
"specular@0.12.1": | |
444, | |
"split@0.1.0": | |
103, | |
"split@0.2.0": | |
217, | |
"splitmix@1.0.0": | |
99, | |
"splitmix@2.0.0": | |
102, | |
"splitmix@2.1.0": | |
105, | |
"spork@0.1.0": | |
527, | |
"spork@0.2.0": | |
502, | |
"spork@0.3.0": | |
503, | |
"spork@0.3.1": | |
632, | |
"spork@0.3.2": | |
485, | |
"spork@0.3.3": | |
480, | |
"spork@0.3.4": | |
490, | |
"spork@0.4.0": | |
495, | |
"spork@0.5.0": | |
480, | |
"spork@0.6.0": | |
499, | |
"spork@1.0.0": | |
662, | |
"sql@0.1.0": | |
85, | |
"sql-squared@0.1.0": | |
-518, | |
"sql-squared@0.2.0": | |
-531, | |
"sql-squared@0.3.0": | |
-530, | |
"sql-squared@0.4.0": | |
1124, | |
"sql-squared@0.4.1": | |
1225, | |
"sql-squared@0.5.0": | |
1090, | |
"sql-squared@0.6.0": | |
1093, | |
"sql-squared@0.6.1": | |
1106, | |
"sql-squared@0.6.2": | |
1127, | |
"sql-squared@0.7.0": | |
870, | |
"sql-squared@0.7.1": | |
1003, | |
"sql-squared@0.7.2": | |
837, | |
"sql-squared@0.7.3": | |
856, | |
"sql-squared@0.7.4": | |
865, | |
"sql-squared@0.7.5": | |
879, | |
"sql-squared@0.8.0": | |
1220, | |
"sql-squared@0.8.1": | |
1065, | |
"sql-squared@0.8.2": | |
1073, | |
"sql-squared@0.8.3": | |
1085, | |
"sql-squared@0.8.4": | |
1086, | |
"sql-squared@0.9.0": | |
1205, | |
"sql-squared@0.9.1": | |
1053, | |
"sql-squared@0.10.0": | |
1059, | |
"sql-squared@0.10.1": | |
1068, | |
"sql-squared@0.11.0": | |
1014, | |
"sql-squared@0.12.0": | |
460, | |
"sql-squared@0.13.0": | |
306, | |
"sql-squared@14.0.0": | |
361, | |
"sql-squared@14.1.0": | |
378, | |
"sql-squared@15.0.0": | |
149, | |
"sqlite@0.1.0": | |
84, | |
"sqlite@0.1.1": | |
82, | |
"sqlite@0.1.2": | |
87, | |
"sqlite@1.0.0": | |
-345, | |
"sqlite@2.0.0": | |
-284, | |
"sqlite@3.0.0": | |
382, | |
"ssh2-sftp-client@0.1.0": | |
289, | |
"ssrs@1.0.0": | |
92, | |
"st@0.1.0": | |
113, | |
"st@0.1.1": | |
48, | |
"st@1.0.0": | |
53, | |
"st@2.0.0": | |
80, | |
"st@3.0.0": | |
81, | |
"st@4.0.0": | |
97, | |
"st@4.0.1": | |
86, | |
"st@4.0.2": | |
181, | |
"st@4.1.0": | |
87, | |
"st@4.1.1": | |
66, | |
"st@5.0.0": | |
74, | |
"st@5.0.1": | |
71, | |
"st@6.0.0": | |
76, | |
"st@6.1.0": | |
76, | |
"st@6.2.0": | |
142, | |
"st-lazy-ref@0.0.1": | |
57, | |
"stac@0.1.0": | |
520, | |
"stac@0.1.1": | |
486, | |
"stac@0.1.2": | |
485, | |
"stac@1.0.0": | |
1475, | |
"stac@1.0.1": | |
1326, | |
"stac@2.0.0": | |
226, | |
"stack@1.0.0": | |
80, | |
"stackless@0.0.4": | |
79, | |
"stackless@0.0.5": | |
76, | |
"stackless-cont@0.0.3": | |
79, | |
"stacksafe-function@1.0.0": | |
65, | |
"stacksafe-function@1.0.1": | |
122, | |
"stacksafe-function@2.0.0": | |
44, | |
"stalling-coroutines@0.1.0": | |
106, | |
"stalling-coroutines@0.1.1": | |
104, | |
"stalling-coroutines@1.0.0": | |
79, | |
"stalling-coroutines@2.0.0": | |
146, | |
"stalling-coroutines@3.0.0": | |
186, | |
"stat-mode@1.0.0": | |
160, | |
"static-serve@0.1.0": | |
432, | |
"static-serve@0.1.1": | |
433, | |
"static-serve@0.2.0": | |
425, | |
"static-serve@0.2.1": | |
427, | |
"static-serve@1.0.0": | |
397, | |
"statistics@0.1.0": | |
70, | |
"statistics@0.1.1": | |
73, | |
"statistics@0.1.2": | |
87, | |
"statistics@0.2.0": | |
60, | |
"stats@0.0.2": | |
119, | |
"stats@0.1.0": | |
114, | |
"stats@0.2.0": | |
199, | |
"stdout@0.1.0": | |
534, | |
"stdout@0.1.1": | |
390, | |
"stdout@0.2.0": | |
880, | |
"stdout@1.0.0": | |
150, | |
"storable@0.0.1": | |
245, | |
"storable@0.0.3": | |
241, | |
"storable@0.0.4": | |
241, | |
"storable@0.0.5": | |
243, | |
"storable@0.0.6": | |
447, | |
"store@0.0.0": | |
229, | |
"store@1.0.0": | |
222, | |
"store@1.0.1": | |
228, | |
"stream@0.1.0": | |
62, | |
"stream@0.2.0": | |
148, | |
"strictlypositiveint@1.0.0": | |
51, | |
"strictlypositiveint@1.0.1": | |
52, | |
"string-parsers@0.2.0": | |
-72, | |
"string-parsers@0.3.0": | |
78, | |
"string-parsers@0.4.0": | |
84, | |
"string-parsers@0.4.1": | |
76, | |
"string-parsers@0.5.0": | |
71, | |
"string-parsers@0.6.0": | |
161, | |
"string-parsers@0.6.1": | |
78, | |
"string-parsers@0.6.2": | |
58, | |
"string-parsers@0.6.3": | |
91, | |
"string-parsers@0.6.4": | |
75, | |
"string-parsers@0.6.5": | |
75, | |
"string-parsers@0.6.6": | |
75, | |
"string-parsers@0.6.7": | |
104, | |
"string-parsers@1.0.0": | |
113, | |
"string-parsers@1.0.1": | |
49, | |
"string-parsers@2.0.0": | |
155, | |
"string-parsers@2.0.1": | |
159, | |
"string-parsers@2.1.0": | |
147, | |
"string-parsers@2.2.0": | |
145, | |
"string-parsers@3.0.0": | |
211, | |
"string-parsers@3.0.1": | |
292, | |
"string-parsers@3.1.0": | |
280, | |
"string-parsers@4.0.0": | |
126, | |
"string-parsers@4.0.1": | |
125, | |
"string-parsers@5.0.0": | |
136, | |
"string-parsers@5.0.1": | |
137, | |
"string-parsers@6.0.0": | |
94, | |
"string-parsers@6.0.1": | |
181, | |
"string-parsers@7.0.0": | |
81, | |
"string-parsers@8.0.0": | |
72, | |
"stringcolors@0.1.0": | |
51, | |
"stringcolors@0.1.1": | |
71, | |
"strings@0.1.0": | |
67, | |
"strings@0.1.1": | |
68, | |
"strings@0.1.2": | |
68, | |
"strings@0.1.3": | |
68, | |
"strings@0.2.0": | |
104, | |
"strings@0.2.1": | |
43, | |
"strings@0.3.0": | |
57, | |
"strings@0.3.1": | |
66, | |
"strings@0.3.2": | |
69, | |
"strings@0.3.3": | |
134, | |
"strings@0.4.0": | |
48, | |
"strings@0.4.1": | |
53, | |
"strings@0.4.2": | |
67, | |
"strings@0.4.3": | |
67, | |
"strings@0.4.4": | |
78, | |
"strings@0.4.5": | |
67, | |
"strings@0.5.0": | |
144, | |
"strings@0.5.1": | |
74, | |
"strings@0.5.2": | |
48, | |
"strings@0.5.3": | |
81, | |
"strings@0.5.4": | |
71, | |
"strings@0.5.5": | |
63, | |
"strings@0.6.0": | |
75, | |
"strings@0.7.0": | |
75, | |
"strings@0.7.1": | |
116, | |
"strings@1.0.0": | |
98, | |
"strings@1.1.0": | |
45, | |
"strings@2.0.0": | |
68, | |
"strings@2.0.1": | |
78, | |
"strings@2.0.2": | |
77, | |
"strings@2.1.0": | |
77, | |
"strings@3.0.0": | |
69, | |
"strings@3.1.0": | |
119, | |
"strings@3.2.0": | |
197, | |
"strings@3.2.1": | |
103, | |
"strings@3.3.0": | |
119, | |
"strings@3.3.1": | |
116, | |
"strings@3.3.2": | |
121, | |
"strings@3.4.0": | |
119, | |
"strings@3.5.0": | |
206, | |
"strings@4.0.0": | |
111, | |
"strings@4.0.1": | |
97, | |
"strings@4.0.2": | |
103, | |
"strings@5.0.0": | |
93, | |
"strings@6.0.0": | |
85, | |
"strings@6.0.1": | |
89, | |
"strings-extra@1.0.0": | |
150, | |
"strings-extra@1.0.1": | |
232, | |
"strings-extra@2.0.0": | |
137, | |
"strings-extra@2.1.0": | |
119, | |
"strings-extra@2.2.0": | |
139, | |
"strings-extra@2.2.1": | |
139, | |
"strings-extra@3.0.0": | |
101, | |
"strings-extra@3.0.1": | |
97, | |
"strings-extra@4.0.0": | |
92, | |
"stringutils@0.0.1": | |
108, | |
"stringutils@0.0.2": | |
92, | |
"stringutils@0.0.3": | |
51, | |
"stringutils@0.0.4": | |
93, | |
"stringutils@0.0.5": | |
140, | |
"stringutils@0.0.6": | |
143, | |
"stringutils@0.0.7": | |
144, | |
"stringutils@0.0.8": | |
130, | |
"stringutils@0.0.9": | |
131, | |
"stringutils@0.0.10": | |
188, | |
"stringutils@0.0.11": | |
82, | |
"stringutils@0.0.12": | |
82, | |
"strongcheck@0.3.2": | |
-79, | |
"strongcheck@0.3.3": | |
-83, | |
"strongcheck@0.3.4": | |
-161, | |
"strongcheck@0.4.0": | |
-79, | |
"strongcheck@0.4.1": | |
-60, | |
"strongcheck@0.4.2": | |
-82, | |
"strongcheck@0.4.3": | |
-81, | |
"strongcheck@0.4.4": | |
-79, | |
"strongcheck@0.4.5": | |
-86, | |
"strongcheck@0.4.6": | |
-81, | |
"strongcheck@0.4.7": | |
-167, | |
"strongcheck@0.4.8": | |
-92, | |
"strongcheck@0.4.9": | |
-63, | |
"strongcheck@0.4.10": | |
-74, | |
"strongcheck@0.4.11": | |
-90, | |
"strongcheck@0.4.12": | |
-90, | |
"strongcheck@0.4.13": | |
-92, | |
"strongcheck@0.4.14": | |
-92, | |
"strongcheck@0.4.15": | |
-192, | |
"strongcheck@0.4.16": | |
-103, | |
"strongcheck@0.5.0": | |
-78, | |
"strongcheck@0.5.1": | |
-100, | |
"strongcheck@0.5.2": | |
-93, | |
"strongcheck@0.6.0": | |
-86, | |
"strongcheck@0.7.0": | |
-80, | |
"strongcheck@0.8.0": | |
92, | |
"strongcheck@0.9.0": | |
193, | |
"strongcheck@0.10.0": | |
90, | |
"strongcheck@0.11.0": | |
73, | |
"strongcheck@0.12.0": | |
81, | |
"strongcheck@0.12.1": | |
91, | |
"strongcheck@0.13.0": | |
91, | |
"strongcheck@0.14.0": | |
98, | |
"strongcheck@0.14.1": | |
96, | |
"strongcheck@0.14.2": | |
191, | |
"strongcheck@0.14.3": | |
81, | |
"strongcheck@0.14.4": | |
78, | |
"strongcheck@0.14.5": | |
82, | |
"strongcheck@0.14.6": | |
94, | |
"strongcheck@0.14.7": | |
93, | |
"strongcheck@1.0.0": | |
83, | |
"strongcheck@1.1.0": | |
80, | |
"strongcheck@1.1.1": | |
176, | |
"strongcheck@2.0.0": | |
311, | |
"strongcheck@2.0.1": | |
-226, | |
"strongcheck@2.0.2": | |
276, | |
"strongcheck@2.1.0": | |
283, | |
"strongcheck@3.0.0": | |
290, | |
"strongcheck@3.1.0": | |
273, | |
"strongcheck@4.0.0": | |
168, | |
"strongcheck@4.1.0": | |
274, | |
"strongcheck@4.1.1": | |
161, | |
"strongcheck@5.0.0": | |
148, | |
"strongcheck@5.0.1": | |
170, | |
"strongcheck-argonaut@1.0.0": | |
543, | |
"strongcheck-argonaut@1.1.0": | |
509, | |
"strongcheck-generics@0.1.0": | |
207, | |
"strongcheck-generics@0.2.0": | |
95, | |
"strongcheck-generics@0.2.1": | |
94, | |
"strongcheck-generics@0.3.0": | |
105, | |
"strongcheck-generics@0.4.0": | |
87, | |
"strongcheck-generics@0.5.0": | |
-239, | |
"strongcheck-generics@0.5.1": | |
-236, | |
"strongcheck-generics@1.0.0": | |
285, | |
"strongcheck-laws@1.0.0": | |
495, | |
"strongcheck-laws@2.0.0": | |
506, | |
"strongcheck-laws@3.0.0": | |
178, | |
"strongcheck-laws@3.1.0": | |
186, | |
"strongcheck-laws@3.2.0": | |
184, | |
"strongcheck-laws@3.2.1": | |
186, | |
"struct@0.1.0": | |
242, | |
"struct@1.0.0": | |
163, | |
"struct@1.0.1": | |
153, | |
"struct@1.1.0": | |
461, | |
"style@0.0.1": | |
182, | |
"style@0.1.0": | |
154, | |
"style@0.2.0": | |
156, | |
"style@0.3.0": | |
289, | |
"style@0.4.0": | |
143, | |
"style@0.5.0": | |
113, | |
"style@0.6.0": | |
128, | |
"style@0.7.0": | |
129, | |
"style@0.8.0": | |
131, | |
"style@0.9.0": | |
133, | |
"style@0.10.0": | |
213, | |
"style@0.11.0": | |
118, | |
"style@0.12.0": | |
115, | |
"style@0.13.0": | |
122, | |
"style@0.14.0": | |
130, | |
"style@0.14.1": | |
133, | |
"style@0.15.0": | |
131, | |
"style@0.16.0": | |
130, | |
"style@0.17.0": | |
217, | |
"stylesheet@0.0.1": | |
40, | |
"stylesheet@0.0.2": | |
315, | |
"stylesheet@0.0.3": | |
158, | |
"subcategory@0.1.0": | |
96, | |
"subcategory@0.1.1": | |
87, | |
"subcategory@0.2.0": | |
88, | |
"subrecord@0.1.0": | |
73, | |
"subscriber@1.0.0": | |
220, | |
"subscriber@1.1.0": | |
118, | |
"subscriber@1.1.1": | |
116, | |
"subscriber@1.1.2": | |
276, | |
"subscriber@2.0.0": | |
-612, | |
"substitute@0.1.0": | |
178, | |
"substitute@0.1.1": | |
250, | |
"substitute@0.2.0": | |
-116, | |
"substitute@0.2.1": | |
-214, | |
"substitute@0.2.2": | |
-80, | |
"substitute@0.2.3": | |
-79, | |
"substructural@0.0.1": | |
132, | |
"substructural@0.0.2": | |
126, | |
"substructural@0.0.3": | |
123, | |
"substructural@0.0.4": | |
124, | |
"substructural@0.0.5": | |
228, | |
"substructural@0.0.6": | |
115, | |
"substructural@0.0.7": | |
61, | |
"substructural@0.0.8": | |
82, | |
"substructural@0.0.9": | |
81, | |
"substructural@0.0.10": | |
82, | |
"substructural@0.0.11": | |
80, | |
"substructural@0.0.12": | |
176, | |
"substructural@0.0.13": | |
78, | |
"substructural@0.0.14": | |
64, | |
"substructural@0.0.15": | |
78, | |
"substructural@0.0.16": | |
83, | |
"substructural@0.0.17": | |
81, | |
"substructural@0.0.18": | |
165, | |
"substructural@0.0.19": | |
96, | |
"subtlecrypto@0.0.0": | |
299, | |
"subtlecrypto@0.0.1": | |
301, | |
"sudoku@0.1.0": | |
90, | |
"sudoku@1.0.0": | |
117, | |
"suggest@1.0.0": | |
87, | |
"suggest@1.0.1": | |
-201, | |
"suggest@2.0.0": | |
-542, | |
"suggest@2.1.1": | |
-399, | |
"suggest@2.2.0": | |
-394, | |
"suggest@2.3.0": | |
461, | |
"suggest@3.0.0": | |
453, | |
"suggest@4.0.0": | |
314, | |
"suggest@5.0.0": | |
323, | |
"sunde@0.1.0": | |
551, | |
"sunde@1.0.0": | |
430, | |
"sunde@2.0.0": | |
423, | |
"sunde@3.0.0": | |
138, | |
"super-spec@0.4.0": | |
75, | |
"super-spec@0.5.0": | |
79, | |
"super-spec@0.5.1": | |
193, | |
"super-spec@0.5.2": | |
74, | |
"super-spec@0.6.0": | |
89, | |
"super-spec@0.6.1": | |
92, | |
"super-spec@0.6.2": | |
97, | |
"super-spec@0.7.0": | |
96, | |
"super-spec@0.7.1": | |
94, | |
"super-spec@0.7.2": | |
96, | |
"super-spec@0.7.3": | |
183, | |
"super-spec@0.8.0": | |
73, | |
"super-spec@0.8.1": | |
74, | |
"super-spec@0.8.2": | |
95, | |
"super-spec@0.8.3": | |
94, | |
"super-spec@0.8.4": | |
88, | |
"super-spec@0.9.0": | |
78, | |
"super-spec@0.9.1": | |
151, | |
"super-spec@0.9.2": | |
67, | |
"super-spec@0.9.3": | |
69, | |
"supply@0.1.0": | |
72, | |
"supply@0.2.0": | |
79, | |
"svg-parser@1.0.0": | |
295, | |
"svg-parser@2.0.0": | |
92, | |
"svg-parser@3.0.0": | |
77, | |
"svg-parser-halogen@0.1.0": | |
799, | |
"svg-parser-halogen@0.2.0": | |
788, | |
"svg-parser-halogen@0.3.0": | |
388, | |
"svg-parser-halogen@0.4.0": | |
395, | |
"svg-parser-halogen@1.0.0": | |
712, | |
"svg-parser-halogen@2.0.0": | |
232, | |
"svg-parser-smolder@1.0.0": | |
316, | |
"svgo@0.1.0": | |
358, | |
"symbiote@0.0.0": | |
645, | |
"symbols@1.0.0": | |
61, | |
"symbols@1.0.1": | |
66, | |
"symbols@2.0.0": | |
148, | |
"symbols@3.0.0": | |
49, | |
"symbols@3.0.1": | |
52, | |
"symmetric-groups@0.1.0": | |
257, | |
"symmetric-groups@0.1.1": | |
213, | |
"symmetric-groups@0.1.2": | |
209, | |
"systemd-journald@0.1.1": | |
61, | |
"systemd-journald@0.1.3": | |
137, | |
"systemd-journald@0.2.0": | |
51, | |
"systemd-journald@0.2.1": | |
51, | |
"systemd-journald@0.3.0": | |
62, | |
"tables@0.0.1": | |
158, | |
"tables@0.0.2": | |
122, | |
"tables@0.0.5": | |
121, | |
"tables@0.0.7": | |
267, | |
"tables-parse@0.0.1": | |
191, | |
"tables-parse@0.0.2": | |
183, | |
"tables-parse@0.1.0": | |
196, | |
"tables-parse@0.1.1": | |
213, | |
"tables-parse@0.1.2": | |
215, | |
"tagged@1.0.0": | |
73, | |
"tagged@2.0.0": | |
103, | |
"tagged@3.0.0": | |
81, | |
"tagged@4.0.0": | |
51, | |
"tagged@4.0.1": | |
61, | |
"tagged@4.0.2": | |
74, | |
"tagged-sum@1.0.0": | |
300, | |
"tagged-sum@1.1.0": | |
200, | |
"tailrec@0.1.0": | |
50, | |
"tailrec@0.1.1": | |
76, | |
"tailrec@0.1.2": | |
74, | |
"tailrec@0.2.0": | |
76, | |
"tailrec@0.2.1": | |
76, | |
"tailrec@0.2.2": | |
79, | |
"tailrec@0.3.0": | |
119, | |
"tailrec@0.3.1": | |
91, | |
"tailrec@1.0.0": | |
45, | |
"tailrec@2.0.0": | |
74, | |
"tailrec@2.0.1": | |
71, | |
"tailrec@2.0.2": | |
75, | |
"tailrec@3.0.0": | |
71, | |
"tailrec@3.1.0": | |
81, | |
"tailrec@3.2.0": | |
165, | |
"tailrec@3.3.0": | |
93, | |
"tailrec@4.0.0": | |
49, | |
"tailrec@4.1.0": | |
66, | |
"tailrec@4.1.1": | |
72, | |
"tailrec@5.0.0": | |
66, | |
"tailrec@5.0.1": | |
71, | |
"tailrec@6.0.0": | |
67, | |
"tailrec@6.1.0": | |
73, | |
"task@0.1.0": | |
206, | |
"task@0.2.0": | |
145, | |
"task@0.2.1": | |
146, | |
"task@0.3.0": | |
183, | |
"task@0.3.1": | |
-115, | |
"task@0.3.2": | |
-199, | |
"taylor@1.0.0": | |
51, | |
"taylor@1.0.1": | |
59, | |
"taylor@2.0.0": | |
158, | |
"taylor@3.0.0": | |
182, | |
"taylor@4.0.0": | |
84, | |
"tecton@0.1.0": | |
177, | |
"tecton@0.1.1": | |
95, | |
"tecton@0.1.2": | |
83, | |
"tecton@0.1.3": | |
85, | |
"tecton@0.1.4": | |
98, | |
"tecton-halogen@0.1.0": | |
224, | |
"tecton-halogen@0.1.1": | |
215, | |
"tecton-halogen@0.1.2": | |
210, | |
"telegraf@0.1.0": | |
143, | |
"telegraf@0.2.1": | |
166, | |
"telegraf@0.2.2": | |
121, | |
"telegraf@0.3.0": | |
124, | |
"telegraf@0.3.1": | |
142, | |
"telegraf@0.4.0": | |
138, | |
"telegraf@0.4.1": | |
136, | |
"telegraf@0.5.0": | |
491, | |
"teller@1.0.0": | |
446, | |
"teller@2.0.0": | |
315, | |
"teller@3.0.0": | |
312, | |
"teller@4.0.0": | |
327, | |
"teller@5.0.0": | |
326, | |
"teller@6.0.0": | |
331, | |
"teller@7.0.0": | |
440, | |
"teller@8.0.0": | |
325, | |
"teller@9.0.0": | |
310, | |
"teller@10.0.0": | |
323, | |
"teller@10.0.1": | |
329, | |
"teller@10.0.2": | |
331, | |
"teller@10.0.3": | |
335, | |
"teller@10.0.4": | |
335, | |
"teller@10.1.0": | |
412, | |
"teller@10.1.1": | |
320, | |
"teller@10.1.2": | |
319, | |
"teller@10.1.3": | |
330, | |
"teller@10.1.4": | |
330, | |
"teller@10.1.5": | |
429, | |
"teller@10.1.6": | |
317, | |
"teller@10.1.7": | |
314, | |
"teller@10.1.8": | |
329, | |
"teller@10.1.9": | |
329, | |
"teller@10.1.10": | |
426, | |
"teller@10.1.11": | |
321, | |
"teller@10.1.12": | |
318, | |
"teller@10.2.0": | |
322, | |
"teller@10.3.0": | |
388, | |
"teller@10.3.1": | |
351, | |
"teller@10.3.2": | |
341, | |
"template-dust@1.0.0": | |
79, | |
"template-dust@1.0.1": | |
137, | |
"template-dust@1.0.2": | |
47, | |
"template-dust@1.0.3": | |
63, | |
"template-dust@1.0.4": | |
66, | |
"template-dust@2.0.0": | |
92, | |
"template-dust@2.0.1": | |
81, | |
"template-dust@3.0.0": | |
142, | |
"template-dust@3.0.1": | |
81, | |
"template-literals@0.1.0": | |
269, | |
"template-literals@0.2.0": | |
272, | |
"template-strings@1.0.0": | |
59, | |
"template-strings@1.1.0": | |
74, | |
"template-strings@1.1.1": | |
68, | |
"template-strings@2.0.0": | |
122, | |
"template-strings@3.0.0": | |
66, | |
"template-strings@4.0.0": | |
95, | |
"template-strings@5.0.0": | |
75, | |
"template-strings@5.1.0": | |
69, | |
"test-unit@1.0.0": | |
153, | |
"test-unit@1.1.0": | |
66, | |
"test-unit@1.1.1": | |
59, | |
"test-unit@1.1.2": | |
69, | |
"test-unit@1.1.3": | |
79, | |
"test-unit@1.1.4": | |
73, | |
"test-unit@1.1.5": | |
76, | |
"test-unit@1.1.6": | |
78, | |
"test-unit@2.0.0": | |
167, | |
"test-unit@3.0.0": | |
87, | |
"test-unit@4.0.0": | |
61, | |
"test-unit@4.1.0": | |
77, | |
"test-unit@5.0.0": | |
87, | |
"test-unit@6.0.0": | |
84, | |
"test-unit@6.0.1": | |
87, | |
"test-unit@7.0.0": | |
79, | |
"test-unit@7.0.1": | |
179, | |
"test-unit@8.0.0": | |
92, | |
"test-unit@9.0.0": | |
65, | |
"test-unit@9.1.0": | |
69, | |
"test-unit@10.0.0": | |
305, | |
"test-unit@10.0.1": | |
321, | |
"test-unit@10.0.2": | |
-255, | |
"test-unit@10.1.0": | |
-244, | |
"test-unit@11.0.0": | |
781, | |
"test-unit@12.0.0": | |
517, | |
"test-unit@13.0.0": | |
480, | |
"test-unit@14.0.0": | |
273, | |
"test-unit@15.0.0": | |
288, | |
"test-unit@16.0.0": | |
142, | |
"test-unit@17.0.0": | |
114, | |
"text@0.0.1": | |
241, | |
"text-encoding@0.0.7": | |
91, | |
"text-encoding@0.0.8": | |
90, | |
"text-encoding@0.0.9": | |
112, | |
"text-encoding@1.0.0": | |
123, | |
"textcursor@0.1.0": | |
875, | |
"textcursor@0.1.1": | |
963, | |
"textcursor@1.0.0": | |
223, | |
"textcursor@2.0.0": | |
250, | |
"thermite@0.1.0": | |
53, | |
"thermite@0.2.0": | |
74, | |
"thermite@0.3.0": | |
67, | |
"thermite@0.4.0": | |
66, | |
"thermite@0.4.1": | |
68, | |
"thermite@0.4.2": | |
158, | |
"thermite@0.5.0": | |
59, | |
"thermite@0.5.1": | |
54, | |
"thermite@0.5.2": | |
58, | |
"thermite@0.5.3": | |
73, | |
"thermite@0.5.4": | |
67, | |
"thermite@0.6.0": | |
72, | |
"thermite@0.6.1": | |
81, | |
"thermite@0.7.0": | |
127, | |
"thermite@0.7.1": | |
49, | |
"thermite@0.7.2": | |
63, | |
"thermite@0.7.3": | |
60, | |
"thermite@0.7.4": | |
76, | |
"thermite@0.8.0": | |
68, | |
"thermite@0.9.0": | |
236, | |
"thermite@0.10.0": | |
108, | |
"thermite@0.10.1": | |
106, | |
"thermite@0.11.0": | |
169, | |
"thermite@0.12.0": | |
173, | |
"thermite@0.12.1": | |
165, | |
"thermite@0.13.0": | |
168, | |
"thermite@0.13.1": | |
169, | |
"thermite@0.14.0": | |
270, | |
"thermite@0.15.0": | |
-127, | |
"thermite@0.15.1": | |
-116, | |
"thermite@1.0.0": | |
92, | |
"thermite@1.0.1": | |
93, | |
"thermite@2.0.0": | |
96, | |
"thermite@3.0.0": | |
662, | |
"thermite@3.1.0": | |
572, | |
"thermite@3.2.0": | |
556, | |
"thermite@3.2.1": | |
-519, | |
"thermite@4.0.0": | |
721, | |
"thermite@4.1.0": | |
631, | |
"thermite@4.1.1": | |
636, | |
"thermite@5.0.0": | |
825, | |
"thermite@6.0.0": | |
298, | |
"thermite@6.0.1": | |
296, | |
"thermite@6.0.2": | |
311, | |
"thermite@6.1.0": | |
234, | |
"thermite@6.2.0": | |
229, | |
"thermite@6.3.0": | |
347, | |
"thermite@6.3.1": | |
257, | |
"thermite-dom@0.0.0": | |
520, | |
"thermite-dom@0.0.1": | |
532, | |
"thermite-dom@0.1.0": | |
477, | |
"thermite-dom@0.2.0": | |
477, | |
"thermite-dom@0.3.0": | |
492, | |
"thermite-dom@0.3.1": | |
371, | |
"these@0.1.0": | |
61, | |
"these@0.2.0": | |
86, | |
"these@0.2.1": | |
71, | |
"these@0.3.0": | |
69, | |
"these@0.3.1": | |
125, | |
"these@0.3.2": | |
105, | |
"these@0.3.3": | |
46, | |
"these@0.3.4": | |
64, | |
"these@1.0.0": | |
72, | |
"these@2.0.0": | |
126, | |
"these@3.0.0": | |
146, | |
"these@3.1.0": | |
108, | |
"these@4.0.0": | |
95, | |
"these@5.0.0": | |
210, | |
"these@6.0.0": | |
96, | |
"timers@0.0.3": | |
44, | |
"timers@0.0.4": | |
72, | |
"timers@0.0.5": | |
65, | |
"timers@0.0.6": | |
72, | |
"timers@0.0.7": | |
126, | |
"timers@0.0.8": | |
45, | |
"timers@0.0.9": | |
57, | |
"timers@1.0.0": | |
92, | |
"timeseries@0.3.0": | |
-305, | |
"timeseries@0.4.0": | |
263, | |
"timeseries@0.5.0": | |
254, | |
"timeseries@0.6.0": | |
261, | |
"timeseries@0.6.1": | |
378, | |
"timeseries@0.7.0": | |
260, | |
"timeseries@0.8.0": | |
257, | |
"timeseries@0.8.1": | |
273, | |
"tolerant-argonaut@0.1.0": | |
507, | |
"tolerant-argonaut@1.0.0": | |
510, | |
"tolerant-argonaut@1.0.1": | |
627, | |
"tolerant-argonaut@1.1.0": | |
447, | |
"tolerant-argonaut@2.0.0": | |
432, | |
"toppokki@1.0.0": | |
429, | |
"toppokki@1.1.0": | |
418, | |
"toppokki@2.0.0": | |
409, | |
"toppokki@2.1.0": | |
457, | |
"toppokki@2.2.0": | |
523, | |
"toppokki@2.3.0": | |
401, | |
"toppokki@2.4.0": | |
392, | |
"toppokki@2.5.0": | |
16378, | |
"toppokki@3.0.0": | |
187, | |
"toppokki@4.0.0": | |
255, | |
"tortellini@0.1.0": | |
147, | |
"tortellini@1.0.0": | |
129, | |
"tortellini@2.0.0": | |
163, | |
"tortellini@2.0.1": | |
171, | |
"tortellini@3.0.0": | |
171, | |
"tortellini@4.0.0": | |
165, | |
"tortellini@5.0.0": | |
175, | |
"tortellini@5.1.0": | |
296, | |
"totally@0.1.0": | |
46, | |
"totally@0.2.0": | |
58, | |
"totally@0.3.0": | |
68, | |
"totally@1.0.0": | |
80, | |
"transformerless@1.1.1": | |
75, | |
"transformerless@2.0.0": | |
104, | |
"transformerless@2.1.0": | |
102, | |
"transformerless@2.2.0": | |
204, | |
"transformerless@2.2.1": | |
80, | |
"transformerless@2.3.0": | |
81, | |
"transformerless@3.0.0": | |
85, | |
"transformerless@3.0.1": | |
99, | |
"transformerless@3.0.2": | |
95, | |
"transformerless@4.0.0": | |
77, | |
"transformerless@4.0.1": | |
160, | |
"transformerless@4.0.2": | |
95, | |
"transformerless@4.1.0": | |
60, | |
"transformers@0.3.0": | |
-64, | |
"transformers@0.3.1": | |
72, | |
"transformers@0.3.2": | |
74, | |
"transformers@0.4.0": | |
73, | |
"transformers@0.4.1": | |
70, | |
"transformers@0.5.0": | |
110, | |
"transformers@0.5.1": | |
131, | |
"transformers@0.5.2": | |
50, | |
"transformers@0.5.3": | |
57, | |
"transformers@0.5.4": | |
77, | |
"transformers@0.5.5": | |
74, | |
"transformers@0.6.0": | |
79, | |
"transformers@0.6.1": | |
75, | |
"transformers@0.7.1": | |
80, | |
"transformers@0.7.2": | |
185, | |
"transformers@0.8.0": | |
91, | |
"transformers@0.8.1": | |
55, | |
"transformers@0.8.2": | |
78, | |
"transformers@0.8.3": | |
76, | |
"transformers@0.8.4": | |
77, | |
"transformers@1.0.0": | |
68, | |
"transformers@2.0.0": | |
193, | |
"transformers@2.0.1": | |
108, | |
"transformers@2.0.2": | |
75, | |
"transformers@2.1.0": | |
78, | |
"transformers@2.2.0": | |
88, | |
"transformers@2.3.0": | |
91, | |
"transformers@3.0.0": | |
111, | |
"transformers@3.1.0": | |
107, | |
"transformers@3.2.0": | |
198, | |
"transformers@3.3.0": | |
96, | |
"transformers@3.4.0": | |
85, | |
"transformers@3.5.0": | |
91, | |
"transformers@3.6.0": | |
103, | |
"transformers@4.0.0": | |
80, | |
"transformers@4.1.0": | |
82, | |
"transformers@4.2.0": | |
81, | |
"transformers@5.0.0": | |
172, | |
"transformers@5.1.0": | |
82, | |
"transformers@5.2.0": | |
64, | |
"transformers@6.0.0": | |
58, | |
"tree@1.0.0": | |
107, | |
"tree@1.1.0": | |
104, | |
"tree@1.2.0": | |
99, | |
"tree@1.3.0": | |
253, | |
"tree@1.3.1": | |
355, | |
"tree@1.3.2": | |
242, | |
"tree-rose@2.0.0": | |
87, | |
"tree-rose@2.0.1": | |
91, | |
"tree-rose@3.0.0": | |
100, | |
"tree-rose@4.0.0": | |
86, | |
"tree-rose@4.0.2": | |
91, | |
"tree-sitter@0.1.2": | |
62, | |
"tree-sitter@0.1.3": | |
91, | |
"treemap@0.1.0": | |
120, | |
"treemap@0.1.1": | |
52, | |
"trie@0.0.1": | |
247, | |
"trie@0.0.2": | |
254, | |
"tritium@1.0.0": | |
493, | |
"tritium@1.0.1": | |
496, | |
"tritium@1.0.2": | |
500, | |
"tritium@1.1.0": | |
615, | |
"tropical@1.0.1": | |
41, | |
"tropical@2.0.0": | |
58, | |
"tropical@3.0.0": | |
53, | |
"tropical@4.0.0": | |
81, | |
"trout@0.4.0": | |
-704, | |
"trout@0.4.1": | |
-710, | |
"trout@0.5.0": | |
-496, | |
"trout@0.6.0": | |
-398, | |
"trout@0.7.0": | |
614, | |
"trout@0.8.0": | |
616, | |
"trout@0.8.1": | |
617, | |
"trout@0.9.0": | |
621, | |
"trout@0.9.1": | |
621, | |
"trout@0.10.0": | |
779, | |
"trout@0.11.0": | |
525, | |
"trout@0.12.0": | |
-557, | |
"trout@0.12.1": | |
487, | |
"trout@0.12.2": | |
492, | |
"trout@0.12.3": | |
463, | |
"trout-client@0.7.0": | |
1415, | |
"trout-client@0.8.0": | |
1265, | |
"trout-client@0.10.0": | |
1285, | |
"trout-client@0.11.0": | |
-731, | |
"trout-client@0.12.0": | |
884, | |
"trout-client@0.12.1": | |
666, | |
"trout-client@0.13.0": | |
646, | |
"tscompat@1.0.0": | |
62, | |
"tscompat@1.0.1": | |
82, | |
"tupc@0.1.0": | |
629, | |
"tupc@0.1.1": | |
583, | |
"tuples@0.2.3": | |
65, | |
"tuples@0.3.0": | |
134, | |
"tuples@0.3.1": | |
49, | |
"tuples@0.3.2": | |
67, | |
"tuples@0.3.3": | |
66, | |
"tuples@0.3.4": | |
71, | |
"tuples@0.4.0": | |
75, | |
"tuples@1.0.0": | |
140, | |
"tuples@2.0.0": | |
72, | |
"tuples@3.0.0": | |
62, | |
"tuples@3.1.0": | |
73, | |
"tuples@3.2.0": | |
70, | |
"tuples@4.0.0": | |
72, | |
"tuples@4.1.0": | |
82, | |
"tuples@5.0.0": | |
69, | |
"tuples@5.1.0": | |
127, | |
"tuples@6.0.0": | |
50, | |
"tuples@6.0.1": | |
51, | |
"tuples@7.0.0": | |
68, | |
"tuples-native@0.0.0": | |
120, | |
"tuples-native@0.0.1": | |
99, | |
"tuples-native@0.1.0": | |
207, | |
"tuples-native@1.0.0": | |
63, | |
"tuples-native@1.0.1": | |
66, | |
"tuples-native@2.0.0": | |
97, | |
"tuples-native@2.0.1": | |
100, | |
"tuples-native@2.0.2": | |
101, | |
"tuples-native@2.1.0": | |
102, | |
"turbine@0.0.1": | |
338, | |
"turbine@0.0.2": | |
447, | |
"turbine@0.0.3": | |
323, | |
"turbine@0.0.4": | |
316, | |
"turbine@0.0.5": | |
330, | |
"turbine@0.1.0": | |
347, | |
"turf@0.1.0": | |
348, | |
"turf@0.1.1": | |
454, | |
"turf@0.1.2": | |
326, | |
"turf@1.0.0": | |
111, | |
"turf@1.0.1": | |
128, | |
"tweetnacl@0.4.0": | |
128, | |
"tweetnacl@0.4.1": | |
128, | |
"tweetnacl@0.5.0": | |
127, | |
"tweetnacl@0.5.1": | |
634, | |
"tweetnacl@0.5.2": | |
501, | |
"tweetnacl@1.0.0": | |
207, | |
"twilio@0.0.1": | |
161, | |
"two-or-more@0.3.0": | |
87, | |
"two-or-more@0.4.0": | |
200, | |
"two-or-more@1.0.0": | |
75, | |
"twoset@0.1.0": | |
43, | |
"type-equality@1.0.0": | |
56, | |
"type-equality@1.1.0": | |
73, | |
"type-equality@2.0.0": | |
63, | |
"type-equality@2.1.0": | |
82, | |
"type-equality@3.0.0": | |
65, | |
"type-equality@4.0.0": | |
133, | |
"type-equality@4.0.1": | |
63, | |
"type-isequal@0.1.0": | |
49, | |
"typeable@0.0.1": | |
56, | |
"typeable@0.0.2": | |
71, | |
"typeable@0.0.3": | |
-71, | |
"typeable@1.0.0": | |
83, | |
"typeable@2.0.0": | |
148, | |
"typeable@3.0.0": | |
322, | |
"typedarray@0.5.2": | |
43, | |
"typedarray@1.0.0": | |
53, | |
"typedarray@1.0.1": | |
64, | |
"typedarray@1.1.0": | |
79, | |
"typedarray@1.2.0": | |
70, | |
"typedarray@1.2.1": | |
146, | |
"typedarray@1.2.2": | |
54, | |
"typedarray@1.2.3": | |
55, | |
"typedarray@1.2.4": | |
71, | |
"typedarray@2.0.0": | |
78, | |
"typedarray@2.1.0": | |
70, | |
"typedenv@0.0.1": | |
136, | |
"typedenv@1.0.0": | |
246, | |
"typelevel@1.0.0": | |
76, | |
"typelevel@2.0.0": | |
58, | |
"typelevel@3.0.0": | |
90, | |
"typelevel@4.0.0": | |
72, | |
"typelevel@5.0.0": | |
81, | |
"typelevel@6.0.0": | |
68, | |
"typelevel-arithmetic@0.1.0": | |
63, | |
"typelevel-codec-json@1.0.0": | |
217, | |
"typelevel-eval@0.1.0": | |
48, | |
"typelevel-eval@0.2.0": | |
64, | |
"typelevel-eval@0.3.0": | |
74, | |
"typelevel-eval@0.4.0": | |
64, | |
"typelevel-eval@0.5.0": | |
-159, | |
"typelevel-lists@0.1.0": | |
48, | |
"typelevel-lists@0.2.0": | |
56, | |
"typelevel-lists@0.3.0": | |
128, | |
"typelevel-lists@0.3.1": | |
105, | |
"typelevel-lists@1.0.0": | |
104, | |
"typelevel-lists@1.1.0": | |
96, | |
"typelevel-lists@2.0.0": | |
225, | |
"typelevel-lists@2.0.1": | |
84, | |
"typelevel-lists@2.1.0": | |
77, | |
"typelevel-peano@0.1.8": | |
74, | |
"typelevel-peano@1.0.1": | |
96, | |
"typelevel-prelude@1.0.0": | |
61, | |
"typelevel-prelude@2.0.0": | |
80, | |
"typelevel-prelude@2.1.0": | |
76, | |
"typelevel-prelude@2.2.0": | |
148, | |
"typelevel-prelude@2.3.0": | |
79, | |
"typelevel-prelude@2.3.1": | |
63, | |
"typelevel-prelude@2.4.0": | |
72, | |
"typelevel-prelude@2.5.0": | |
76, | |
"typelevel-prelude@2.6.0": | |
72, | |
"typelevel-prelude@2.7.0": | |
83, | |
"typelevel-prelude@3.0.0": | |
134, | |
"typelevel-prelude@4.0.0": | |
48, | |
"typelevel-prelude@4.0.1": | |
60, | |
"typelevel-prelude@4.0.2": | |
57, | |
"typelevel-prelude@5.0.0": | |
74, | |
"typelevel-prelude@5.0.1": | |
67, | |
"typelevel-prelude@5.0.2": | |
72, | |
"typelevel-prelude@6.0.0": | |
140, | |
"typelevel-prelude@7.0.0": | |
49, | |
"typelevel-rowlist-limits@0.0.1": | |
126, | |
"typelevel-rowlist-limits@0.0.2": | |
101, | |
"typelevel-rowlist-limits@0.0.3": | |
100, | |
"typelevel-rowlist-limits@0.0.6": | |
99, | |
"typelevel-rows@0.1.0": | |
57, | |
"typesafe-localstorage@0.0.1": | |
189, | |
"typesafe-localstorage@0.0.2": | |
81, | |
"ui@0.1.0": | |
49, | |
"ui@0.1.1": | |
78, | |
"ui@0.1.2": | |
75, | |
"ui@0.2.0": | |
74, | |
"ui@0.2.1": | |
75, | |
"ui@0.3.0": | |
158, | |
"uint@0.1.0": | |
47, | |
"uint@0.2.0": | |
56, | |
"uint@0.3.0": | |
72, | |
"uint@0.4.0": | |
85, | |
"uint@0.5.0": | |
89, | |
"uint@4.0.0": | |
66, | |
"uint@4.0.1": | |
122, | |
"uint@4.0.2": | |
45, | |
"uint@4.1.0": | |
426, | |
"uint@5.0.0": | |
56, | |
"uint@5.1.0": | |
110, | |
"uint@5.1.1": | |
225, | |
"uint@5.1.2": | |
138, | |
"uint@5.1.3": | |
134, | |
"uint@5.1.4": | |
139, | |
"uint@6.0.0": | |
120, | |
"uint@6.0.1": | |
123, | |
"uint@6.0.2": | |
89, | |
"uint@6.0.3": | |
178, | |
"uint@7.0.0": | |
71, | |
"uint-instances@0.0.0": | |
404, | |
"uint-instances@0.0.1": | |
366, | |
"uint-instances@0.0.2": | |
390, | |
"uk-modulo@1.0.0": | |
76, | |
"uk-modulo@1.0.1": | |
201, | |
"uk-modulo@1.1.0": | |
191, | |
"uk-modulo@1.2.0": | |
259, | |
"uk-modulo@1.3.0": | |
147, | |
"uk-modulo@1.4.0": | |
251, | |
"uk-modulo@1.5.0": | |
254, | |
"uk-modulo@1.6.0": | |
258, | |
"uk-modulo@1.7.0": | |
158, | |
"uk-modulo@1.8.0": | |
152, | |
"uk-modulo@1.9.0": | |
261, | |
"uk-modulo@5.0.0": | |
141, | |
"uk-modulo@5.10.0": | |
137, | |
"uk-modulo@5.20.0": | |
157, | |
"uk-modulo@5.20.1": | |
152, | |
"uk-modulo@5.30.0": | |
149, | |
"uk-modulo@5.40.0": | |
258, | |
"uk-modulo@5.50.0": | |
144, | |
"uk-modulo@5.70.0": | |
140, | |
"uk-modulo@5.80.0": | |
137, | |
"uk-modulo@5.90.0": | |
148, | |
"uk-modulo@5.90.1": | |
147, | |
"uk-modulo@6.0.0": | |
153, | |
"uk-modulo@6.12.0": | |
150, | |
"ulid@1.0.0": | |
560, | |
"ulid@2.0.0": | |
43, | |
"ulid@3.0.0": | |
128, | |
"ulid@3.0.1": | |
51, | |
"unconsable@0.0.1": | |
143, | |
"unconsable@0.0.2": | |
141, | |
"uncurried-transformers@0.1.0": | |
77, | |
"uncurried-transformers@1.0.0": | |
80, | |
"uncurried-transformers@1.1.0": | |
172, | |
"undefinable@0.1.0": | |
50, | |
"undefinable@1.0.0": | |
56, | |
"undefinable@2.0.0": | |
57, | |
"undefinable@3.0.0": | |
75, | |
"undefinable@4.0.0": | |
61, | |
"undefined@1.0.1": | |
72, | |
"undefined@1.0.2": | |
134, | |
"undefined@2.0.0": | |
49, | |
"undefined-is-not-a-problem@0.1.0": | |
210, | |
"undefined-is-not-a-problem@0.1.1": | |
181, | |
"undefined-is-not-a-problem@0.1.2": | |
178, | |
"undefined-is-not-a-problem@0.2.0": | |
113, | |
"undefined-is-not-a-problem@0.2.1": | |
107, | |
"undefined-is-not-a-problem@1.0.0": | |
208, | |
"undefined-is-not-a-problem@1.1.0": | |
83, | |
"undefined-or@1.0.0": | |
46, | |
"undefined-or@1.0.1": | |
59, | |
"unfoldable@0.3.0": | |
70, | |
"unfoldable@0.3.1": | |
73, | |
"unfoldable@0.3.2": | |
72, | |
"unfoldable@0.4.0": | |
73, | |
"unfoldable@0.4.1": | |
154, | |
"unfoldable@1.0.0": | |
53, | |
"unfoldable@1.1.0": | |
51, | |
"unfoldable@2.0.0": | |
83, | |
"unfoldable@3.0.0": | |
90, | |
"unfoldable@3.1.0": | |
95, | |
"unfoldable@3.2.0": | |
100, | |
"unfoldable@4.0.0": | |
156, | |
"unfoldable@4.0.1": | |
82, | |
"unfoldable@4.0.2": | |
73, | |
"unfoldable@4.1.0": | |
60, | |
"unfoldable@5.0.0": | |
85, | |
"unfoldable@6.0.0": | |
71, | |
"unicode@0.0.1": | |
67, | |
"unicode@1.0.0": | |
70, | |
"unicode@2.0.0": | |
153, | |
"unicode@2.0.1": | |
74, | |
"unicode@2.0.2": | |
77, | |
"unicode@3.0.0": | |
207, | |
"unicode@3.0.1": | |
335, | |
"unicode@3.0.2": | |
201, | |
"unicode@4.0.0": | |
218, | |
"unicode@4.0.1": | |
122, | |
"unicode@5.0.0": | |
77, | |
"unicode@5.0.1": | |
90, | |
"unicode@6.0.0": | |
98, | |
"unicode-prelude@0.1.0": | |
65, | |
"unicode-prelude@0.1.1": | |
82, | |
"unicode-prelude@0.1.2": | |
73, | |
"unicode-prelude@0.1.3": | |
87, | |
"unicode-prelude@0.2.0": | |
112, | |
"unicode-prelude@0.2.1": | |
46, | |
"unicode-prelude@0.2.2": | |
53, | |
"unicode-prelude@0.2.3": | |
69, | |
"unicode-prelude@0.2.4": | |
69, | |
"unique@0.0.1": | |
71, | |
"unique@0.1.0": | |
64, | |
"unique@0.2.0": | |
75, | |
"unique@0.2.1": | |
128, | |
"unique@0.2.2": | |
53, | |
"unique@0.2.3": | |
52, | |
"unique@0.3.0": | |
56, | |
"unique@0.4.0": | |
68, | |
"unique@0.5.0": | |
79, | |
"unique-lists@0.0.1": | |
297, | |
"unlift@1.0.0": | |
205, | |
"unlift@1.0.1": | |
-304, | |
"unordered-collections@0.2.0": | |
39, | |
"unordered-collections@1.0.0": | |
55, | |
"unordered-collections@1.0.1": | |
73, | |
"unordered-collections@1.1.0": | |
104, | |
"unordered-collections@1.2.0": | |
100, | |
"unordered-collections@1.3.0": | |
98, | |
"unordered-collections@1.4.0": | |
196, | |
"unordered-collections@1.5.0": | |
97, | |
"unordered-collections@1.6.0": | |
81, | |
"unordered-collections@1.7.0": | |
84, | |
"unordered-collections@1.8.0": | |
97, | |
"unordered-collections@1.8.1": | |
94, | |
"unordered-collections@1.8.2": | |
93, | |
"unordered-collections@1.8.3": | |
94, | |
"unordered-collections@1.9.0": | |
176, | |
"unordered-collections@1.9.1": | |
90, | |
"unordered-collections@1.9.2": | |
88, | |
"unordered-collections@1.10.0": | |
85, | |
"unordered-collections@2.0.0": | |
103, | |
"unordered-collections@2.1.0": | |
97, | |
"unordered-collections@2.1.1": | |
96, | |
"unordered-collections@2.1.2": | |
95, | |
"unordered-collections@2.1.3": | |
193, | |
"unordered-collections@2.1.4": | |
85, | |
"unordered-collections@3.0.0": | |
81, | |
"unordered-collections@3.0.1": | |
73, | |
"unorm@0.0.0": | |
60, | |
"unorm@1.0.0": | |
73, | |
"unorm@1.0.1": | |
68, | |
"unsafe-coerce@0.1.1": | |
68, | |
"unsafe-coerce@1.0.0": | |
79, | |
"unsafe-coerce@2.0.0": | |
140, | |
"unsafe-coerce@3.0.0": | |
46, | |
"unsafe-coerce@4.0.0": | |
54, | |
"unsafe-coerce@5.0.0": | |
60, | |
"unsafe-coerce@6.0.0": | |
73, | |
"unsafe-reference@1.0.0": | |
64, | |
"unsafe-reference@2.0.0": | |
105, | |
"unsafe-reference@3.0.0": | |
73, | |
"unsafe-reference@3.0.1": | |
81, | |
"unsafe-reference@3.1.0": | |
151, | |
"unsafe-reference@4.0.0": | |
46, | |
"unsafe-reference@5.0.0": | |
52, | |
"untagged-to-tagged@0.1.3": | |
151, | |
"untagged-union@0.1.1": | |
154, | |
"untagged-union@0.1.4": | |
108, | |
"untagged-union@0.2.0": | |
149, | |
"untagged-union@0.3.0": | |
113, | |
"untagged-union@1.0.0": | |
211, | |
"uri@0.2.0": | |
83, | |
"uri@0.2.1": | |
76, | |
"uri@0.2.2": | |
88, | |
"uri@0.2.3": | |
89, | |
"uri@0.2.4": | |
86, | |
"uri@0.3.0": | |
87, | |
"uri@0.3.1": | |
177, | |
"uri@1.0.0": | |
72, | |
"uri@2.0.0": | |
247, | |
"uri@2.0.1": | |
185, | |
"uri@3.0.0": | |
370, | |
"uri@3.0.1": | |
338, | |
"uri@3.1.0": | |
326, | |
"uri@4.0.0": | |
326, | |
"uri@4.0.1": | |
465, | |
"uri@4.0.2": | |
307, | |
"uri@4.1.0": | |
363, | |
"uri@4.1.1": | |
372, | |
"uri@4.2.0": | |
379, | |
"uri@4.2.1": | |
357, | |
"uri@4.2.2": | |
508, | |
"uri@4.2.3": | |
371, | |
"uri@4.2.4": | |
359, | |
"uri@5.0.0": | |
305, | |
"uri@5.1.0": | |
314, | |
"uri@6.0.0": | |
273, | |
"uri@6.1.0": | |
271, | |
"uri@7.0.0": | |
282, | |
"uri@8.0.0": | |
246, | |
"uri@8.0.1": | |
136, | |
"uri@9.0.0": | |
98, | |
"uri-extra@0.0.0": | |
531, | |
"uri-extra@0.0.1": | |
519, | |
"uri-extra@0.0.2": | |
603, | |
"uri-extra@0.0.3": | |
710, | |
"url-regex-safe@0.1.0": | |
76, | |
"url-validator@1.0.0": | |
45, | |
"url-validator@1.0.1": | |
75, | |
"url-validator@1.0.2": | |
67, | |
"url-validator@1.1.0": | |
67, | |
"url-validator@1.2.0": | |
85, | |
"url-validator@2.0.0": | |
111, | |
"url-validator@2.0.1": | |
49, | |
"url-validator@2.1.0": | |
51, | |
"uuid@1.0.0": | |
70, | |
"uuid@1.0.1": | |
71, | |
"uuid@1.0.2": | |
62, | |
"uuid@1.0.3": | |
76, | |
"uuid@2.0.0": | |
69, | |
"uuid@2.0.1": | |
132, | |
"uuid@3.0.0": | |
65, | |
"uuid@4.0.0": | |
55, | |
"uuid@5.0.0": | |
50, | |
"uuid@5.1.0": | |
74, | |
"uuid@5.2.0": | |
61, | |
"uuid@5.2.1": | |
74, | |
"uuid@5.2.2": | |
60, | |
"uuid@6.0.0": | |
126, | |
"uuid@6.0.1": | |
52, | |
"uuid@6.1.0": | |
481, | |
"uuid@7.0.0": | |
441, | |
"uuid@8.0.0": | |
171, | |
"uuid@9.0.0": | |
128, | |
"uuidv4@1.0.0": | |
191, | |
"validated-molecule@1.0.0": | |
74, | |
"validated-molecule@1.0.1": | |
75, | |
"validated-molecule@1.0.2": | |
79, | |
"validated-molecule@1.0.3": | |
92, | |
"validated-molecule@1.0.4": | |
84, | |
"validated-molecule@1.0.5": | |
88, | |
"validation@0.0.1": | |
140, | |
"validation@0.0.2": | |
52, | |
"validation@0.0.3": | |
52, | |
"validation@0.1.0": | |
54, | |
"validation@0.1.1": | |
71, | |
"validation@0.2.0": | |
69, | |
"validation@0.2.1": | |
64, | |
"validation@1.0.0": | |
76, | |
"validation@2.0.0": | |
132, | |
"validation@3.0.0": | |
48, | |
"validation@3.1.0": | |
59, | |
"validation@3.2.0": | |
73, | |
"validation@4.0.0": | |
81, | |
"validation@4.1.0": | |
85, | |
"validation@4.2.0": | |
121, | |
"validation@5.0.0": | |
103, | |
"validation@6.0.0": | |
52, | |
"value-of-information@0.0.1": | |
256, | |
"value-of-information@0.1.0": | |
212, | |
"var@0.0.1": | |
68, | |
"var@0.0.2": | |
69, | |
"var@0.1.0": | |
68, | |
"var@0.2.0": | |
62, | |
"var@1.0.0": | |
156, | |
"var@2.0.0": | |
98, | |
"var@3.0.0": | |
56, | |
"variant@1.0.0": | |
88, | |
"variant@1.0.1": | |
83, | |
"variant@1.1.0": | |
162, | |
"variant@2.0.0": | |
187, | |
"variant@2.1.0": | |
155, | |
"variant@3.0.0": | |
160, | |
"variant@3.1.0": | |
167, | |
"variant@3.2.0": | |
166, | |
"variant@3.2.1": | |
169, | |
"variant@4.0.0": | |
254, | |
"variant@4.1.0": | |
162, | |
"variant@5.0.0": | |
82, | |
"variant@5.1.0": | |
85, | |
"variant@5.2.0": | |
97, | |
"variant@6.0.0": | |
99, | |
"variant@6.0.1": | |
103, | |
"variant@7.0.0": | |
99, | |
"variant@7.0.1": | |
204, | |
"variant@7.0.2": | |
97, | |
"variant@7.0.3": | |
76, | |
"variant@7.1.0": | |
84, | |
"variant@8.0.0": | |
86, | |
"vary@0.1.0": | |
368, | |
"vary@0.2.0": | |
694, | |
"vary@1.0.0": | |
285, | |
"vault@0.1.0": | |
158, | |
"vdom@1.0.0": | |
-213, | |
"vdom@2.0.0": | |
-348, | |
"vdom@2.0.1": | |
-355, | |
"vdom@2.0.2": | |
-359, | |
"vector@1.0.0": | |
190, | |
"vector@1.0.1": | |
200, | |
"vector@1.0.3": | |
314, | |
"vector@1.0.4": | |
178, | |
"vector@1.0.5": | |
177, | |
"vector@1.0.6": | |
190, | |
"vector@1.0.7": | |
195, | |
"vector@1.1.0": | |
233, | |
"vector@1.2.0": | |
304, | |
"vector@2.0.0": | |
443, | |
"vector-space@0.0.1": | |
48, | |
"vector-space@0.1.0": | |
-67, | |
"vectorfield@1.0.0": | |
110, | |
"vectorfield@1.0.1": | |
120, | |
"vectors@1.0.0": | |
-300, | |
"vectors@1.0.1": | |
298, | |
"vectors@1.0.2": | |
417, | |
"vectors@1.1.0": | |
285, | |
"vega@0.0.1": | |
372, | |
"vega@1.0.0": | |
236, | |
"veither@1.0.0": | |
71, | |
"veither@1.0.1": | |
178, | |
"veither@1.0.2": | |
114, | |
"veither@1.0.3": | |
255, | |
"veither@1.0.4": | |
102, | |
"veither@1.0.5": | |
161, | |
"veither@1.0.6": | |
191, | |
"verbal-expressions@0.2.1": | |
83, | |
"verbal-expressions@1.0.0": | |
78, | |
"verbal-expressions@1.0.1": | |
81, | |
"verbal-expressions@2.0.0": | |
-404, | |
"verbal-expressions@3.0.0": | |
295, | |
"verbal-expressions@4.0.0": | |
131, | |
"versions@0.1.1": | |
65, | |
"versions@2.0.0": | |
76, | |
"versions@3.0.0": | |
196, | |
"versions@3.0.1": | |
194, | |
"versions@4.0.0": | |
253, | |
"versions@5.0.0": | |
299, | |
"versions@5.0.1": | |
160, | |
"versions@6.0.0": | |
101, | |
"versions@6.1.0": | |
100, | |
"versions@7.0.0": | |
101, | |
"vexceptt@1.0.0": | |
225, | |
"vexceptt@1.0.1": | |
229, | |
"vexceptt@1.0.2": | |
333, | |
"vexceptt@2.0.0": | |
225, | |
"vexflow@0.1.0": | |
139, | |
"virtual-dom@0.1.0": | |
41, | |
"virtual-dom@0.2.0": | |
74, | |
"virtual-dom@0.3.0": | |
67, | |
"virtual-dom-typed@0.0.2": | |
-74, | |
"virtual-dom-typed@0.1.0": | |
-69, | |
"virtual-dom-typed@0.1.1": | |
166, | |
"virtual-dom-typed@0.1.2": | |
70, | |
"visx@0.0.1": | |
133, | |
"vnm-utility@0.0.1": | |
456, | |
"vnm-utility@1.0.0": | |
377, | |
"vnm-utility@2.0.0": | |
374, | |
"vnm-utility@3.0.0": | |
120, | |
"void@0.1.0": | |
62, | |
"void@0.2.0": | |
157, | |
"void@0.2.1": | |
88, | |
"void@0.3.0": | |
61, | |
"vom@0.1.0": | |
-280, | |
"vom@0.1.1": | |
-241, | |
"vom@0.1.2": | |
-238, | |
"vom@0.1.3": | |
-239, | |
"vom@0.1.4": | |
-366, | |
"vom@1.0.0": | |
538, | |
"vom@1.1.0": | |
403, | |
"vom@1.1.1": | |
395, | |
"vom@1.1.2": | |
399, | |
"vom@1.2.0": | |
508, | |
"vom@1.3.0": | |
535, | |
"vom@1.4.0": | |
694, | |
"vom@1.5.0": | |
514, | |
"vom@1.6.0": | |
506, | |
"wamp@0.0.1": | |
305, | |
"wamp@0.0.2": | |
315, | |
"wamp@0.0.3": | |
314, | |
"web-clipboard@1.0.0": | |
472, | |
"web-clipboard@2.0.0": | |
624, | |
"web-clipboard@3.0.0": | |
203, | |
"web-clipboard@4.0.0": | |
141, | |
"web-clipboard@4.1.0": | |
126, | |
"web-clipboard@5.0.0": | |
131, | |
"web-cssom@1.0.0": | |
228, | |
"web-cssom@2.0.0": | |
173, | |
"web-dom@1.0.0": | |
368, | |
"web-dom@2.0.0": | |
263, | |
"web-dom@3.0.0": | |
257, | |
"web-dom@3.1.0": | |
270, | |
"web-dom@4.0.0": | |
274, | |
"web-dom@4.0.1": | |
274, | |
"web-dom@4.0.2": | |
394, | |
"web-dom@4.1.0": | |
268, | |
"web-dom@5.0.0": | |
124, | |
"web-dom@6.0.0": | |
113, | |
"web-dom-parser@5.0.0": | |
296, | |
"web-dom-parser@6.0.0": | |
297, | |
"web-dom-parser@6.1.0": | |
388, | |
"web-dom-parser@6.1.1": | |
292, | |
"web-dom-parser@7.0.0": | |
139, | |
"web-dom-parser@8.0.0": | |
111, | |
"web-dom-xpath@1.0.0": | |
353, | |
"web-dom-xpath@1.0.1": | |
258, | |
"web-dom-xpath@1.0.2": | |
256, | |
"web-dom-xpath@1.1.0": | |
274, | |
"web-dom-xpath@1.2.0": | |
273, | |
"web-dom-xpath@1.2.1": | |
366, | |
"web-dom-xpath@1.2.2": | |
247, | |
"web-dom-xpath@2.0.0": | |
150, | |
"web-dom-xpath@2.0.1": | |
152, | |
"web-dom-xpath@3.0.0": | |
135, | |
"web-encoding@1.0.0": | |
66, | |
"web-encoding@2.0.0": | |
72, | |
"web-encoding@3.0.0": | |
60, | |
"web-events@1.0.0": | |
249, | |
"web-events@1.0.1": | |
148, | |
"web-events@2.0.0": | |
144, | |
"web-events@2.0.1": | |
142, | |
"web-events@3.0.0": | |
109, | |
"web-events@4.0.0": | |
100, | |
"web-fetch@1.0.0": | |
228, | |
"web-fetch@1.0.1": | |
231, | |
"web-fetch@2.0.0": | |
249, | |
"web-fetch@3.0.0": | |
110, | |
"web-file@1.0.0": | |
257, | |
"web-file@1.1.0": | |
255, | |
"web-file@1.2.0": | |
261, | |
"web-file@2.0.0": | |
260, | |
"web-file@2.1.0": | |
265, | |
"web-file@2.1.1": | |
268, | |
"web-file@2.1.2": | |
373, | |
"web-file@2.2.0": | |
247, | |
"web-file@2.3.0": | |
248, | |
"web-file@3.0.0": | |
131, | |
"web-file@4.0.0": | |
114, | |
"web-file-directory-entries@0.1.0": | |
318, | |
"web-html@1.0.0": | |
523, | |
"web-html@1.1.0": | |
371, | |
"web-html@1.1.1": | |
366, | |
"web-html@1.2.0": | |
373, | |
"web-html@2.0.0": | |
379, | |
"web-html@2.0.1": | |
383, | |
"web-html@2.1.0": | |
383, | |
"web-html@2.2.0": | |
494, | |
"web-html@2.2.1": | |
383, | |
"web-html@2.2.2": | |
370, | |
"web-html@2.3.0": | |
370, | |
"web-html@3.0.0": | |
178, | |
"web-html@3.0.1": | |
177, | |
"web-html@3.1.0": | |
178, | |
"web-html@3.2.0": | |
179, | |
"web-html@3.2.1": | |
286, | |
"web-html@4.0.0": | |
131, | |
"web-html@4.1.0": | |
127, | |
"web-pointerevents@1.0.0": | |
133, | |
"web-proletarian@0.1.0": | |
109, | |
"web-proletarian@0.1.1": | |
62, | |
"web-proletarian@1.0.0": | |
70, | |
"web-promise@1.0.0": | |
163, | |
"web-promise@1.0.1": | |
58, | |
"web-promise@1.0.2": | |
60, | |
"web-promise@1.0.3": | |
73, | |
"web-promise@2.0.0": | |
83, | |
"web-promise@2.0.1": | |
81, | |
"web-promise@2.1.0": | |
176, | |
"web-promise@3.0.0": | |
92, | |
"web-promise@3.1.0": | |
61, | |
"web-resize-observer@1.0.0": | |
111, | |
"web-router@0.0.2": | |
298, | |
"web-router@0.0.3": | |
299, | |
"web-router@0.0.4": | |
298, | |
"web-router@0.1.0": | |
300, | |
"web-router@0.2.0": | |
398, | |
"web-router@0.2.1": | |
280, | |
"web-router@0.3.0": | |
160, | |
"web-router@1.0.0": | |
114, | |
"web-socket@1.0.0": | |
342, | |
"web-socket@2.0.0": | |
344, | |
"web-socket@3.0.0": | |
273, | |
"web-socket@4.0.0": | |
127, | |
"web-speech@0.1.0": | |
126, | |
"web-speech@0.1.1": | |
124, | |
"web-speech@0.2.0": | |
141, | |
"web-storage@1.0.0": | |
63, | |
"web-storage@2.0.0": | |
257, | |
"web-storage@3.0.0": | |
252, | |
"web-storage@4.0.0": | |
258, | |
"web-storage@5.0.0": | |
106, | |
"web-streams@1.0.0": | |
54, | |
"web-streams@2.0.0": | |
65, | |
"web-streams@3.0.0": | |
77, | |
"web-touchevents@1.0.0": | |
1488, | |
"web-touchevents@2.0.0": | |
1574, | |
"web-touchevents@3.0.0": | |
584, | |
"web-touchevents@4.0.0": | |
282, | |
"web-uievents@1.0.0": | |
461, | |
"web-uievents@1.1.0": | |
455, | |
"web-uievents@2.0.0": | |
473, | |
"web-uievents@3.0.0": | |
220, | |
"web-uievents@4.0.0": | |
159, | |
"web-url@1.0.1": | |
344, | |
"web-url@1.0.2": | |
470, | |
"web-url@2.0.0": | |
114, | |
"web-urlsearchparams@0.0.0": | |
170, | |
"web-urlsearchparams@0.0.1": | |
172, | |
"web-workers@0.1.0": | |
63, | |
"web-workers@0.1.1": | |
70, | |
"web-workers@0.1.2": | |
68, | |
"web-workers@0.2.0": | |
186, | |
"web-workers@1.0.0": | |
95, | |
"web-workers@1.1.0": | |
95, | |
"web-xhr@1.0.0": | |
603, | |
"web-xhr@1.1.0": | |
600, | |
"web-xhr@2.0.0": | |
366, | |
"web-xhr@3.0.0": | |
260, | |
"web-xhr@3.0.1": | |
243, | |
"web-xhr@3.0.2": | |
250, | |
"web-xhr@4.0.0": | |
150, | |
"web-xhr@4.1.0": | |
153, | |
"web-xhr@5.0.0": | |
125, | |
"web3@0.1.1": | |
852, | |
"web3@0.9.0": | |
591, | |
"web3@0.10.0": | |
-412, | |
"web3@0.11.0": | |
-390, | |
"web3@0.11.1": | |
-405, | |
"web3@0.11.2": | |
-409, | |
"web3@0.11.4": | |
-513, | |
"web3@0.12.0": | |
-393, | |
"web3@0.13.0": | |
-399, | |
"web3@0.14.0": | |
-409, | |
"web3@0.15.0": | |
-422, | |
"web3@0.15.2": | |
413, | |
"web3@0.15.3": | |
407, | |
"web3@0.16.0": | |
523, | |
"web3@0.16.1": | |
385, | |
"web3@0.17.0": | |
374, | |
"web3@0.18.0": | |
385, | |
"web3@0.18.1": | |
394, | |
"web3@0.18.2": | |
398, | |
"web3@0.18.3": | |
397, | |
"web3@0.18.4": | |
510, | |
"web3@0.19.0": | |
-349, | |
"web3@0.20.0": | |
-344, | |
"web3@0.21.0": | |
-354, | |
"web3@0.22.0": | |
-378, | |
"web3@0.22.1": | |
-377, | |
"web3@0.23.0": | |
538, | |
"web3@0.23.1": | |
648, | |
"web3@0.23.2": | |
513, | |
"web3@0.23.3": | |
540, | |
"web3@0.24.0": | |
558, | |
"web3@0.25.0": | |
559, | |
"web3@0.25.1": | |
566, | |
"web3@1.0.0": | |
537, | |
"web3-generator@0.1.0": | |
-885, | |
"web3-generator@0.9.0": | |
997, | |
"web3-generator@0.10.0": | |
-939, | |
"web3-generator@0.11.0": | |
-973, | |
"web3-generator@0.12.0": | |
-1103, | |
"web3-generator@0.13.0": | |
-969, | |
"web3-generator@0.14.0": | |
-951, | |
"web3-generator@0.14.1": | |
-974, | |
"web3-generator@0.15.0": | |
-986, | |
"web3-generator@0.15.2": | |
958, | |
"web3-generator@0.15.3": | |
1081, | |
"web3-generator@0.16.0": | |
935, | |
"web3-generator@0.16.1": | |
913, | |
"web3-generator@0.17.0": | |
944, | |
"web3-generator@0.17.1": | |
938, | |
"web3-generator@0.17.2": | |
957, | |
"web3-generator@0.18.0": | |
1081, | |
"web3-generator@0.19.0": | |
-877, | |
"web3-generator@0.20.0": | |
-869, | |
"web3-generator@0.21.0": | |
-803, | |
"web3-generator@0.21.1": | |
-815, | |
"web3-generator@0.21.2": | |
-820, | |
"web3-generator@0.22.0": | |
1064, | |
"web3-generator@0.23.0": | |
858, | |
"web3-generator@0.24.0": | |
855, | |
"web3-generator@3.0.0": | |
-365, | |
"web3-generator@4.0.0": | |
-271, | |
"webapp@0.0.0": | |
-560, | |
"webaudio@0.1.0": | |
278, | |
"webaudio@0.1.1": | |
649, | |
"webaudio@0.1.2": | |
608, | |
"webaudio@0.2.0": | |
282, | |
"webaudio@0.2.1": | |
296, | |
"webcomponents@0.1.0": | |
511, | |
"webdriver@0.1.0": | |
201, | |
"webdriver@0.2.0": | |
93, | |
"webdriver@0.2.1": | |
82, | |
"webdriver@0.2.2": | |
77, | |
"webdriver@0.2.3": | |
99, | |
"webdriver@0.3.0": | |
-98, | |
"webdriver@0.3.1": | |
-98, | |
"webdriver@0.4.0": | |
-106, | |
"webdriver@0.5.0": | |
-195, | |
"webdriver@0.6.0": | |
-89, | |
"webdriver@0.6.1": | |
-84, | |
"webdriver@0.6.2": | |
-86, | |
"webdriver@0.7.0": | |
117, | |
"webdriver@0.7.1": | |
120, | |
"webdriver@0.7.2": | |
115, | |
"webdriver@0.8.0": | |
118, | |
"webdriver@0.9.0": | |
225, | |
"webdriver@0.10.0": | |
110, | |
"webdriver@0.11.0": | |
104, | |
"webdriver@0.11.1": | |
104, | |
"webdriver@0.11.2": | |
118, | |
"webdriver@0.11.3": | |
123, | |
"webdriver@0.11.4": | |
139, | |
"webdriver@0.12.0": | |
110, | |
"webdriver@0.13.0": | |
212, | |
"webdriver@0.14.0": | |
102, | |
"webdriver@0.14.1": | |
102, | |
"webdriver@0.16.0": | |
96, | |
"webdriver@0.17.0": | |
112, | |
"webdriver@0.18.0": | |
113, | |
"webdriver@0.19.0": | |
108, | |
"webdriver@1.0.0": | |
82, | |
"webdriver@2.0.0": | |
-302, | |
"webdriver@3.0.0": | |
551, | |
"webdriver@3.0.1": | |
525, | |
"webdriver@4.0.0": | |
725, | |
"webdriver@4.0.1": | |
709, | |
"webdriver@5.0.0": | |
720, | |
"webdriver@5.0.1": | |
724, | |
"webdriver@6.0.0": | |
596, | |
"weber@0.1.1": | |
40, | |
"weber@0.1.2": | |
56, | |
"weber@0.1.3": | |
57, | |
"weber@0.1.4": | |
70, | |
"webgl@1.1.0": | |
308, | |
"webgl@1.1.1": | |
301, | |
"webgl@1.1.2": | |
299, | |
"webgl@1.1.3": | |
408, | |
"webgl@1.2.0": | |
-267, | |
"webgl@1.3.0": | |
244, | |
"webgl@1.3.1": | |
259, | |
"webgl@1.3.2": | |
262, | |
"webgl@2.0.0": | |
-799, | |
"webgl@2.0.1": | |
530, | |
"webgl-examples@1.0.1": | |
457, | |
"webgl-examples@1.0.2": | |
469, | |
"webgl-examples@1.1.0": | |
-375, | |
"webgl-examples@1.2.0": | |
-237, | |
"webgl-examples@1.3.0": | |
405, | |
"webgl2-raw@1.0.0": | |
376, | |
"webidl@0.1.0": | |
154, | |
"webidl@0.2.0": | |
78, | |
"webidl@1.0.0": | |
59, | |
"webidl@1.0.1": | |
71, | |
"webidl@2.0.0": | |
288, | |
"webidl@3.0.0": | |
257, | |
"websocket-moderate@0.0.0": | |
146, | |
"websocket-moderate@0.0.1": | |
52, | |
"websocket-moderate@1.0.0": | |
65, | |
"websocket-moderate@1.0.1": | |
84, | |
"websocket-moderate@2.0.0": | |
268, | |
"websocket-moderate@2.0.1": | |
416, | |
"websocket-moderate@3.0.0": | |
460, | |
"websocket-moderate@3.1.0": | |
309, | |
"websocket-moderate@4.0.0": | |
372, | |
"websocket-moderate@5.0.0": | |
582, | |
"websocket-moderate@6.0.0": | |
604, | |
"websocket-moderate@7.0.0": | |
564, | |
"websocket-moderate@7.0.1": | |
625, | |
"websocket-moderate@7.0.2": | |
675, | |
"websocket-moderate-extra@0.0.0": | |
725, | |
"websocket-moderate-extra@0.0.1": | |
755, | |
"websocket-simple@0.0.1": | |
99, | |
"websocket-simple@0.1.0": | |
100, | |
"websocket-simple@0.2.0": | |
200, | |
"websocket-simple@0.3.0": | |
95, | |
"websocket-simple@0.4.0": | |
60, | |
"websocket-simple@0.5.0": | |
-179, | |
"websocket-simple@0.5.1": | |
-197, | |
"websocket-simple@1.0.0": | |
424, | |
"websocket-simple@1.0.1": | |
414, | |
"websocket-simple@2.0.0": | |
637, | |
"websocket-simple@3.0.0": | |
418, | |
"websocket-simple@3.0.1": | |
272, | |
"websockets-rpc@1.0.3": | |
-499, | |
"websockets-rpc@1.0.4": | |
-508, | |
"websockets-rpc@1.0.5": | |
-517, | |
"websockets-rpc@1.1.0": | |
-625, | |
"websockets-rpc@1.2.0": | |
-363, | |
"websockets-rpc@1.3.0": | |
-349, | |
"websockets-rpc@1.3.1": | |
-349, | |
"websockets-rpc@1.4.0": | |
-396, | |
"websockets-rpc@1.4.1": | |
-392, | |
"webstorage@0.0.1": | |
65, | |
"webstorage@0.1.0": | |
69, | |
"webstorage@0.2.0": | |
112, | |
"webstorage@0.3.0": | |
48, | |
"webstorage@0.4.0": | |
66, | |
"webstorage@1.0.0": | |
51, | |
"webstorage@2.0.0": | |
87, | |
"webstorage@3.0.0": | |
72, | |
"webstorage@3.0.1": | |
148, | |
"webstorage@3.0.2": | |
105, | |
"webstorage@3.0.3": | |
49, | |
"webstorage@3.0.4": | |
66, | |
"webstorage@4.0.0": | |
68, | |
"webworkers@0.1.1": | |
308, | |
"webworkers@0.1.2": | |
281, | |
"webworkers@0.2.0": | |
271, | |
"wechaty@1.0.0": | |
703, | |
"wechaty@1.0.1": | |
553, | |
"which@0.1.0": | |
66, | |
"which@1.0.0": | |
104, | |
"which@2.0.0": | |
105, | |
"wikitext@0.0.2": | |
78, | |
"wikitext@0.0.3": | |
80, | |
"wikitext@0.0.4": | |
79, | |
"wikitext@0.0.5": | |
192, | |
"wikitext@0.0.6": | |
82, | |
"winston@0.1.0": | |
50, | |
"wire@0.1.0": | |
105, | |
"wire@0.1.1": | |
105, | |
"wire@0.1.2": | |
101, | |
"wire@0.1.3": | |
102, | |
"wire@0.1.4": | |
105, | |
"wire@0.2.0": | |
263, | |
"wire@0.2.1": | |
137, | |
"wire@0.2.2": | |
134, | |
"wire@0.2.3": | |
149, | |
"wire@0.2.4": | |
148, | |
"wire@0.2.5": | |
256, | |
"wire@0.3.0": | |
215, | |
"wire@0.3.1": | |
212, | |
"wire@0.3.2": | |
209, | |
"wire@0.3.3": | |
220, | |
"wire@0.3.4": | |
222, | |
"wire@0.3.5": | |
347, | |
"wire@0.3.6": | |
218, | |
"wire@0.3.7": | |
207, | |
"wire@0.4.0": | |
411, | |
"wire@0.4.1": | |
424, | |
"wire@0.4.2": | |
217, | |
"wire@0.5.0": | |
272, | |
"with-index@1.0.0": | |
62, | |
"with-index@1.0.1": | |
162, | |
"with-index@2.0.0": | |
48, | |
"wkhtmltopdf@1.0.0": | |
131, | |
"wkhtmltopdf@1.0.1": | |
100, | |
"word@0.1.0": | |
837, | |
"word@0.2.0": | |
815, | |
"word@0.3.0": | |
957, | |
"word@0.4.0": | |
799, | |
"word@0.4.1": | |
792, | |
"words-lines@0.0.1": | |
59, | |
"words-lines@0.0.2": | |
85, | |
"words-lines@0.0.3": | |
78, | |
"words-lines@0.0.4": | |
80, | |
"words-lines@0.0.5": | |
173, | |
"workers@1.0.0": | |
327, | |
"workers@2.0.0": | |
441, | |
"workers@2.1.0": | |
737, | |
"workly@0.1.0": | |
118, | |
"workly@0.1.1": | |
123, | |
"wrappable@1.0.0": | |
56, | |
"ws@0.0.1": | |
644, | |
"ws@0.0.2": | |
743, | |
"xhr@0.4.0": | |
48, | |
"xiaomian@0.1.0": | |
95, | |
"xorshift@0.0.1": | |
60, | |
"xorshift@1.0.0": | |
89, | |
"xorshift@2.0.0": | |
73, | |
"xorshift@3.0.0": | |
156, | |
"xorshift@3.0.1": | |
90, | |
"xpath@0.1.0": | |
174, | |
"xpath-like@1.0.0": | |
41, | |
"xpath-like@1.0.1": | |
65, | |
"xpath-like@2.0.0": | |
71, | |
"xpath-like@3.0.0": | |
67, | |
"xstream@0.1.0": | |
78, | |
"xstream@0.1.1": | |
164, | |
"xstream@0.1.2": | |
78, | |
"xstream@0.2.0": | |
61, | |
"xstream@0.2.1": | |
68, | |
"xstream@0.3.0": | |
68, | |
"xstream@0.4.0": | |
88, | |
"xstream@0.4.1": | |
78, | |
"xstream@0.4.2": | |
96, | |
"xstream@0.5.0": | |
487, | |
"xstream@0.6.0": | |
324, | |
"xstream@0.6.1": | |
297, | |
"xstream@0.7.0": | |
361, | |
"xstream@0.8.0": | |
321, | |
"xstream@0.9.0": | |
606, | |
"xstream@0.9.1": | |
557, | |
"xstream@1.0.0": | |
685, | |
"yaml-next@0.1.0": | |
366, | |
"yaml-next@0.2.0": | |
414, | |
"yaml-next@1.0.0": | |
184, | |
"yaml-next@2.0.0": | |
398, | |
"yaml-next@3.0.0": | |
174, | |
"yaml-next@3.0.1": | |
221, | |
"yargs@0.2.1": | |
-39, | |
"yargs@0.3.0": | |
-56, | |
"yargs@0.4.0": | |
74, | |
"yargs@0.5.0": | |
74, | |
"yargs@0.7.2": | |
185, | |
"yargs@0.7.3": | |
73, | |
"yargs@1.0.0": | |
53, | |
"yargs@1.0.1": | |
58, | |
"yargs@2.0.0": | |
226, | |
"yargs@3.0.0": | |
191, | |
"yargs@3.0.1": | |
290, | |
"yargs@3.1.0": | |
252, | |
"yargs@4.0.0": | |
381, | |
"yarn@1.1.0": | |
50, | |
"yarn@1.2.0": | |
60, | |
"yarn@1.3.0": | |
56, | |
"yarn@1.3.1": | |
74, | |
"yarn@2.0.0": | |
173, | |
"yarn@3.0.0": | |
162, | |
"yarn@3.0.1": | |
160, | |
"yarn@4.0.0": | |
287, | |
"yayamll@0.0.1": | |
372, | |
"yayamll@0.0.2": | |
353, | |
"yayamll@1.0.0": | |
356, | |
"yayamll@1.1.0": | |
167, | |
"yayamll@1.1.1": | |
182, | |
"yesod-auth@0.1.0": | |
-166, | |
"yoga-fetch@1.0.1": | |
234, | |
"yoga-json@1.0.0": | |
85, | |
"yoga-json@1.0.1": | |
83, | |
"yoga-json@2.0.0": | |
87, | |
"yoga-json@3.0.0": | |
121, | |
"yoga-json@3.0.1": | |
113, | |
"yoga-json@3.0.2": | |
111, | |
"yoga-json@4.0.0": | |
261, | |
"yoga-json@4.0.1": | |
108, | |
"yoga-om@0.1.0": | |
86, | |
"yoga-postgres@0.1.0": | |
64, | |
"yoga-postgres@0.2.0": | |
102, | |
"yoga-postgres@0.2.1": | |
98, | |
"yoga-postgres@0.2.2": | |
97, | |
"yoga-postgres@1.0.0": | |
80, | |
"yoga-postgres@2.0.0": | |
388, | |
"yoga-postgres@3.0.0": | |
346, | |
"yoga-postgres@4.0.0": | |
281, | |
"yoga-postgres@4.1.0": | |
291, | |
"yoga-postgres@5.0.0": | |
227, | |
"yoga-postgres@6.0.0": | |
108, | |
"yoga-tree@1.0.0": | |
81, | |
"z85@0.0.0": | |
353, | |
"z85@0.0.1": | |
243, | |
"z85@0.0.2": | |
-456, | |
"zclipboard@0.1.0": | |
629, | |
"zclipboard@0.3.0": | |
108, | |
"zclipboard@1.0.0": | |
171, | |
"zclipboard@1.0.1": | |
78, | |
"zclipboard@2.0.0": | |
-210, | |
"zclipboard@3.0.0": | |
483, | |
"zeromq@0.0.0": | |
579, | |
"zeromq@0.0.1": | |
394, | |
"zeromq@0.0.2": | |
797, | |
"zeromq@0.0.3": | |
930, | |
"zeromq@0.0.4": | |
783, | |
"zeromq@0.0.5": | |
350, | |
"zeromq@0.0.6": | |
433, | |
"zeromq@0.0.7": | |
444, | |
"zeta@0.0.0": | |
399, | |
"zeta@0.0.1": | |
399, | |
"zeta@0.0.2": | |
516, | |
"zeta@0.0.3": | |
389, | |
"zeta@0.0.4": | |
373, | |
"zeta@0.0.5": | |
380, | |
"zeta@0.0.6": | |
403, | |
"zeta@1.0.0": | |
397, | |
"zeta@1.1.0": | |
453, | |
"zeta@1.2.0": | |
569, | |
"zeta@1.2.1": | |
443, | |
"zeta@1.3.0": | |
430, | |
"zeta@2.0.0": | |
440, | |
"zeta@3.0.0": | |
311, | |
"zeta@3.0.1": | |
308, | |
"zeta@4.0.0": | |
310, | |
"zeta@5.0.0": | |
338, | |
"zeta@5.0.1": | |
209, | |
"zeta@5.0.2": | |
174, | |
"zeta@5.0.3": | |
168, | |
"zeta@5.0.4": | |
184, | |
"zeta@6.0.0": | |
188, | |
"zeta-extra@0.0.0": | |
457, | |
"zeta-extra@0.0.1": | |
395, | |
"zippable@0.1.0": | |
276, | |
"zipperarray@1.0.0": | |
75, | |
"zipperarray@1.0.1": | |
78, | |
"zipperarray@1.1.0": | |
157, | |
"zmq@0.0.1": | |
-192, | |
} |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment