Created
April 21, 2016 12:33
-
-
Save Seldaek/27a141c7e21f1a1e816461b97c199930 to your computer and use it in GitHub Desktop.
PHP Ecosystem Scan
This file has been truncated, but you can view the full file.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
<?php return array ( | |
'file' => | |
array ( | |
'README' => 71549, | |
'.gitignore' => 56048, | |
'LICENSE' => 42975, | |
'.travis.yml' => 27817, | |
'phpunit.xml.dist' => 14730, | |
'phpunit.xml' => 12788, | |
'composer.lock' => 10886, | |
'.gitattributes' => 6851, | |
'CHANGELOG' => 6765, | |
'.scrutinizer.yml' => 5365, | |
'contributing' => 4027, | |
'.editorconfig' => 3550, | |
'module.php' => 2663, | |
'build.xml' => 1832, | |
'.coveralls.yml' => 1738, | |
'index.php' => 1706, | |
'.php_cs' => 1591, | |
'bootstrap.php' => 1152, | |
'makefile' => 1120, | |
'_config.php' => 1054, | |
'licence' => 1033, | |
'.htaccess' => 879, | |
'.styleci.yml' => 731, | |
'phpspec.yml' => 688, | |
'VERSION' => 685, | |
'autoload_classmap.php' => 645, | |
'autoload.php' => 641, | |
'example.php' => 628, | |
'phpcs.xml' => 619, | |
'composer.phar' => 616, | |
'.codeclimate.yml' => 577, | |
'.gitmodules' => 553, | |
'conduct' => 513, | |
'phpunit.php' => 467, | |
'COPYING' => 463, | |
'test.php' => 455, | |
'TODO' => 452, | |
'codeception.yml' => 425, | |
'CHANGES' => 393, | |
'vagrantfile' => 387, | |
'UPGRADE' => 381, | |
'config.php' => 362, | |
'start.php' => 340, | |
'package.xml' => 318, | |
'autoload_register.php' => 295, | |
'manifest.xml' => 291, | |
'phpmd.xml' => 290, | |
'autoload_function.php' => 289, | |
'phpdoc.dist.xml' => 277, | |
'install' => 254, | |
'box.json' => 246, | |
'.project' => 242, | |
'behat.yml' => 235, | |
'phpspec.yml.dist' => 231, | |
'circle.yml' => 228, | |
'logo.png' => 225, | |
'.ds_store' => 220, | |
'contributors' => 211, | |
'authors' => 202, | |
'autoloader.php' => 194, | |
'index.html' => 193, | |
'build.default.properties' => 192, | |
'init.php' => 190, | |
'notice' => 189, | |
'registration.php' => 188, | |
'server.php' => 187, | |
'.bowerrc' => 185, | |
'exception.php' => 181, | |
'yii.bat' => 180, | |
'.buildpath' => 170, | |
'requirements.php' => 170, | |
'CREDITS' => 167, | |
'apigen.neon' => 165, | |
'.env.example' => 163, | |
'modman' => 159, | |
'.semver' => 154, | |
'ext_emconf.php' => 151, | |
'.atoum.php' => 150, | |
'ruleset.xml' => 149, | |
'build.properties' => 147, | |
'artisan' => 141, | |
'mkdocs.yml' => 139, | |
'.check-author.yml' => 136, | |
'appveyor.yml' => 136, | |
'functions.php' => 133, | |
'phpdoc.xml' => 132, | |
'favicon.ico' => 131, | |
'ext_localconf.php' => 130, | |
'demo.php' => 128, | |
'change' => 123, | |
'config.xml' => 123, | |
'client.php' => 122, | |
'code-of-conduct' => 122, | |
'yii' => 122, | |
'MIT-LICENSE' => 120, | |
'helpers.php' => 116, | |
'dockerfile' => 113, | |
'widget.php' => 109, | |
'behat.yml.dist' => 109, | |
'ride.json' => 107, | |
'logo.gif' => 105, | |
'routes.php' => 102, | |
'screenshot.png' => 100, | |
'ext_tables.php' => 99, | |
'autoloadexample.php' => 97, | |
'robots' => 96, | |
'phpunit.travis.xml' => 95, | |
'icon.png' => 95, | |
'ext_icon.gif' => 94, | |
'manifest.php' => 93, | |
'doxyfile' => 92, | |
'autoload.php.dist' => 92, | |
'provides.json' => 91, | |
'build.php' => 91, | |
'extension.xml' => 91, | |
'module.json' => 90, | |
'.bootstrap.atoum.php' => 90, | |
'init_autoloader.php' => 89, | |
'docker-compose.yml' => 89, | |
'console' => 87, | |
'api.php' => 87, | |
'install.php' => 83, | |
'controller.php' => 83, | |
'readme.textile' => 83, | |
'build.sh' => 83, | |
'phpdox.xml' => 82, | |
'copyright' => 81, | |
'app.php' => 81, | |
'phpmd.xml.dist' => 81, | |
'robofile.php' => 80, | |
'gemfile' => 79, | |
'config.json' => 78, | |
'upgrade-2.2' => 78, | |
'include.php' => 76, | |
'activate.php' => 76, | |
'init' => 76, | |
'plugin.php' => 75, | |
'travis.phpunit.xml' => 74, | |
'copying.lesser' => 74, | |
'.sensiolabs.yml' => 72, | |
'init.bat' => 72, | |
'serviceprovider.php' => 71, | |
'upgrade-2.3' => 71, | |
'ext_tables.sql' => 69, | |
'cache.php' => 68, | |
'phpunit.xml.ci' => 67, | |
'code_of_conduct' => 67, | |
'router.php' => 67, | |
'upgrading' => 66, | |
'request.php' => 65, | |
'phpci.yml' => 65, | |
'application.php' => 64, | |
'test' => 63, | |
'phpunit.dist.xml' => 62, | |
'style.css' => 62, | |
'.formatter.yml' => 62, | |
'collection.php' => 62, | |
'response.php' => 62, | |
'guardfile' => 61, | |
'examples.php' => 61, | |
'config.rb' => 61, | |
'events.php' => 60, | |
'install.sh' => 60, | |
'rakefile' => 60, | |
'class.pth' => 58, | |
'phpdox.xml.dist' => 58, | |
'connection.php' => 58, | |
'cli-config.php' => 56, | |
'mailer.php' => 55, | |
'ezinfo.php' => 55, | |
'phpspec.yml.ci' => 55, | |
'.travis.env' => 54, | |
'.travis.key' => 54, | |
'composer.json~' => 53, | |
'manager.php' => 53, | |
'.travis.install' => 53, | |
'couscous.yml' => 53, | |
'sami.php' => 52, | |
'image.php' => 52, | |
'factory.php' => 52, | |
'DESCRIPTION' => 52, | |
'scrutinizer.yml' => 51, | |
'.travis.composer.config.json' => 51, | |
'.gush.yml' => 51, | |
'upgrade-2.4' => 51, | |
'readme.html' => 51, | |
'ext_conf_template' => 50, | |
'console.php' => 50, | |
'activerecord.php' => 49, | |
'test.sh' => 49, | |
'file.php' => 49, | |
'gemfile.lock' => 49, | |
'.hhconfig' => 49, | |
'.travis.php.ini' => 49, | |
'asset.php' => 48, | |
'parser.php' => 48, | |
'web.config' => 48, | |
'extension.php' => 47, | |
'sonar-project.properties' => 47, | |
'version.php' => 47, | |
'message.php' => 47, | |
'sample.php' => 46, | |
'.hgignore' => 46, | |
'.coke' => 45, | |
'.arcconfig' => 45, | |
'view.php' => 45, | |
'history' => 45, | |
'setup.php' => 44, | |
'procfile' => 44, | |
'manifest.json' => 44, | |
'.infra.json' => 44, | |
'deactivate.php' => 44, | |
'session.php' => 43, | |
'container.php' => 43, | |
'cli.php' => 43, | |
'changelog-1.0' => 43, | |
'campaignchain.yml' => 43, | |
'capfile' => 43, | |
'form.php' => 43, | |
'box.json.dist' => 42, | |
'puli.json' => 42, | |
'database.php' => 42, | |
'license-mit' => 42, | |
'package.php' => 42, | |
'peridot.php' => 42, | |
'elefant.json' => 41, | |
'loader.php' => 41, | |
'search.php' => 41, | |
'user.php' => 41, | |
'.state' => 41, | |
'language.xml' => 41, | |
'.dunitconfig' => 41, | |
'.rmt.yml' => 40, | |
'change.xml' => 40, | |
'admin.php' => 40, | |
'screenshot-1.png' => 40, | |
'travis.php.ini' => 40, | |
'base.php' => 39, | |
'event.php' => 39, | |
'ext_icon.png' => 39, | |
'phinx.yml' => 39, | |
'pallo.json' => 39, | |
'.env' => 39, | |
'phprelease.ini' => 38, | |
'screenshot.jpg' => 38, | |
'query.php' => 38, | |
'phpcs.xml.dist' => 37, | |
'curl.php' => 37, | |
'template_map.php' => 37, | |
'.gitreview' => 37, | |
'shippable.yml' => 37, | |
'runtests.sh' => 37, | |
'default-enable' => 37, | |
'coverage-checker.php' => 37, | |
'uninstall.php' => 37, | |
'.old-scrutinizer.yml' => 36, | |
'versioning' => 36, | |
'html.php' => 36, | |
'.travis.sh' => 36, | |
'gulpfile.js' => 36, | |
'package.ini' => 36, | |
'route.php' => 36, | |
'.jshintrc' => 36, | |
'phpunit.phar' => 36, | |
'_tests_bootstrap.php' => 36, | |
'phpunit' => 35, | |
'codeception.dist.yml' => 35, | |
'ini.php' => 34, | |
'plugin.xml' => 34, | |
'assets.php' => 34, | |
'release' => 34, | |
'documentation' => 34, | |
'cacert.pem' => 34, | |
'roadmap' => 34, | |
'.sami.php' => 34, | |
'descriptor.php' => 33, | |
'repository.php' => 33, | |
'options.php' => 33, | |
'main.php' => 33, | |
'.package.yml' => 32, | |
'config.yml' => 32, | |
'wp-cli.yml' => 32, | |
'generate-api.sh' => 32, | |
'.dockerignore' => 31, | |
'page.php' => 31, | |
'phpunit.xml.travis' => 31, | |
'icon.svg' => 31, | |
'command.php' => 31, | |
'activefield.php' => 31, | |
'header.php' => 31, | |
'news' => 31, | |
'tests.php' => 30, | |
'http.php' => 30, | |
'helper.php' => 30, | |
'unlicense' => 30, | |
'constants.php' => 29, | |
'model.php' => 29, | |
'validator.php' => 29, | |
'settings.php' => 29, | |
'run-tests.sh' => 29, | |
'cs.sh' => 29, | |
'build.properties.dev' => 29, | |
'core.php' => 29, | |
'db.php' => 29, | |
'packages.json' => 29, | |
'.php_cs.dist' => 29, | |
'auth.php' => 29, | |
'.atoum.bootstrap.php' => 28, | |
'license_afl' => 28, | |
'readme.mkd' => 28, | |
'footer.php' => 28, | |
'.tavis.yml' => 28, | |
'src.php' => 28, | |
'tests.xml' => 28, | |
'phpunit.sh' => 28, | |
'wercker.yml' => 28, | |
'build.properties.default' => 27, | |
'menu.php' => 27, | |
'.phpspec_cs' => 27, | |
'activeform.php' => 27, | |
'configuration.php' => 27, | |
'phpunit-bootstrap.php' => 27, | |
'installer.php' => 27, | |
'.travis.composer.php' => 27, | |
'button.php' => 27, | |
'logger.php' => 26, | |
'nav.php' => 26, | |
'dispatcher.php' => 26, | |
'generator.php' => 26, | |
'update.php' => 26, | |
'activequery.php' => 26, | |
'phpmd.sh' => 26, | |
'stub.php' => 25, | |
'translation.php' => 25, | |
'run_tests.sh' => 25, | |
'build.jenkins.xml' => 25, | |
'redirect.php' => 25, | |
'registry.php' => 25, | |
'assetbundle.php' => 25, | |
'benchmark.php' => 25, | |
'make-toc' => 25, | |
'upgrade-2.0' => 25, | |
'php.ini' => 25, | |
'component.php' => 25, | |
'makedoc.sh' => 25, | |
'init.sh' => 25, | |
'release-notes' => 25, | |
'.mailmap' => 25, | |
'icon.php' => 25, | |
'humans' => 25, | |
'error.php' => 25, | |
'url.php' => 25, | |
'template.php' => 25, | |
'json.php' => 25, | |
'migration.php' => 25, | |
'humbug.json.dist' => 24, | |
'callback.php' => 24, | |
'phing.xml' => 24, | |
'datepicker.php' => 24, | |
'phpunit.hhvm.xml' => 24, | |
'fontawesomeasset.php' => 24, | |
'ext_autoload.php' => 24, | |
'dropdown.php' => 24, | |
'service.php' => 24, | |
'pom.xml' => 24, | |
'boot.php' => 24, | |
'phpunit-ci.xml' => 23, | |
'docs' => 23, | |
'manifest.yml' => 23, | |
'ext.php' => 23, | |
'screenshot-2.png' => 23, | |
'readme_ru' => 23, | |
'config.ini' => 23, | |
'facadeprovider.php' => 23, | |
'environment.php' => 23, | |
'readme.ru' => 23, | |
'util.php' => 23, | |
'coverage.clover' => 22, | |
'koharness.php' => 22, | |
'filesystem.php' => 22, | |
'log.php' => 22, | |
'run.php' => 22, | |
'.config' => 22, | |
'setup' => 22, | |
'.gitlab-ci.yml' => 22, | |
'readme.md~' => 22, | |
'cron.php' => 22, | |
'querybuilder.php' => 22, | |
'worker.php' => 22, | |
'.phpdoc-md' => 22, | |
'.travis.install.sh' => 22, | |
'infra.php' => 22, | |
'login.php' => 21, | |
'debug.php' => 21, | |
'dependencies.ini' => 21, | |
'finder.php' => 21, | |
'codesniffer.ruleset.xml' => 21, | |
'.drone.yml' => 21, | |
'momentasset.php' => 21, | |
'api' => 21, | |
'sidebar.php' => 21, | |
'config.yml.dist' => 20, | |
'setup.sh' => 20, | |
'metadata.php' => 20, | |
'config.php.dist' => 20, | |
'load.php' => 20, | |
'rmt.json' => 20, | |
'classloader.php' => 20, | |
'wp-config.php' => 20, | |
'module-config.json' => 20, | |
'alert.php' => 20, | |
'markdown.php' => 20, | |
'build' => 20, | |
'rmt' => 20, | |
'filter.php' => 20, | |
'composer.yml' => 19, | |
'404.php' => 19, | |
'navbar.php' => 19, | |
'post-install' => 19, | |
'tcpdf.php' => 19, | |
'travis.yml' => 19, | |
'.composer-auth.json' => 19, | |
'releases.json' => 19, | |
'notes' => 19, | |
'single.php' => 19, | |
'license-2.0' => 19, | |
'backmatter' => 19, | |
'common.php' => 19, | |
'utils.php' => 19, | |
'.dreamfactory.php' => 19, | |
'mail.php' => 19, | |
'bundle.php' => 19, | |
'tinymce.php' => 19, | |
'coreasset.php' => 18, | |
'phpcs-ruleset.xml' => 18, | |
'upgrade-3.0' => 18, | |
'bob_config.php' => 18, | |
'.appveyor.yml' => 18, | |
'scripthandler.php' => 18, | |
'handler.php' => 18, | |
'builder.php' => 18, | |
'release_notes' => 18, | |
'dynamicreturntypemeta.json' => 18, | |
'license-agpl' => 18, | |
'archive.php' => 18, | |
'tinymceasset.php' => 18, | |
'phpunit_bootstrap.php' => 18, | |
'translator.php' => 18, | |
'license-commercial-websites' => 18, | |
'usage' => 18, | |
'jfusion.xml' => 18, | |
'graph.php' => 18, | |
'update' => 18, | |
'license-commercial-website' => 18, | |
'dev.phpunit.xml' => 18, | |
'license-commercial-saas' => 18, | |
'map.php' => 18, | |
'index-test.php' => 17, | |
'deps' => 17, | |
'contribute' => 17, | |
'changelog.yml' => 17, | |
'action.php' => 17, | |
'uploader.php' => 17, | |
'arr.php' => 17, | |
'readme_en' => 17, | |
'ext_typoscript_setup' => 17, | |
'build.local.xml' => 17, | |
'errorhandler.php' => 17, | |
'fig.yml' => 17, | |
'exampleconfig.yaml' => 17, | |
'autoload.json' => 17, | |
'docs.php' => 17, | |
'connect.php' => 17, | |
'clearsessions.php' => 17, | |
'bootstrap.hh' => 17, | |
'upgrade-1.1' => 17, | |
'config-sample.php' => 17, | |
'component.json' => 16, | |
'peridot.hh' => 16, | |
'openid.php' => 16, | |
'xvengine.json' => 16, | |
'sage.config' => 16, | |
'table.php' => 16, | |
'screenshot-3.png' => 16, | |
'views.php' => 16, | |
'select2asset.php' => 16, | |
'.travis.composer.json' => 16, | |
'clientinterface.php' => 16, | |
'gridview.php' => 16, | |
'.atoum.travis.php' => 16, | |
'changelog-1.1' => 16, | |
'tcpdf_parser.php' => 16, | |
'tasks' => 16, | |
'html.inc' => 16, | |
'change_log' => 16, | |
'review' => 15, | |
'panel.php' => 15, | |
'modal.php' => 15, | |
'breadcrumbs.php' => 15, | |
'cacheinterface.php' => 15, | |
'infra.js' => 15, | |
'nginx.conf' => 15, | |
'sms.php' => 15, | |
'ckeditor.php' => 15, | |
'bootstrap.php.dist' => 15, | |
'queue.php' => 15, | |
'testrunner.yml' => 15, | |
'readme.ja' => 15, | |
'starter.php' => 15, | |
'travis-php.ini' => 15, | |
'.php_cs.php' => 15, | |
'deploy.sh' => 15, | |
'copying lesser' => 15, | |
'.arclint' => 15, | |
'testing' => 15, | |
'.phpstorm.meta.php' => 15, | |
'xmlrpc.php' => 15, | |
'storage.php' => 15, | |
'migrations.yml' => 15, | |
'datetimepicker.php' => 15, | |
'config.example.php' => 15, | |
'.env.dist' => 15, | |
'faq' => 15, | |
'phpunit.bat' => 14, | |
'composer.php' => 14, | |
'psr2tabs.xml' => 14, | |
'inputwidget.php' => 14, | |
'examples' => 14, | |
'codesniffer' => 14, | |
'kernel.php' => 14, | |
'paginator.php' => 14, | |
'htaccess' => 14, | |
'xml.php' => 14, | |
'phpcompatinfo.json' => 14, | |
'bootstrap.sh' => 14, | |
'.travis.coverage.sh' => 14, | |
'pagination.php' => 14, | |
'humbug.json' => 14, | |
'example.html' => 14, | |
'.version' => 14, | |
'run-tests' => 14, | |
'readme-git' => 14, | |
'example.png' => 14, | |
'.cloak.toml' => 14, | |
'tag.php' => 14, | |
'.travis-phpunit.xml' => 14, | |
'feed.php' => 14, | |
'date.php' => 14, | |
'lab.config' => 14, | |
'.coveralls.toml' => 14, | |
'build-pre-commit.xml' => 14, | |
'config' => 14, | |
'node.php' => 14, | |
'grumphp.yml' => 14, | |
'license.mit' => 14, | |
'comments.php' => 14, | |
'buttongroup.php' => 14, | |
'select2.php' => 13, | |
'datetimepickerasset.php' => 13, | |
'readme-ru' => 13, | |
'serializer.php' => 13, | |
'schema.php' => 13, | |
'entity.php' => 13, | |
'mpdf.php' => 13, | |
'testcase.php' => 13, | |
'datepickerasset.php' => 13, | |
'blok.php' => 13, | |
'provision.sh' => 13, | |
'theme.php' => 13, | |
'item.php' => 13, | |
'taskfile' => 13, | |
'requirements' => 13, | |
'deploy.php' => 13, | |
'upload.php' => 13, | |
'codeclimate.sh' => 13, | |
'app.json' => 13, | |
'validation.php' => 13, | |
'.scrunitizer.yml' => 13, | |
'phar-stub.php' => 13, | |
'boxfile' => 13, | |
'progress.php' => 13, | |
'guide' => 13, | |
'result.php' => 13, | |
'author.php' => 13, | |
'.htaccess.sample' => 13, | |
'sphinxsearchbundle.php' => 13, | |
'prolog.php' => 13, | |
'oauth.php' => 13, | |
'recipe.php' => 13, | |
'default_option.php' => 12, | |
'readme.org' => 12, | |
'tcpdf_autoconfig.php' => 12, | |
'content.php' => 12, | |
'tcpdf_import.php' => 12, | |
'phpunit.xml-dist' => 12, | |
'import.php' => 12, | |
'phpunit-ci.xml.dist' => 12, | |
'phpmd-pre-commit.xml' => 12, | |
'template.xml' => 12, | |
'docblox.dist.xml' => 12, | |
'typeaheadasset.php' => 12, | |
'ueditor.php' => 12, | |
'_ide_helper.php' => 12, | |
'upgrade_to_1_2' => 12, | |
'run-test' => 12, | |
'install.xml' => 12, | |
'config_fonts.php' => 12, | |
'mpdf.css' => 12, | |
'compile.sh' => 12, | |
'inflector.php' => 12, | |
'releasenotes' => 12, | |
'wp-config-sample.php' => 12, | |
'wechat.php' => 12, | |
'cache.properties' => 12, | |
'browser.php' => 12, | |
'preview.png' => 12, | |
'tcpdf_barcodes_2d.php' => 12, | |
'install.sql' => 12, | |
'tcpdf_barcodes_1d.php' => 12, | |
'test-cov' => 12, | |
'connectioninterface.php' => 12, | |
'pearfarm.spec' => 12, | |
'package.xml.tmpl' => 12, | |
'revision' => 12, | |
'config.doxy' => 12, | |
'config.default.php' => 12, | |
'updates.php' => 12, | |
'demo.html' => 12, | |
'codecept.phar' => 12, | |
'runtests' => 12, | |
'path.php' => 12, | |
'register.php' => 12, | |
'config.m4' => 12, | |
'oauthtoken.php' => 12, | |
'cli' => 12, | |
'.pullapprove.yml' => 12, | |
'rss.php' => 12, | |
'index' => 12, | |
'update.sh' => 11, | |
'compress.php' => 11, | |
'gpl' => 11, | |
'wp-links-opml.php' => 11, | |
'progbar.css' => 11, | |
'wp-settings.php' => 11, | |
'wp-mail.php' => 11, | |
'wp-login.php' => 11, | |
'wp-load.php' => 11, | |
'phpconfig.ini' => 11, | |
'color.php' => 11, | |
'.directory' => 11, | |
'wp-trackback.php' => 11, | |
'data.php' => 11, | |
'wp-cron.php' => 11, | |
'wp-comments-post.php' => 11, | |
'homestead' => 11, | |
'wp-blog-header.php' => 11, | |
'wp-activate.php' => 11, | |
'wp-signup.php' => 11, | |
'samson.php' => 11, | |
'props.json' => 11, | |
'compiler.php' => 11, | |
'lib.php' => 11, | |
'logout.php' => 11, | |
'container.yml' => 11, | |
'cookie.php' => 11, | |
'license.lgpl' => 11, | |
'usermodule.php' => 11, | |
'yii.php' => 11, | |
'class.ext_update.php' => 11, | |
'activefixture.php' => 11, | |
'mysql.php' => 11, | |
'export.php' => 11, | |
'config.sample.php' => 11, | |
'.hgtags' => 11, | |
'upgrade-2.1' => 11, | |
'tabs.php' => 11, | |
'assets.json' => 11, | |
'runner.php' => 11, | |
'release.sh' => 11, | |
'404.html' => 11, | |
'usage.php' => 11, | |
'setting.php' => 11, | |
'document.php' => 11, | |
'typecheck' => 11, | |
'di.yml' => 11, | |
'phpspec.hhvm.yml' => 11, | |
'str.php' => 11, | |
'changelog-2.0' => 11, | |
'dumper.php' => 11, | |
'composers.php' => 11, | |
'crossdomain.xml' => 11, | |
'field.php' => 11, | |
'phpunit.bootstrap.php' => 11, | |
'daterangepicker.php' => 11, | |
'resetter.php' => 10, | |
'oauth2.php' => 10, | |
'payment.php' => 10, | |
'phpunit.coverage.xml' => 10, | |
'fileloader.php' => 10, | |
'php.ini.sample' => 10, | |
'qrcode.php' => 10, | |
'sidenav.php' => 10, | |
'tests.sh' => 10, | |
'text.php' => 10, | |
'.bumpversion.cfg' => 10, | |
'phakefile' => 10, | |
'daterangepickerasset.php' => 10, | |
'sitemap.php' => 10, | |
'get.php' => 10, | |
'task.php' => 10, | |
'.run' => 10, | |
'test.html' => 10, | |
'store.php' => 10, | |
'create-phar.php' => 10, | |
'bootstrap-dev.php' => 10, | |
'doxygen.conf' => 10, | |
'apigen.yml' => 10, | |
'kindeditorasset.php' => 10, | |
'adminasset.php' => 10, | |
'license.html' => 10, | |
'nitpick.json' => 10, | |
'qa-tools.json' => 10, | |
'adminmodule.php' => 10, | |
'readme.asciidoc' => 10, | |
'readme-ja' => 10, | |
'convert.php' => 10, | |
'crypt.php' => 10, | |
'globals.php' => 10, | |
'facade.php' => 10, | |
'runtests.bat' => 10, | |
'.eslintrc' => 10, | |
'slider.php' => 10, | |
'.jshintignore' => 10, | |
'info' => 10, | |
'captcha.php' => 10, | |
'vendors.php' => 10, | |
'apiary.apib' => 10, | |
'contributing.textile' => 10, | |
'ueditorasset.php' => 10, | |
'make-unit' => 10, | |
'run-tests-coverage' => 10, | |
'context.php' => 10, | |
'compile.php' => 10, | |
'module.conf.yaml' => 10, | |
'module.yaml' => 10, | |
'ajax.php' => 10, | |
'lgpl-3.0' => 10, | |
'analytics.php' => 10, | |
'formbuilder.php' => 10, | |
'autocompleteasset.php' => 10, | |
'example2.php' => 10, | |
'.travis_shell_after_success.sh' => 10, | |
'authaction.php' => 10, | |
'.travis.yml.dist' => 10, | |
'bootstrapasset.php' => 10, | |
'autoload.inc.php' => 10, | |
'splclassloader.php' => 10, | |
'invalidresponseexception.php' => 10, | |
'viewrenderer.php' => 10, | |
'uri.php' => 10, | |
'run-me.bat' => 10, | |
'bugfree.json' => 10, | |
'baseclient.php' => 10, | |
'translate.php' => 9, | |
'installation' => 9, | |
'hwioauthbundle.php' => 9, | |
'phpunit.local.xml' => 9, | |
'wrapper.php' => 9, | |
'imagecache.php' => 9, | |
'adminlteasset.php' => 9, | |
'aoe-logo.png' => 9, | |
'pager.php' => 9, | |
'app.yaml' => 9, | |
'dependencies' => 9, | |
'dco' => 9, | |
'token.php' => 9, | |
'build.xml.dist' => 9, | |
'currency.php' => 9, | |
'phpspec-ci.yml' => 9, | |
'.-travis.yml' => 9, | |
'.travis.ini' => 9, | |
'.gitignore~' => 9, | |
'argument.php' => 9, | |
'connectionfactory.php' => 9, | |
'manual' => 9, | |
'compatibility.php' => 9, | |
'theme.xml' => 9, | |
'xmlseclibs.php' => 9, | |
'group.php' => 9, | |
'object.php' => 9, | |
'security.php' => 9, | |
'changelog-0.x' => 9, | |
'.jscsrc' => 9, | |
'badge.php' => 9, | |
'htmlbuilder.php' => 9, | |
'sami-config.php' => 9, | |
'sami.config.php' => 9, | |
'lisence' => 9, | |
'phpunit-functional.xml.dist' => 9, | |
'phpunit-coverage.xml' => 9, | |
'managerregistry.php' => 9, | |
'email.php' => 9, | |
'apigen.conf' => 9, | |
'formatter.php' => 9, | |
'mddoc.xml' => 9, | |
'tutorial.php' => 9, | |
'docs.json' => 9, | |
'tags' => 9, | |
'sonatauserbundle.php' => 9, | |
'tree.php' => 9, | |
'helloworld.php' => 9, | |
'crawler.php' => 9, | |
'actioncolumn.php' => 9, | |
'paths.php' => 9, | |
'category.php' => 9, | |
'pakefile.php' => 9, | |
'example1.php' => 9, | |
'vendors.sh' => 9, | |
'composer.json.dist' => 9, | |
'composer' => 9, | |
'.phpcs.xml' => 9, | |
'i18n.php' => 9, | |
'cname' => 9, | |
'phpunit.xsd' => 9, | |
'thumbnail.php' => 9, | |
'package.sh' => 9, | |
'yiic.php' => 9, | |
'issue_template' => 9, | |
'processor.php' => 9, | |
'readme.php' => 9, | |
'lang.php' => 9, | |
'activeassets.php' => 9, | |
'development_readme' => 9, | |
'hacking' => 9, | |
'twitter.php' => 9, | |
'getting_started' => 9, | |
'daemon.php' => 9, | |
'loaderinterface.php' => 9, | |
'authentication.php' => 9, | |
'font info' => 8, | |
'copying.lib' => 8, | |
'gpl-license' => 8, | |
'bootstrap_phpunit.php' => 8, | |
'sami_docs.php' => 8, | |
'codemirrorasset.php' => 8, | |
'yaml.php' => 8, | |
'giiasset.php' => 8, | |
'spark.info' => 8, | |
'yiic' => 8, | |
'settings.gradle' => 8, | |
'elements.php' => 8, | |
'log' => 8, | |
'build.gradle' => 8, | |
'ckeditorasset.php' => 8, | |
'screenshot-index.png' => 8, | |
'screenshot-4.png' => 8, | |
'qc.yml' => 8, | |
'portkey.json' => 8, | |
'backend.php' => 8, | |
'fancyboxasset.php' => 8, | |
'readme_cn' => 8, | |
'.jms.yml' => 8, | |
'config_lang2fonts.php' => 8, | |
'simple_html_dom.php' => 8, | |
'build.bat' => 8, | |
'deploy' => 8, | |
'lang2fonts.css' => 8, | |
'config_script2lang.php' => 8, | |
'uploadbehavior.php' => 8, | |
'adwords.php' => 8, | |
'process.php' => 8, | |
'script_behat.sh' => 8, | |
'kahlan-config.php' => 8, | |
'script_phpunit.sh' => 8, | |
'.borisrc' => 8, | |
'gallerymanager.php' => 8, | |
'versions' => 8, | |
'styles.css' => 8, | |
'packagexmlsetup.php' => 8, | |
'doc' => 8, | |
'oauth1.php' => 8, | |
'index.tpl' => 8, | |
'gallerybehavior.php' => 8, | |
'htmlserviceprovider.php' => 8, | |
'collect.php' => 8, | |
'databaseserviceprovider.php' => 8, | |
'time.php' => 8, | |
'contribution' => 8, | |
'eventinterface.php' => 8, | |
'changelog-2.1' => 8, | |
'phpexcel.php' => 8, | |
'.bower.json' => 8, | |
'indexmanager.php' => 8, | |
'php-cs-fixer' => 8, | |
'injector.php' => 8, | |
'stream.php' => 8, | |
'disqus.php' => 8, | |
'setup.py' => 8, | |
'howitworks' => 8, | |
'tests.bootstrap.php' => 8, | |
'info.xml' => 8, | |
'schema.xml' => 8, | |
'job.php' => 8, | |
'sortablegridview.php' => 8, | |
'report.php' => 8, | |
'.px_execute.php' => 8, | |
'debug-test.php' => 8, | |
'driver.php' => 8, | |
'change.log' => 8, | |
'basecontroller.php' => 8, | |
'.apigen.yml' => 8, | |
'start.sh' => 8, | |
'urlmanager.php' => 8, | |
'uploadaction.php' => 8, | |
'phpcs.sh' => 8, | |
'print.css' => 8, | |
'.env-example' => 8, | |
'push-tests' => 8, | |
'driverinterface.php' => 8, | |
'tools.php' => 8, | |
'codestyle.xml' => 8, | |
'locale.php' => 8, | |
'dialog.php' => 8, | |
'format.php' => 8, | |
'n98-magerun.yaml' => 8, | |
'.pharignore' => 8, | |
'_bootstrap.php' => 8, | |
'.php_cs.cache' => 8, | |
'layout.php' => 8, | |
'compile' => 8, | |
'features' => 8, | |
'.eslintignore' => 8, | |
'urlgenerator.php' => 8, | |
'run-tests.bat' => 8, | |
'moduletrait.php' => 8, | |
'readme.en' => 8, | |
'manifest' => 8, | |
'angularasset.php' => 7, | |
'source.php' => 7, | |
'.coverall.yml' => 7, | |
'gpl-3.0' => 7, | |
'gravatar.php' => 7, | |
'._.ds_store' => 7, | |
'phinx.php' => 7, | |
'baseoauth.php' => 7, | |
'.config.json' => 7, | |
'make.php' => 7, | |
'imperaviredactorasset.php' => 7, | |
'logo.jpg' => 7, | |
'kindeditor.php' => 7, | |
'permission.php' => 7, | |
'textdirectionimperaviredactorpluginasset.php' => 7, | |
'pdo.php' => 7, | |
'thanks' => 7, | |
'datatable.jpg' => 7, | |
'win.runtest.bat' => 7, | |
'fontfamilyimperaviredactorpluginasset.php' => 7, | |
'plugin.yml' => 7, | |
'fontcolorimperaviredactorpluginasset.php' => 7, | |
'timepicker.php' => 7, | |
'fontsizeimperaviredactorpluginasset.php' => 7, | |
'fullscreenimperaviredactorpluginasset.php' => 7, | |
'latlng.php' => 7, | |
'configuration' => 7, | |
'info.php' => 7, | |
'mapasset.php' => 7, | |
'jquery.min.js' => 7, | |
'modulesserviceprovider.php' => 7, | |
'readme.git' => 7, | |
'package2.xml' => 7, | |
'clipsimperaviredactorpluginasset.php' => 7, | |
'changelog-3.0' => 7, | |
'mit.license' => 7, | |
'bfw_modules_info.php' => 7, | |
'phpdoc.sh' => 7, | |
'media.php' => 7, | |
'orchestra.json' => 7, | |
'startup.php' => 7, | |
'env.php' => 7, | |
'script.php' => 7, | |
'rest.php' => 7, | |
'status' => 7, | |
'fullcalendar.php' => 7, | |
'editablecolumn.php' => 7, | |
'gentry.json' => 7, | |
'filters.php' => 7, | |
'pluginmanager.php' => 7, | |
'barcodes.php' => 7, | |
'.phpunit.xml' => 7, | |
'readme-id' => 7, | |
'db.sql' => 7, | |
'publish.sh' => 7, | |
'travis.ini' => 7, | |
'phpdoc.ini.dist' => 7, | |
'config.w32' => 7, | |
'foundationasset.php' => 7, | |
'string.php' => 7, | |
'moduleasset.php' => 7, | |
'services.yml' => 7, | |
'type.php' => 7, | |
'socket.php' => 7, | |
'install.html' => 7, | |
'copyng' => 7, | |
'mime.php' => 7, | |
'changelog.html' => 7, | |
'security' => 7, | |
'install-frameworkmissing.html' => 7, | |
'generate.php' => 7, | |
'chart.php' => 7, | |
'make-junctions.sh' => 7, | |
'resources.php' => 7, | |
'jquery.js' => 7, | |
'treeview.php' => 7, | |
'routecollection.php' => 7, | |
'package.xml.tpl' => 7, | |
'comment.php' => 7, | |
'widgetasset.php' => 7, | |
'doctrine-mongo-mapping.xsd' => 7, | |
'phpunit.cnf.ini' => 7, | |
'license-gpl' => 7, | |
'signer.php' => 7, | |
'googlebundle.php' => 7, | |
'rtl.css' => 7, | |
'mapsmanager.php' => 7, | |
'neo4jphpversiontask.php' => 7, | |
'notifier.php' => 7, | |
'phpunit_mysql.xml' => 7, | |
'.travis.yaml' => 7, | |
'recaptcha.php' => 7, | |
'datetime.php' => 7, | |
'pbj-schemas.php' => 7, | |
'cas.php' => 7, | |
'interface.php' => 7, | |
'phpunit.cmd' => 7, | |
'.npmignore' => 7, | |
'example-google.php' => 7, | |
'php-cs-fixer.phar' => 7, | |
'phpinfo.php' => 7, | |
'.env.travis' => 7, | |
'gruntfile.js' => 7, | |
'elfinder.php' => 7, | |
'readme_old' => 7, | |
'.csslintrc' => 7, | |
'upgrade.html' => 7, | |
'storageinterface.php' => 7, | |
'slimscrollasset.php' => 7, | |
'apple-touch-icon.png' => 7, | |
'flash.php' => 7, | |
'highcharts.php' => 7, | |
'factoryinterface.php' => 7, | |
'person.php' => 7, | |
'crud.php' => 7, | |
'codesniffer.php' => 7, | |
'config.neon' => 7, | |
'sql.php' => 7, | |
'load_font.php' => 7, | |
'bump-version.sh' => 7, | |
'dompdf_config.custom.inc.php' => 7, | |
'exceptions.php' => 7, | |
'errors.php' => 7, | |
'.bzrignore' => 7, | |
'testsuite' => 7, | |
'.vimrc' => 7, | |
'logo.svg' => 7, | |
'phpcs.ruleset.xml' => 7, | |
'hybridresult.php' => 7, | |
'check.php' => 7, | |
'build.properties.dist' => 7, | |
'.apishka.php' => 7, | |
'config.inc.php' => 7, | |
'config.test.php' => 7, | |
'soapclient.php' => 7, | |
'summary' => 7, | |
'example' => 7, | |
'taxonomy.php' => 7, | |
'release.php' => 7, | |
'hooks.php' => 7, | |
'yiic.bat' => 7, | |
'docker-compose.yml.dist' => 7, | |
'notorm.php' => 7, | |
'pdf.php' => 7, | |
's3.php' => 7, | |
'managerconfigurator.php' => 6, | |
'soapresponse.php' => 6, | |
'soaprequest.php' => 6, | |
'running_behat' => 6, | |
'tableimperaviredactorpluginasset.php' => 6, | |
'package.boot.php' => 6, | |
'activeformasset.php' => 6, | |
'filemanagerimperaviredactorpluginasset.php' => 6, | |
'__init__.php' => 6, | |
'definedlinksimperaviredactorpluginasset.php' => 6, | |
'counterimperaviredactorpluginasset.php' => 6, | |
'resolver.php' => 6, | |
'note.development.nov.2011' => 6, | |
'messageconfig.php' => 6, | |
'run-tests.php' => 6, | |
'limiterimperaviredactorpluginasset.php' => 6, | |
'textexpanderimperaviredactorpluginasset.php' => 6, | |
'meta.php' => 6, | |
'upgrade-1.3' => 6, | |
'videoimperaviredactorpluginasset.php' => 6, | |
'db.xml' => 6, | |
'framework.php' => 6, | |
'upgrade-1.0' => 6, | |
'soapkernel.php' => 6, | |
'basemodel.php' => 6, | |
'fosuserevents.php' => 6, | |
'fosuserbundle.php' => 6, | |
'note.thenetcircle' => 6, | |
'imagemanagerimperaviredactorpluginasset.php' => 6, | |
'doctrine-mapping.xsd' => 6, | |
'armadillofile.yml' => 6, | |
'writer.php' => 6, | |
'changelog-0.1' => 6, | |
'plugin.json' => 6, | |
'patents' => 6, | |
'matcher.php' => 6, | |
'extension.json' => 6, | |
'selector.php' => 6, | |
'imagldapbundle.php' => 6, | |
'phpunit.sample.xml' => 6, | |
'buildtools' => 6, | |
'calendar.php' => 6, | |
'lexer.php' => 6, | |
'ueditoraction.php' => 6, | |
'plugins' => 6, | |
'wordpress.php' => 6, | |
'build.phpunit.xml' => 6, | |
'coverage.xml' => 6, | |
'phonenumber.php' => 6, | |
'treeviewasset.php' => 6, | |
'herbert.config.php' => 6, | |
'test_build' => 6, | |
'.acid.yml.dist' => 6, | |
'linkpager.php' => 6, | |
'transport.php' => 6, | |
'admingeneratorgeneratorbundle.php' => 6, | |
'definition.php' => 6, | |
'behavior.php' => 6, | |
'run-all.sh' => 6, | |
'htmlawed.php' => 6, | |
'development' => 6, | |
'dist.sh' => 6, | |
'rules.xml' => 6, | |
'armadillo_standin.sh' => 6, | |
'upgrade-2.8' => 6, | |
'themeasset.php' => 6, | |
'mapper.php' => 6, | |
'endpoint.php' => 6, | |
'spec' => 6, | |
'unittests.xml' => 6, | |
'howto' => 6, | |
'ocular.phar' => 6, | |
'realestatemssqlbundle.php' => 6, | |
'build-dev.xml' => 6, | |
'autocomplete.php' => 6, | |
'sortable.php' => 6, | |
'routingserviceprovider.php' => 6, | |
'imagemanager.php' => 6, | |
'routerinterface.php' => 6, | |
'htmlfacade.php' => 6, | |
'formfacade.php' => 6, | |
'readme.mkdn' => 6, | |
'carousel.php' => 6, | |
'acl.php' => 6, | |
'.noninteractive' => 6, | |
'formatconverter.php' => 6, | |
'access.php' => 6, | |
'2dbarcodes.php' => 6, | |
'config.yaml' => 6, | |
'opengraph.php' => 6, | |
'buildphar.php' => 6, | |
'transaction.php' => 6, | |
'cachemanager.php' => 6, | |
'materializeasset.php' => 6, | |
'attachment.php' => 6, | |
'make-junctions.bat' => 6, | |
'params.json' => 6, | |
'htmlcolors.php' => 6, | |
'webuploaderasset.php' => 6, | |
'validate.php' => 6, | |
'twitteroauth.php' => 6, | |
'win.composer.update.bat' => 6, | |
'content-none.php' => 6, | |
'changes-2.1.0' => 6, | |
'simpletest.php' => 6, | |
'navigation.php' => 6, | |
'users.php' => 6, | |
'rule.php' => 6, | |
'tcpdf.fdf' => 6, | |
'render.php' => 6, | |
'dataprovider.php' => 6, | |
'unicode_data.php' => 6, | |
'datatablesasset.php' => 6, | |
'help.php' => 6, | |
'dompdf.php' => 6, | |
'dompdf_config.inc.php' => 6, | |
'.eproject' => 6, | |
'timer.php' => 6, | |
'webuploader.php' => 6, | |
'readme.debian' => 6, | |
'inputfile.php' => 6, | |
'sayhello.php' => 6, | |
'rebuild.sh' => 6, | |
'arguments.php' => 6, | |
'runphpunit' => 6, | |
'runcomposer' => 6, | |
'up.sh' => 6, | |
'fancybox.php' => 6, | |
'kahlan-config.travis.php' => 6, | |
'review-1.4' => 6, | |
'travis.phpunit.xml.dist' => 6, | |
'pugxmultiuserbundle.php' => 6, | |
'notification.php' => 6, | |
'common.inc.php' => 6, | |
'mit-licence' => 6, | |
'nelmioapidocbundle.php' => 6, | |
'reader.php' => 6, | |
'datatypes.php' => 6, | |
'review-1.2' => 6, | |
'pbj-schema-stores.php' => 6, | |
'responseinterface.php' => 6, | |
'seeder.php' => 6, | |
'.travis-config.ini' => 6, | |
'eventdispatcher.php' => 6, | |
'element.php' => 6, | |
'license-agpl.html' => 6, | |
'license-commercial-saas.html' => 6, | |
'license-commercial-website.html' => 6, | |
'license-commercial-websites.html' => 6, | |
'home.php' => 6, | |
'filenotfoundexception.php' => 6, | |
'run-tests-hhvm' => 6, | |
'link.php' => 6, | |
'bootstrapper.php' => 6, | |
'singleton.php' => 6, | |
'cli-config.php.dist' => 6, | |
'role.php' => 6, | |
'pbjc.yml' => 6, | |
'.sami' => 6, | |
'uploadimagebehavior.php' => 6, | |
'tcpdf.crt' => 6, | |
'account.php' => 6, | |
'topsdk.php' => 6, | |
'parameter.php' => 6, | |
'upgrade_guide' => 6, | |
'teste.php' => 6, | |
'readme_spanish' => 6, | |
'expression.php' => 6, | |
'screenshot-inner.png' => 6, | |
'smarty_3.1_notes' => 6, | |
'php.ini.dist' => 6, | |
'boris' => 6, | |
'config.dist.php' => 6, | |
'jmsjobqueuebundle.php' => 6, | |
'phpunit-coverage-html.xml' => 6, | |
'smarty_3.0_bc_notes' => 6, | |
'httpexception.php' => 6, | |
'parameters.php' => 6, | |
'config_cp.php' => 6, | |
'filesystemmap.php' => 6, | |
'.phpmd.xml' => 6, | |
'readme.zh' => 6, | |
'smarty_2_bc_notes' => 6, | |
'repositoryinterface.php' => 6, | |
'simplehtmldom.php' => 6, | |
'extrasetup.php' => 6, | |
'np' => 6, | |
'myconfig.ini' => 6, | |
'php-semver-checker-git.yml.dist' => 6, | |
'vagrantfile.dist' => 6, | |
'_ss_environment.php' => 6, | |
'mousewheelasset.php' => 6, | |
'codefile.php' => 6, | |
'editable.php' => 6, | |
'markdowneditor.php' => 6, | |
'demo.gif' => 6, | |
'detailview.php' => 6, | |
'aliases.php' => 6, | |
'twig.php' => 6, | |
'entry.php' => 5, | |
'pre-commit' => 5, | |
'validatorinterface.php' => 5, | |
'croncontroller.php' => 5, | |
'annotation.php' => 5, | |
'scrut.json' => 5, | |
'example3.php' => 5, | |
'paymentfactory.php' => 5, | |
'phpbench.json.dist' => 5, | |
'index.xsl' => 5, | |
'fastclickasset.php' => 5, | |
'relation.php' => 5, | |
'pipeline.php' => 5, | |
'sessioninterface.php' => 5, | |
'parserinterface.php' => 5, | |
'readme.adoc' => 5, | |
'creditos' => 5, | |
'modernizrasset.php' => 5, | |
'changelog-3.1' => 5, | |
'copying-mit' => 5, | |
'collectioninterface.php' => 5, | |
'upgrade_to_1_1' => 5, | |
'headers.php' => 5, | |
'iconbar.php' => 5, | |
'phpunit-integration.xml' => 5, | |
'stofdoctrineextensionsbundle.php' => 5, | |
'codeclimate.yml' => 5, | |
'sass-compiler.php' => 5, | |
'exemple.php' => 5, | |
'.bldr.yml' => 5, | |
'userpath.php' => 5, | |
'documentation.html' => 5, | |
'release-notes.html' => 5, | |
'lena512color.jpg' => 5, | |
'detection.dat' => 5, | |
'facedetector.php' => 5, | |
'upgrade-1.5' => 5, | |
'fileinput.php' => 5, | |
'pathcontroller.php' => 5, | |
'ftp.php' => 5, | |
'api.json' => 5, | |
'test.bat' => 5, | |
'authorize.php' => 5, | |
'changelog-1.2' => 5, | |
'encrypter.php' => 5, | |
'gallerymanagerasset.php' => 5, | |
'problematicaclmanagerbundle.php' => 5, | |
'value.php' => 5, | |
'localpath.php' => 5, | |
'reporter.php' => 5, | |
'.composer.json.swp' => 5, | |
'readme.fr' => 5, | |
'documentacao_moip-php.pdf' => 5, | |
'sdk.class.php' => 5, | |
'queryinterface.php' => 5, | |
'autorun.php' => 5, | |
'review-1.1' => 5, | |
'config.js' => 5, | |
'phpbench.json' => 5, | |
'assetscallback.php' => 5, | |
'language.php' => 5, | |
'license.lesser' => 5, | |
'xmlmimefilter.php' => 5, | |
'wssecurityfilter.php' => 5, | |
'number.php' => 5, | |
'basepath.php' => 5, | |
'ftppath.php' => 5, | |
'mimefilter.php' => 5, | |
'summernote.php' => 5, | |
'cheatsheet' => 5, | |
'package.yml' => 5, | |
'zipper.sh' => 5, | |
'cookies.php' => 5, | |
'handler.template.php' => 5, | |
'stringhelper.php' => 5, | |
'encoder.php' => 5, | |
'testsuite.php' => 5, | |
'pluploadasset.php' => 5, | |
'icon.jpg' => 5, | |
'pluploadaction.php' => 5, | |
'plupload.php' => 5, | |
'chunkuploader.php' => 5, | |
'phpunit-travis.xml' => 5, | |
'timezone.php' => 5, | |
'version.json' => 5, | |
'phpword.ini.dist' => 5, | |
'todos' => 5, | |
'datamatrix.php' => 5, | |
'readme.dist' => 5, | |
'makefile.am' => 5, | |
'cli-tests.php' => 5, | |
'channel.php' => 5, | |
'point.php' => 5, | |
'pdf417.php' => 5, | |
'changelog.php' => 5, | |
'sample_push.php' => 5, | |
'.pre-commit' => 5, | |
'cropperasset.php' => 5, | |
'vendors.win.php' => 5, | |
'sample_push_custom.php' => 5, | |
'sample_push_many.php' => 5, | |
'sample_server.php' => 5, | |
'send.php' => 5, | |
'medoo.php' => 5, | |
'install-composer.sh' => 5, | |
'iotcpdfbundle.php' => 5, | |
'leiame' => 5, | |
'amazon-config.default.php' => 5, | |
'slender.yml' => 5, | |
'scientist.png' => 5, | |
'.gitkeep' => 5, | |
'typeahead.php' => 5, | |
'global.php' => 5, | |
'structure.sql' => 5, | |
'sql.sql' => 5, | |
'run-travis' => 5, | |
'spinner.php' => 5, | |
'shtumiusefulbundle.php' => 5, | |
'spbowerbundle.php' => 5, | |
'managerinterface.php' => 5, | |
'datagridevents.php' => 5, | |
'.gitattribute' => 5, | |
'phpunit_config.xml' => 5, | |
'version-check.json' => 5, | |
'theme.json' => 5, | |
'docs.sh' => 5, | |
'grid.php' => 5, | |
'.hedron.yml' => 5, | |
'sample_feedback.php' => 5, | |
'build-phar' => 5, | |
'configurationinterface.php' => 5, | |
'fullcalendarasset.php' => 5, | |
'foscommentbundle.php' => 5, | |
'book.json' => 5, | |
'match.php' => 5, | |
'travis.sh' => 5, | |
'progressbar.php' => 5, | |
'select2bootstrapasset.php' => 5, | |
'box.php' => 5, | |
'select.php' => 5, | |
'defaults.php' => 5, | |
'order.php' => 5, | |
'phpunit.no_autoload.xml' => 5, | |
'searchform.php' => 5, | |
'sphinxapi.php' => 5, | |
'resque.php' => 5, | |
'csv.php' => 5, | |
'shell.php' => 5, | |
'license.pdf' => 5, | |
'cover.png' => 5, | |
'.atoum.treemap.php' => 5, | |
'phpunit.mysql.xml' => 5, | |
'metronic.php' => 5, | |
'.phpdoc.xml' => 5, | |
'counter.php' => 5, | |
'excel.php' => 5, | |
'bugs' => 5, | |
'gallerymanageraction.php' => 5, | |
'liesmich' => 5, | |
'geolocation.php' => 5, | |
'config_fonts-distr-without-otl.php' => 5, | |
'license_yaml' => 5, | |
'themes.php' => 5, | |
'protocol.php' => 5, | |
'doctrinebundle.php' => 5, | |
'service' => 5, | |
'news.php' => 5, | |
'article.php' => 5, | |
'printasset.php' => 5, | |
'fileinterface.php' => 5, | |
'hh_autoload.json' => 5, | |
'fpdi_bridge.php' => 5, | |
'aggregateserviceprovider.php' => 5, | |
'cs-fixer' => 5, | |
'player.php' => 5, | |
'sortablegridaction.php' => 5, | |
'eventmanager.php' => 5, | |
'_changelog' => 5, | |
'basehtml.php' => 5, | |
'sortablegridasset.php' => 5, | |
'.htaccess.dist' => 5, | |
'eventsubscriberinterface.php' => 5, | |
'js.php' => 5, | |
'download.php' => 5, | |
'classmap.php' => 5, | |
'zip.php' => 5, | |
'redisqueue.php' => 5, | |
'mod_form.php' => 5, | |
'phpunit.xml.travisci' => 5, | |
'.dunitconfig-nightly' => 5, | |
'fr.php' => 5, | |
'ca-bundle.crt' => 5, | |
'change-log' => 5, | |
'locallib.php' => 5, | |
'reference.php' => 5, | |
'fpdf.php' => 5, | |
'jmsi18nroutingbundle.php' => 5, | |
'fpdf.css' => 5, | |
'ipn.php' => 5, | |
'encoding.php' => 5, | |
'gump.class.php' => 5, | |
'expressionlanguage.php' => 5, | |
'htmlawed_readme.htm' => 5, | |
'arrayhelper.php' => 5, | |
'htmlawed_readme' => 5, | |
'activedataprovider.php' => 5, | |
'preloader.php' => 5, | |
'inittestsuite.php' => 5, | |
'stats.php' => 5, | |
'testclass.tt' => 5, | |
'bootboxasset.php' => 5, | |
'sonatamediabundle.php' => 5, | |
'cron.sh' => 5, | |
'class.pop3.php' => 5, | |
'index.php.sample' => 5, | |
'sitemap.xml' => 5, | |
'mage' => 5, | |
'class.phpmailer.php' => 5, | |
'phpunit.xml.example' => 5, | |
'bootstrap.js' => 5, | |
'sessionmanager.php' => 5, | |
'sortablegridbehavior.php' => 5, | |
'infinitescrollasset.php' => 5, | |
'fosjsroutingbundle.php' => 5, | |
'garbagecollect.php' => 5, | |
'generate.sh' => 5, | |
'generate_api' => 5, | |
'tutorial' => 5, | |
'.mime' => 5, | |
'jsonresponse.php' => 5, | |
'sessionserviceprovider.php' => 5, | |
'update-gh-pages.sh' => 5, | |
'class.smtp.php' => 5, | |
'autoload.dist.php' => 5, | |
'remote.php' => 5, | |
'modelmanager.php' => 5, | |
'viewtopic.php' => 5, | |
'lgpl' => 5, | |
'htmlawedtest.php' => 5, | |
'htmlawed_testcase' => 5, | |
'buttondropdown.php' => 5, | |
'enum.php' => 5, | |
'fontawesome.php' => 5, | |
'license-apache' => 5, | |
'routing.php' => 5, | |
'profiler.php' => 5, | |
'messages.php' => 5, | |
'cart.php' => 5, | |
'screen.png' => 5, | |
'yuicompressor.jar' => 5, | |
'makerelease.sh' => 5, | |
'animateasset.php' => 5, | |
'packager' => 5, | |
'screen-shot.png' => 5, | |
'kindeditorwidget.php' => 5, | |
'fluent.php' => 5, | |
'runmessage' => 5, | |
'license.textile' => 5, | |
'collapse.php' => 5, | |
'phpunit.functional.xml.dist' => 5, | |
'applicationinterface.php' => 5, | |
'phpspec-html.yml' => 5, | |
'phpspec-clover.yml' => 5, | |
'packager.php' => 5, | |
'thankyou' => 5, | |
'contributions' => 5, | |
'galleryimage.php' => 5, | |
'datatables.php' => 5, | |
'venne-phing.xml' => 5, | |
'codecept' => 5, | |
'show.php' => 5, | |
'system.php' => 5, | |
'assetsjqueryadapter.php' => 5, | |
'recorder.php' => 5, | |
'upgrade-1.2' => 5, | |
'fileupload.php' => 5, | |
'upgrade-1.4' => 5, | |
'httpclient.php' => 5, | |
'.doxygen' => 5, | |
'minion' => 5, | |
'eventdispatcherinterface.php' => 5, | |
'package_compatible.xml' => 5, | |
'menus.php' => 5, | |
'dump.sql' => 5, | |
'formatterinterface.php' => 5, | |
'favicon.png' => 5, | |
'shoppingcart.php' => 5, | |
'default-disable' => 5, | |
'phpunit.xml.hhvm' => 5, | |
'datetimebehavior.php' => 5, | |
'clover.xml' => 5, | |
'paypal.php' => 5, | |
'migratecontroller.php' => 5, | |
'namespaceditemresolver.php' => 5, | |
'httpclientinterface.php' => 5, | |
'translationserviceprovider.php' => 5, | |
'coverage' => 5, | |
'.env-sample' => 5, | |
'autoloader.class.php' => 5, | |
'gatewayinterface.php' => 5, | |
'sliderasset.php' => 5, | |
'timeline.php' => 5, | |
'dynamicmodel.php' => 5, | |
'porting_info' => 5, | |
'validationexception.php' => 5, | |
'install.bat' => 5, | |
'_register_database.php' => 5, | |
'menuasset.php' => 5, | |
'branches' => 5, | |
'sync.php' => 5, | |
'emailinterface.php' => 5, | |
'password.php' => 5, | |
'silverstripe_version' => 5, | |
'commit.bat' => 5, | |
'sandbox.php' => 5, | |
'imagebehavior.php' => 5, | |
'migrationserviceprovider.php' => 5, | |
'sweetalertasset.php' => 5, | |
'allincl.php' => 5, | |
'nestedsetbehavior.php' => 4, | |
'phpcodesniffer.xml' => 4, | |
'phpdoc.ini' => 4, | |
'jstree.php' => 4, | |
'phpunit-integration-legacy.xml' => 4, | |
'grammar.php' => 4, | |
'bitly.php' => 4, | |
'alertasset.php' => 4, | |
'proxy.php' => 4, | |
'accordion.php' => 4, | |
'permissions.php' => 4, | |
'configinterface.php' => 4, | |
'codeofconduct' => 4, | |
'ref.js' => 4, | |
'usermanagementmodule.php' => 4, | |
'pull_request_template' => 4, | |
'i.sh' => 4, | |
'statement.php' => 4, | |
'chatasset.php' => 4, | |
'changelog.htm' => 4, | |
'faq.htm' => 4, | |
'db.class.php' => 4, | |
'.phpunit' => 4, | |
'ref.php' => 4, | |
'listener.php' => 4, | |
'templateengine.php' => 4, | |
'ref.css' => 4, | |
'schema.sql' => 4, | |
'configexception.php' => 4, | |
'dispatch.php' => 4, | |
'menubuilder.php' => 4, | |
'bootstrap.inc.php' => 4, | |
'parameters.yml.dist' => 4, | |
'front-page.php' => 4, | |
'hello.php' => 4, | |
'indexer.php' => 4, | |
'fosfacebookbundle.php' => 4, | |
'searchbundle.php' => 4, | |
'tsmarty2c.php' => 4, | |
'mediawiki-extension.json' => 4, | |
'demo' => 4, | |
'compatibility-test.php' => 4, | |
'phpairbrakebundle.php' => 4, | |
'class.krumo.php' => 4, | |
'library.php' => 4, | |
'ivorygooglemapbundle.php' => 4, | |
'pear.php' => 4, | |
'obfuscator.php' => 4, | |
'containerawarejob.php' => 4, | |
'idiorm.php' => 4, | |
'.dir-locals.el' => 4, | |
'readme.sublime-workspace' => 4, | |
'routerexception.php' => 4, | |
'money.php' => 4, | |
'mailchimp.php' => 4, | |
'codesniffer.conf' => 4, | |
'php.php' => 4, | |
'output.png' => 4, | |
'solr.php' => 4, | |
'fpdf_tpl.php' => 4, | |
'config-example.php' => 4, | |
'jwt.php' => 4, | |
'serializerinterface.php' => 4, | |
'pdostatement.php' => 4, | |
'data' => 4, | |
'phpdocumentor.phar' => 4, | |
'converter.php' => 4, | |
'dev' => 4, | |
'style.php' => 4, | |
'svggraphmultilinegraph.php' => 4, | |
'svggraphmultiradargraph.php' => 4, | |
'viewforum.php' => 4, | |
'viewerrorbag.php' => 4, | |
'instance.php' => 4, | |
'pluralizer.php' => 4, | |
'svggraphmultiscattergraph.php' => 4, | |
'svggraphmultigraph.php' => 4, | |
'svggraphpattern.php' => 4, | |
'svggraphpie3dgraph.php' => 4, | |
'title.php' => 4, | |
'svggraphpiegraph.php' => 4, | |
'gettext.php' => 4, | |
'svggraphpointgraph.php' => 4, | |
'dbmanager.php' => 4, | |
'example4.php' => 4, | |
'locallang_db.xml' => 4, | |
'thumbaction.php' => 4, | |
'svggraphhorizontalbargraph.php' => 4, | |
'redis.php' => 4, | |
'phpspec.no-coverage.yml' => 4, | |
'svggraphhorizontalfloatingbargraph.php' => 4, | |
'video.php' => 4, | |
'filebehavior.php' => 4, | |
'tips' => 4, | |
'svggraphlinegraph.php' => 4, | |
'build-phar.php' => 4, | |
'svggraphhorizontalgroupedbargraph.php' => 4, | |
'run-test.sh' => 4, | |
'svggraphhorizontalstackedbargraph.php' => 4, | |
'svggraphjavascript.php' => 4, | |
'routeinterface.php' => 4, | |
'svggraphpolarareagraph.php' => 4, | |
'svggraphpopulationpyramid.php' => 4, | |
'svggraphgroupedcylindergraph.php' => 4, | |
'address.php' => 4, | |
'svggraph.ini' => 4, | |
'uploadedfile.php' => 4, | |
'mailserviceprovider.php' => 4, | |
'presenter.php' => 4, | |
'controllerinterface.php' => 4, | |
'dispatcherinterface.php' => 4, | |
'etspaymentogonebundle.php' => 4, | |
'paginationserviceprovider.php' => 4, | |
'packagecreator.php' => 4, | |
'containerinterface.php' => 4, | |
'codesniffer.conf.dist' => 4, | |
'apiexception.php' => 4, | |
'requestinterface.php' => 4, | |
'datetimecomparevalidator.php' => 4, | |
'svggraphstructureddata.php' => 4, | |
'.nitpick.json' => 4, | |
'renderer.php' => 4, | |
'workbenchserviceprovider.php' => 4, | |
'svggraphradargraph.php' => 4, | |
'travis.xml' => 4, | |
'svggraphscattergraph.php' => 4, | |
'liqpay.php' => 4, | |
'edit_form.php' => 4, | |
'post.php' => 4, | |
'htmlform.php' => 4, | |
'svggraphstackedlinegraph.php' => 4, | |
'svggraphstackedbar3dgraph.php' => 4, | |
'messagebag.php' => 4, | |
'svggraphstackedbargraph.php' => 4, | |
'svggraphstackedcylindergraph.php' => 4, | |
'ext_tables_static+adt.sql' => 4, | |
'htmlstring.php' => 4, | |
'regioncode.php' => 4, | |
'currencies.json' => 4, | |
'mailparser.php' => 4, | |
'nexmoaccount.php' => 4, | |
'phpdoc.xml-dist' => 4, | |
'.build.props' => 4, | |
'phings' => 4, | |
'nexmoreceipt.php' => 4, | |
'nexmomessage.php' => 4, | |
'settingsaction.php' => 4, | |
'foselasticabundle.php' => 4, | |
'delete.php' => 4, | |
'properties.php' => 4, | |
'utilities.php' => 4, | |
'manual.html' => 4, | |
'travis-config.ini' => 4, | |
'module.ini' => 4, | |
'deployment.properties' => 4, | |
'doc.sh' => 4, | |
'doc.php' => 4, | |
'redirector.php' => 4, | |
'treeasset.php' => 4, | |
'config.php-development' => 4, | |
'guid.php' => 4, | |
'readme.dcy' => 4, | |
'codecept.bat' => 4, | |
'jobinterface.php' => 4, | |
'mysql.sql' => 4, | |
'timeago.php' => 4, | |
'product.php' => 4, | |
'liscense' => 4, | |
'kcfinderasset.php' => 4, | |
'default.php' => 4, | |
'changelog.mkd' => 4, | |
'testlistener.php' => 4, | |
'test-config.yml.dist' => 4, | |
'abstractcontroller.php' => 4, | |
'config.php.example' => 4, | |
'phonenumberutil.php' => 4, | |
'svggraphdata.php' => 4, | |
'dialogasset.php' => 4, | |
'notify.php' => 4, | |
'svggraphbargraph.php' => 4, | |
'svggraphboxandwhiskergraph.php' => 4, | |
'svggraphbubblegraph.php' => 4, | |
'svggraphcylindergraph.php' => 4, | |
'svggraphdonutgraph.php' => 4, | |
'svggraphaxislog.php' => 4, | |
'merchant.php' => 4, | |
'svggraphexplodedpiegraph.php' => 4, | |
'svggraphfloatingbargraph.php' => 4, | |
'svggraphgridgraph.php' => 4, | |
'svggraphgroupedbar3dgraph.php' => 4, | |
'svggraphgroupedbargraph.php' => 4, | |
'svggraphbar3dgraph.php' => 4, | |
'svggraphaxisfixeddoubleended.php' => 4, | |
'invoker.php' => 4, | |
'countrycodetoregioncodemap.php' => 4, | |
'services.php' => 4, | |
'ewzrecaptchabundle.php' => 4, | |
'filterinterface.php' => 4, | |
'schemamanager.php' => 4, | |
'platform.php' => 4, | |
'growl.php' => 4, | |
'svggraph.php' => 4, | |
'svggraphaxisfixed.php' => 4, | |
'svggraph3dgraph.php' => 4, | |
'svggraphaxis.php' => 4, | |
'_license' => 4, | |
'numberparseexception.php' => 4, | |
'transformer.php' => 4, | |
'phonemetadata.php' => 4, | |
'svggraphaxisdoubleended.php' => 4, | |
'.php_cs-fixers.php' => 4, | |
'google.php' => 4, | |
'webtestcase.php' => 4, | |
'columnschema.php' => 4, | |
'readme.rdoc' => 4, | |
'build.vagrant.properties' => 4, | |
'server_status.php' => 4, | |
'licenses' => 4, | |
'server_sql.php' => 4, | |
'.drone.sec' => 4, | |
'server_replication.php' => 4, | |
'server_privileges.php' => 4, | |
'server_plugins.php' => 4, | |
'filtermanager.php' => 4, | |
'server_import.php' => 4, | |
'server_export.php' => 4, | |
'server_status_monitor.php' => 4, | |
'server_engines.php' => 4, | |
'.description.php' => 4, | |
'watchr.rb' => 4, | |
'server_databases.php' => 4, | |
'lint.php' => 4, | |
'server_collations.php' => 4, | |
'server_binlog.php' => 4, | |
'phpunit.teamcity.mssql.xml' => 4, | |
's3path.php' => 4, | |
'loggerinterface.php' => 4, | |
'schema_export.php' => 4, | |
'server_status_advisor.php' => 4, | |
'server_status_processes.php' => 4, | |
'prefs_forms.php' => 4, | |
'settings.ini' => 4, | |
'sanitizer.php' => 4, | |
'htmlcompressor.php' => 4, | |
'tbl_replace.php' => 4, | |
'tbl_relation.php' => 4, | |
'experimental' => 4, | |
'tbl_recent_favorite.php' => 4, | |
'phppackage.png' => 4, | |
'oil' => 4, | |
'tbl_operations.php' => 4, | |
'tbl_indexes.php' => 4, | |
'tbl_import.php' => 4, | |
'tbl_gis_visualization.php' => 4, | |
'server_status_queries.php' => 4, | |
'tbl_get_field.php' => 4, | |
'tbl_find_replace.php' => 4, | |
'tbl_export.php' => 4, | |
'tbl_create.php' => 4, | |
'tbl_chart.php' => 4, | |
'tbl_change.php' => 4, | |
'tbl_addfield.php' => 4, | |
'show_config_errors.php' => 4, | |
'server_variables.php' => 4, | |
'server_user_groups.php' => 4, | |
'server_status_variables.php' => 4, | |
'prefs_manage.php' => 4, | |
'develop' => 4, | |
'tbl_select.php' => 4, | |
'phpunit-dist.xml' => 4, | |
'db_events.php' => 4, | |
'db_designer.php' => 4, | |
'db_datadict.php' => 4, | |
'db_central_columns.php' => 4, | |
'contributor_license_agreement.html' => 4, | |
'config-sample.inc.php' => 4, | |
'config.sample.inc.php' => 4, | |
'math.php' => 4, | |
'chk_rel.php' => 4, | |
'posting.php' => 4, | |
'composite.php' => 4, | |
'soapclientbuilder.php' => 4, | |
'db_import.php' => 4, | |
'wsaddressingfilter.php' => 4, | |
'wsdldownloader.php' => 4, | |
'adapterinterface.php' => 4, | |
'processmanager.php' => 4, | |
'phpunit-html-coverage.xml' => 4, | |
'cubex' => 4, | |
'package.jpg' => 4, | |
'summernoteasset.php' => 4, | |
'contributors.html' => 4, | |
'set.php' => 4, | |
'contact.php' => 4, | |
'db_export.php' => 4, | |
'db_operations.php' => 4, | |
'.travis_install_dependencies.sh' => 4, | |
'gis_data_editor.php' => 4, | |
'phpguard.yml.dist' => 4, | |
'buttonwidget.php' => 4, | |
'license.bsd' => 4, | |
'lexikmailerbundle.php' => 4, | |
'layout.html' => 4, | |
'phpunit.coverage.xml.dist' => 4, | |
'phpmyadmin.css.php' => 4, | |
'normalization.php' => 4, | |
'markup.php' => 4, | |
'license.php' => 4, | |
'import_status.php' => 4, | |
'file_echo.php' => 4, | |
'copying3' => 4, | |
'error_report.php' => 4, | |
'db_triggers.php' => 4, | |
'applicationfactory.php' => 4, | |
'db_tracking.php' => 4, | |
'compiler.jar' => 4, | |
'db_structure.php' => 4, | |
'db_sql_format.php' => 4, | |
'db_sql_autocomplete.php' => 4, | |
'db_sql.php' => 4, | |
'db_search.php' => 4, | |
'db_routines.php' => 4, | |
'tbl_row_action.php' => 4, | |
'tbl_sql.php' => 4, | |
'turbosms.php' => 4, | |
'bootstrapthemeasset.php' => 4, | |
'boxfile.install' => 4, | |
'bootstrap.css' => 4, | |
'grammar.pp' => 4, | |
'phpmailerautoload.php' => 4, | |
'alipay.php' => 4, | |
'ccdnusersecuritybundle.php' => 4, | |
'public.php' => 4, | |
'status.php' => 4, | |
'profile.php' => 4, | |
'formgenerator.php' => 4, | |
'.travis_publish_doc.sh' => 4, | |
'bootstrappluginasset.php' => 4, | |
'example-wrapper.php' => 4, | |
'licanse' => 4, | |
'laravel' => 4, | |
'rb.php' => 4, | |
'column.php' => 4, | |
'checkboxcolumn.php' => 4, | |
'momentjsasset.php' => 4, | |
'twigextension.php' => 4, | |
'assetmanager.php' => 4, | |
'smarty.php' => 4, | |
'.php-cs-fixer.php' => 4, | |
'uploadifyasset.php' => 4, | |
'random.php' => 4, | |
'example-form.php' => 4, | |
'card.php' => 4, | |
'watch.sh' => 4, | |
'php_parser.php' => 4, | |
'gallery.php' => 4, | |
'bench.php' => 4, | |
'infinitescrollpager.php' => 4, | |
'announce' => 4, | |
'structure.php' => 4, | |
'parameterbag.php' => 4, | |
'browse.php' => 4, | |
'slug.php' => 4, | |
'middlewareinterface.php' => 4, | |
'middleware.php' => 4, | |
'apigen' => 4, | |
'example-cloudfront.php' => 4, | |
'writeme' => 4, | |
'.preflight' => 4, | |
'materializepluginasset.php' => 4, | |
'datatablesbootstrapasset.php' => 4, | |
'debugpanel.php' => 4, | |
'ide_helper.php' => 4, | |
'buttonfixedaction.php' => 4, | |
'.cfignore' => 4, | |
'splfileinfo.php' => 4, | |
'bootstrapswitchasset.php' => 4, | |
'travisci-phpunit.xml' => 4, | |
'fastimage.php' => 4, | |
'easyimage.php' => 4, | |
'tbl_structure.php' => 4, | |
'arrayutils.php' => 4, | |
'containerawaretrait.php' => 4, | |
'alias.php' => 4, | |
'phpserver.php' => 4, | |
'directive.php' => 4, | |
'.snippets' => 4, | |
'maskmoneyasset.php' => 4, | |
'directory.php' => 4, | |
'yii2-setting-preview.png' => 4, | |
'webapp.php' => 4, | |
'view_operations.php' => 4, | |
'view_create.php' => 4, | |
'version_check.php' => 4, | |
'dal.php' => 4, | |
'schedule.php' => 4, | |
'user_password.php' => 4, | |
'cropasset.php' => 4, | |
'transformation_wrapper.php' => 4, | |
'transformation_overview.php' => 4, | |
'tbl_zoom_select.php' => 4, | |
'phpdoc.yml' => 4, | |
'deprecated' => 4, | |
'tbl_triggers.php' => 4, | |
'readme.creole' => 4, | |
'tbl_tracking.php' => 4, | |
'documentinterface.php' => 4, | |
'plivo.php' => 4, | |
'utilsbundle.php' => 4, | |
'config.ru' => 4, | |
'languageasset.php' => 4, | |
'thumbs.db' => 4, | |
'lessc.inc.php' => 4, | |
'apiclient.php' => 4, | |
'.user.ini' => 4, | |
'sensiogeneratorbundle.php' => 4, | |
'catalog.php' => 4, | |
'serialcolumn.php' => 4, | |
'spreadsheetreader.php' => 4, | |
'captchaaction.php' => 4, | |
'spreadsheetreader_csv.php' => 4, | |
'acf.php' => 4, | |
'teste' => 4, | |
'spreadsheetreader_ods.php' => 4, | |
'dev.php' => 4, | |
'spreadsheetreader_xls.php' => 4, | |
'spreadsheetreader_xlsx.php' => 4, | |
'option.php' => 4, | |
'extractor.php' => 4, | |
'orm.php' => 4, | |
'datamapper.php' => 4, | |
'phpmig.php' => 4, | |
'block.php' => 4, | |
'property.php' => 4, | |
'specificationinterface.php' => 4, | |
'db_qbe.php' => 4, | |
'hipmandrillbundle.php' => 4, | |
'encodings_maps.php' => 4, | |
'config.inc.php.dist' => 4, | |
'dist.php' => 4, | |
'oauthrequest.php' => 4, | |
'cropper.php' => 4, | |
'oauthexception.php' => 4, | |
'oauthdatastore.php' => 4, | |
'togglecolumn.php' => 4, | |
'gridviewasset.php' => 4, | |
'oauthsignaturemethod.php' => 4, | |
'unitstype.php' => 4, | |
'size.php' => 4, | |
'pluginabstract.php' => 4, | |
'overlaytrait.php' => 4, | |
'optionstrait.php' => 4, | |
'objectabstract.php' => 4, | |
'maptypeid.php' => 4, | |
'oauthserver.php' => 4, | |
'oauthutil.php' => 4, | |
'latlngbounds.php' => 4, | |
'env.example' => 4, | |
'checker.php' => 4, | |
'icingaexchange.yml' => 4, | |
'uikitasset.php' => 4, | |
'example.htaccess' => 4, | |
'migrations.json' => 4, | |
'accounts.json' => 4, | |
'highchartsasset.php' => 4, | |
'visualpaginator.php' => 4, | |
'migrate.php' => 4, | |
'example.css' => 4, | |
'formserviceprovider.php' => 4, | |
'connector.php' => 4, | |
'protoc-gen-php.php' => 4, | |
'protoc-gen-php.bat' => 4, | |
'gofile' => 4, | |
'release-0.1.0' => 4, | |
'braincraftedbootstrapbundle.php' => 4, | |
'latlngliteral.php' => 4, | |
'eventtype.php' => 4, | |
'output.php' => 4, | |
'config.template.php' => 4, | |
'build.linux.properties' => 4, | |
'build.mac.properties' => 4, | |
'oxygen' => 4, | |
'processorinterface.php' => 4, | |
'.codeclimate' => 4, | |
'changes 5.7.3' => 4, | |
'txt.license' => 4, | |
'txt.version' => 4, | |
'scheduler.php' => 4, | |
'app' => 4, | |
'configure.php' => 4, | |
'maintainers' => 4, | |
'botdetector.php' => 4, | |
'a' => 4, | |
'ext-all.js' => 4, | |
'locallang.xml' => 4, | |
'filemanager.php' => 4, | |
'user.sql' => 4, | |
'clientabstract.php' => 4, | |
'sonatadoctrinemongodbadminbundle.php' => 4, | |
'srgb.icc' => 4, | |
'relationbehavior.php' => 4, | |
'spotcolors.php' => 4, | |
'tcpdf.p12' => 4, | |
'tcpdf_filters.php' => 4, | |
'browse_foreigners.php' => 4, | |
'.travis' => 4, | |
'sami_configuration.php' => 4, | |
'local-config-sample.php' => 4, | |
'buildapi.sh' => 4, | |
'bootstrap-vagrant.sh' => 4, | |
'readme_exportafacil' => 4, | |
'embed.php' => 4, | |
'meta.yml' => 4, | |
'upgrade-1.9' => 4, | |
'consoleserviceprovider.php' => 4, | |
'avalancheimaginebundle.php' => 4, | |
'display.php' => 4, | |
'oauthconsumer.php' => 4, | |
'dropzone.php' => 4, | |
'database.png' => 4, | |
'topbarsection.php' => 4, | |
'grammar.y' => 4, | |
'topbar.php' => 4, | |
'modules.php' => 4, | |
'readme-en' => 4, | |
'dropzoneasset.php' => 4, | |
'navigationwidget.php' => 4, | |
'breadcrumb.php' => 4, | |
'class.php' => 4, | |
'sessionhandler.php' => 4, | |
'unitofwork.php' => 4, | |
'foundationiconasset.php' => 4, | |
'function.php' => 4, | |
'behat.yml-dist' => 4, | |
'webserver.php' => 4, | |
'formmetadata.php' => 4, | |
'generate-docs.sh' => 4, | |
'baseimage.php' => 4, | |
'classes.png' => 4, | |
'recaptchavalidator.php' => 4, | |
'config.json.dist' => 4, | |
'dropdownbutton.php' => 4, | |
'formmapper.php' => 4, | |
'lessify.inc.php' => 3, | |
'.scrutinzer.yml' => 3, | |
'detached.php' => 3, | |
'httpresource.php' => 3, | |
'web_tester.php' => 3, | |
'upgrade-3.2' => 3, | |
'plessc' => 3, | |
'help_my_tests_dont_work_anymore' => 3, | |
'target.php' => 3, | |
'run-test-hhvm' => 3, | |
'default_reporter.php' => 3, | |
'apple-touch-icon-114x114-precomposed.png' => 3, | |
'releases' => 3, | |
'upgrade-3.1' => 3, | |
'taskinterface.php' => 3, | |
'encryptor.php' => 3, | |
'scss.php' => 3, | |
'nginx_app.conf' => 3, | |
'makefile.pl' => 3, | |
'xmlparser.php' => 3, | |
'readme-dev' => 3, | |
'touchspin.php' => 3, | |
'travisconfig.ini' => 3, | |
'phpspec.yml.hhvm' => 3, | |
'yiidebugviewrenderer.php' => 3, | |
'phpunit.watcher.json' => 3, | |
'basestorage.php' => 3, | |
'changelog-4.0' => 3, | |
'nelmiosecuritybundle.php' => 3, | |
'storeinterface.php' => 3, | |
'netterobots' => 3, | |
'aliasloader.php' => 3, | |
'objectresolver.php' => 3, | |
'lessify' => 3, | |
'welcome.php' => 3, | |
'file-header.phps' => 3, | |
'publish' => 3, | |
'sypexgeo.php' => 3, | |
'macaw.php' => 3, | |
'code-coverage.xml' => 3, | |
'.travis.before-install' => 3, | |
'passwordinterface.php' => 3, | |
'authenticator.php' => 3, | |
'expectation.php' => 3, | |
'eclipse.php' => 3, | |
'knpzendcachebundle.php' => 3, | |
'connectoraction.php' => 3, | |
'partner.php' => 3, | |
'userevents.php' => 3, | |
'update.bat' => 3, | |
'debugaction.php' => 3, | |
'conventions' => 3, | |
'hearsayrequirejsbundle.php' => 3, | |
'install.mysql' => 3, | |
'install.pgsql' => 3, | |
'geo.php' => 3, | |
'install.sqlite' => 3, | |
'auth-schema-mysql.sql' => 3, | |
'auth-schema-postgresql.sql' => 3, | |
'summernotelanguageasset.php' => 3, | |
'collector.php' => 3, | |
'ccdnforumforumbundle.php' => 3, | |
'dbug.php' => 3, | |
'phpcs_ruleset.xml' => 3, | |
'apple-touch-icon-precomposed.png' => 3, | |
'demo.sql' => 3, | |
'doctrine_annotations.php' => 3, | |
'whiteoctobertcpdfbundle.php' => 3, | |
'license_osl' => 3, | |
'front.php' => 3, | |
'gallerycontroller.php' => 3, | |
'tmp' => 3, | |
'nestedsortableasset.php' => 3, | |
'nestedsortable.php' => 3, | |
'envoy.blade.php' => 3, | |
'environaut.xml' => 3, | |
'apple-touch-icon-72x72-precomposed.png' => 3, | |
'private.php' => 3, | |
'operator.php' => 3, | |
'syliusorderevents.php' => 3, | |
'ecommerce.php' => 3, | |
'groovey' => 3, | |
'sxgeo.php' => 3, | |
'gen.php' => 3, | |
'_lgpl' => 3, | |
'apple-touch-icon-144x144-precomposed.png' => 3, | |
'knpgaufrettebundle.php' => 3, | |
'npm-debug.log' => 3, | |
'notice.php' => 3, | |
'lisezmoi' => 3, | |
'app.json.dist' => 3, | |
'comparatorinterface.php' => 3, | |
'.git-push-everywhere' => 3, | |
'dropdownx.php' => 3, | |
'lecense' => 3, | |
'datetimeattribute.php' => 3, | |
'navx.php' => 3, | |
'sortablelistview.php' => 3, | |
'phpdoctor.ini' => 3, | |
'phpunit-lts.phar' => 3, | |
'treeviewinput.php' => 3, | |
'apple-touch-icon-57x57-precomposed.png' => 3, | |
'serviceregistry.php' => 3, | |
'screenshot-1.jpg' => 3, | |
'entitymanager.php' => 3, | |
'.travis-php.ini' => 3, | |
'readme_rus' => 3, | |
'pdepend.xml.dist' => 3, | |
'filehandlerinterface.php' => 3, | |
'poll.php' => 3, | |
'yiidebugtoolbar.php' => 3, | |
'htaccess.example' => 3, | |
'license_tr' => 3, | |
'sismo.config.php.dist' => 3, | |
'unit_tester.php' => 3, | |
'validationserviceprovider.php' => 3, | |
'tpl.php' => 3, | |
'thelia' => 3, | |
'yiidebugcontroller.php' => 3, | |
'luascriptbuilder.php' => 3, | |
'cmsbundle.php' => 3, | |
'yiidebugtoolbarpanel.php' => 3, | |
'datetimecomparevalidationasset.php' => 3, | |
'symfony' => 3, | |
'stamp.yml' => 3, | |
'yiidebugcomponentproxy.php' => 3, | |
'googlemaps.php' => 3, | |
'svggraphstackedgroupedbargraph.php' => 3, | |
'before_script.sh' => 3, | |
'yiidebug.php' => 3, | |
'yiidebugtoolbarroute.php' => 3, | |
'symfony license' => 3, | |
'structure' => 3, | |
'trace.php' => 3, | |
'.phpunit.bootstrap.php' => 3, | |
'phpcodesniffer' => 3, | |
'doxygen_input_filter.php' => 3, | |
'ajaxbutton.php' => 3, | |
'infobox.php' => 3, | |
'funk.yml.dist' => 3, | |
'annotations' => 3, | |
'facebook.php' => 3, | |
'uikitalmostflatasset.php' => 3, | |
'simple.php' => 3, | |
'uikitgradientasset.php' => 3, | |
'git.php' => 3, | |
'uikitpluginasset.php' => 3, | |
'oauth2serverbundle.php' => 3, | |
'apccache.php' => 3, | |
'ole.php' => 3, | |
'serve' => 3, | |
'require.php' => 3, | |
'fileinputasset.php' => 3, | |
'config.php.template' => 3, | |
'exemplo.php' => 3, | |
'licencse' => 3, | |
'test.css' => 3, | |
'compile-apache.php' => 3, | |
'xhprof.php' => 3, | |
'minify.php' => 3, | |
'template.latte' => 3, | |
'twitterapiexchange.php' => 3, | |
'changelog.textile' => 3, | |
'screenshot1.png' => 3, | |
'module.conf.local.yaml' => 3, | |
'leeme' => 3, | |
'selectable.php' => 3, | |
'routes' => 3, | |
'extensionbuilder.json' => 3, | |
'frames.php' => 3, | |
'r.php' => 3, | |
'githubmarkdown.php' => 3, | |
'pear.sh' => 3, | |
'http-console.php' => 3, | |
'sessionstorage.php' => 3, | |
'creds-dist.php' => 3, | |
'history.php' => 3, | |
'.zfproject.xml' => 3, | |
'spyc.php' => 3, | |
'exceptionhandler.php' => 3, | |
'dashboard.json' => 3, | |
'yiidebugviewhelper.php' => 3, | |
'youtube.php' => 3, | |
'filesystemserviceprovider.php' => 3, | |
'cookiejar.php' => 3, | |
'jmsserializerbundle.php' => 3, | |
'blog.php' => 3, | |
'phpqrcode.php' => 3, | |
'slidermodule.php' => 3, | |
'menumodule.php' => 3, | |
'pheanstalk_init.php' => 3, | |
'spyc.yaml' => 3, | |
'conf.php' => 3, | |
'queuemanager.php' => 3, | |
'tidy_parser.php' => 3, | |
'scss.inc.php' => 3, | |
'typeinterface.php' => 3, | |
'.atoum.php.dist' => 3, | |
'.gitmessage' => 3, | |
'sqsqueue.php' => 3, | |
'changelog-2.x' => 3, | |
'test_case.php' => 3, | |
'shell_tester.php' => 3, | |
'.styleci' => 3, | |
'todo.xml' => 3, | |
'scorer.php' => 3, | |
'istorage.php' => 3, | |
'calendar.png' => 3, | |
'swiftmailerbundle.php' => 3, | |
'toast.php' => 3, | |
'.test.php' => 3, | |
'filemaker.php' => 3, | |
'abstracttype.php' => 3, | |
'changelog-1.x' => 3, | |
'reflection_php5.php' => 3, | |
'mock_objects.php' => 3, | |
'fmsteamcondenserbundle.php' => 3, | |
'pakefile' => 3, | |
'monitor.php' => 3, | |
'treeviewinputasset.php' => 3, | |
'puppetfile' => 3, | |
'authmanager.php' => 3, | |
'whois.gtld.fastdomain.php' => 3, | |
'whois.gtld.corporatedomains.php' => 3, | |
'whois.gtld.directnic.php' => 3, | |
'whois.gtld.domaindiscover.php' => 3, | |
'whois.gtld.domainpeople.php' => 3, | |
'whois.gtld.dotster.php' => 3, | |
'whois.gtld.dreamhost.php' => 3, | |
'whois.gtld.enom.php' => 3, | |
'whois.gtld.fabulous.php' => 3, | |
'whois.gtld.gandi.php' => 3, | |
'whois.gtld.ascio.php' => 3, | |
'whois.gtld.genericb.php' => 3, | |
'whois.gtld.godaddy.php' => 3, | |
'avocodeformextensionsbundle.php' => 3, | |
'whois.gtld.iana.php' => 3, | |
'whois.gtld.interdomain.php' => 3, | |
'whois.gtld.itsyourdomain.php' => 3, | |
'run' => 3, | |
'whois.gtld.joker.php' => 3, | |
'whois.gtld.assorted.php' => 3, | |
'whois.gtld.alldomains.php' => 3, | |
'whois.gtld.melbourneit.php' => 3, | |
'whois.de.php' => 3, | |
'whois.client.php' => 3, | |
'whois.cn.php' => 3, | |
'whois.co.php' => 3, | |
'geocoder.php' => 3, | |
'whois.co.za.php' => 3, | |
'whois.coop.php' => 3, | |
'jobworkload.php' => 3, | |
'whois.cz.php' => 3, | |
'whois.edu.php' => 3, | |
'whois.gtld.afternic.php' => 3, | |
'jobbase.php' => 3, | |
'whois.eu.php' => 3, | |
'whois.fi.php' => 3, | |
'gearmancontroller.php' => 3, | |
'whois.fj.php' => 3, | |
'gearmancomponent.php' => 3, | |
'bootstrap.min.css' => 3, | |
'whois.fr.php' => 3, | |
'composer_install_github_key.sh' => 3, | |
'whois.gtld.markmonitor.php' => 3, | |
'whois.gtld.moniker.php' => 3, | |
'phpunit-integration-legacy-solr.xml' => 3, | |
'whois.ie.php' => 3, | |
'whois.gtld.schlund.php' => 3, | |
'whois.gtld.srsplus.php' => 3, | |
'whois.gtld.tmagnic.php' => 3, | |
'whois.gtld.tvcorp.php' => 3, | |
'whois.gtld.wildwestdomains.php' => 3, | |
'whois.hu.php' => 3, | |
'whois.icon.png' => 3, | |
'whois.idna.php' => 3, | |
'whois.il.php' => 3, | |
'whois.gtld.register.php' => 3, | |
'whois.in.php' => 3, | |
'whois.info.php' => 3, | |
'whois.int.php' => 3, | |
'whois.ip.afrinic.php' => 3, | |
'whois.ip.apnic.php' => 3, | |
'whois.ip.arin.php' => 3, | |
'whois.ip.krnic.php' => 3, | |
'whois.ip.lacnic.php' => 3, | |
'whois.gtld.rrpproxy.php' => 3, | |
'whois.gtld.publicdomainregistry.php' => 3, | |
'whois.gtld.name.php' => 3, | |
'whois.gtld.nicco.php' => 3, | |
'whois.gtld.nameintel.php' => 3, | |
'whois.gtld.namejuice.php' => 3, | |
'apcclassloader.php' => 3, | |
'classcollectionloader.php' => 3, | |
'whois.gtld.nameking.php' => 3, | |
'whois.gtld.names4ever.php' => 3, | |
'whois.gtld.namevault.php' => 3, | |
'whois.gtld.networksolutions.php' => 3, | |
'whois.gtld.nicline.php' => 3, | |
'whois.gtld.psiusa.php' => 3, | |
'classmapgenerator.php' => 3, | |
'debugclassloader.php' => 3, | |
'starrating.php' => 3, | |
'mapclassloader.php' => 3, | |
'growlasset.php' => 3, | |
'whois.gtld.onlinenic.php' => 3, | |
'whois.gtld.opensrs.php' => 3, | |
'whois.gtld.ovh.php' => 3, | |
'whois.gtld.php' => 3, | |
'whois.cl.php' => 3, | |
'whois.ch.php' => 3, | |
'scrollup.php' => 3, | |
'boleto_banestes.php' => 3, | |
'boleto_cef_sigcb.php' => 3, | |
'boleto_cef.php' => 3, | |
'boleto_bradesco.php' => 3, | |
'boleto_besc.php' => 3, | |
'scdatetimepickerbundle.php' => 3, | |
'regex.php' => 3, | |
'notificationevents.php' => 3, | |
'boleto_bb.php' => 3, | |
'boleto_banespa.php' => 3, | |
'boleto_hsbc.php' => 3, | |
'boleto_bancoob.php' => 3, | |
'boleto cef - contra apresentacao.zip' => 3, | |
'functions' => 3, | |
'ftpexception.php' => 3, | |
'rresque.php' => 3, | |
'smarty.class.php' => 3, | |
'entitytrait.php' => 3, | |
'qrbitstream.php' => 3, | |
'boleto_cef_sinco.php' => 3, | |
'run_test.sh' => 3, | |
'qrconst.php' => 3, | |
'tsmarty2c.1' => 3, | |
'awssdk.php' => 3, | |
'dynamicindex.php' => 3, | |
'changelog-3.2' => 3, | |
'tables.sql' => 3, | |
'bootstraptrait.php' => 3, | |
'boleto_unibanco.php' => 3, | |
'block.t.php' => 3, | |
'function.locale.php' => 3, | |
'boleto_sudameris.php' => 3, | |
'boleto_itau.php' => 3, | |
'boleto_sofisa.php' => 3, | |
'readme2' => 3, | |
'boleto_sicredi.php' => 3, | |
'controllerlistener.php' => 3, | |
'boleto_santander_banespa.php' => 3, | |
'boleto_real.php' => 3, | |
'travis-php-config.ini' => 3, | |
'package-container.yml' => 3, | |
'boleto_nossacaixa.php' => 3, | |
'qrconfig.php' => 3, | |
'qrencode.php' => 3, | |
'whois.cat.php' => 3, | |
'whois.at.php' => 3, | |
'whois.ae.php' => 3, | |
'sqldatabase.php' => 3, | |
'whois.aero.php' => 3, | |
'sqlstatement.php' => 3, | |
'whois.ag.php' => 3, | |
'module_creation' => 3, | |
'whois.am.php' => 3, | |
'whois.asia.php' => 3, | |
'whois.au.php' => 3, | |
'example.cli.php' => 3, | |
'whois.be.php' => 3, | |
'whois.bh.php' => 3, | |
'endpoint-cors.php' => 3, | |
'install_archive' => 3, | |
'whois.biz.php' => 3, | |
'timepickerasset.php' => 3, | |
'puppet.php' => 3, | |
'whois.br.php' => 3, | |
'whois.ca.php' => 3, | |
'npdata.ser' => 3, | |
'release_process' => 3, | |
'qrimage.php' => 3, | |
'stash.php' => 3, | |
'qrinput.php' => 3, | |
'qrlib.php' => 3, | |
'roles.php' => 3, | |
'qrmask.php' => 3, | |
'_manifest_exclude' => 3, | |
'ext_typoscript_constants' => 3, | |
'settings.yml' => 3, | |
'queueinterface.php' => 3, | |
'mobiledetect.php' => 3, | |
'handlers' => 3, | |
'qrrscode.php' => 3, | |
'qrspec.php' => 3, | |
'assertion.php' => 3, | |
'qrsplit.php' => 3, | |
'qrtools.php' => 3, | |
'soap.php' => 3, | |
'qrvect.php' => 3, | |
'ci_instance.php' => 3, | |
'adminmanager.php' => 3, | |
'whois.ip.lib.php' => 3, | |
'whois.ip.php' => 3, | |
'concepts' => 3, | |
'bootstrap-for-theme.php' => 3, | |
'simpleimage.php' => 3, | |
'migrate' => 3, | |
'header.jpg' => 3, | |
'fab.png' => 3, | |
'blank.html' => 3, | |
'fancyboxhelpersasset.php' => 3, | |
'yiit.php' => 3, | |
'baserepository.php' => 3, | |
'.svnignore' => 3, | |
'find.php' => 3, | |
'signature.php' => 3, | |
'readme_zh_cn' => 3, | |
'ckeditorwidgetasset.php' => 3, | |
'fosoauthserverbundle.php' => 3, | |
'ckeditortrait.php' => 3, | |
'modelbehavior.php' => 3, | |
'bolt' => 3, | |
'fssolrbundle.php' => 3, | |
'elements.html' => 3, | |
'validationasset.php' => 3, | |
'apigen.sh' => 3, | |
'dbtestcase.php' => 3, | |
'loggablebehavior.php' => 3, | |
'sso.php' => 3, | |
'memcachesasl.php' => 3, | |
'jstreeasset.php' => 3, | |
'not-gettexted.php' => 3, | |
'head.php' => 3, | |
'logtarget.php' => 3, | |
'debugasset.php' => 3, | |
'hackunit.php' => 3, | |
'es.php' => 3, | |
'imagecolor.php' => 3, | |
'notifyjsasset.php' => 3, | |
'pot-ext-meta.php' => 3, | |
'animatecssasset.php' => 3, | |
'highcharts.src.js' => 3, | |
'highcharts.js' => 3, | |
'highcharts-more.src.js' => 3, | |
'highcharts-more.js' => 3, | |
'nav.tpl' => 3, | |
'uploadify.php' => 3, | |
'fullcalendarwidget.php' => 3, | |
'notrixmailerloopbundle.php' => 3, | |
'datatablestabletoolsasset.php' => 3, | |
'trends.php' => 3, | |
'write.php' => 3, | |
'watcher.php' => 3, | |
'readwrite.php' => 3, | |
'datetimehelper.php' => 3, | |
'indexaction.php' => 3, | |
'spam.php' => 3, | |
'backup.php' => 3, | |
'folder.php' => 3, | |
'build.js' => 3, | |
'read.php' => 3, | |
'generic.php' => 3, | |
'bucket.php' => 3, | |
'insert.php' => 3, | |
'ticket.php' => 3, | |
'serve.php' => 3, | |
'tile.png' => 3, | |
'phpunit.xml.sample' => 3, | |
'herzultforumbundle.php' => 3, | |
'phpunit_sqlite.xml' => 3, | |
404 => 3, | |
'variable.php' => 3, | |
'htmlhelper.php' => 3, | |
'docker-entrypoint.sh' => 3, | |
'run_phpcs.sh' => 3, | |
'composer-install.sh' => 3, | |
'.gitsplit.yml' => 3, | |
'raindroproutingbundle.php' => 3, | |
'phrozn.png' => 3, | |
'scheme.php' => 3, | |
'instagramwidget.php' => 3, | |
'notyasset.php' => 3, | |
'languages.php' => 3, | |
'composer.dev.json' => 3, | |
'dir.php' => 3, | |
'textcat.php' => 3, | |
'docker-compose.yml.sample' => 3, | |
'vk.php' => 3, | |
'mime.types' => 3, | |
'install_phalcon.sh' => 3, | |
'debug.tpl' => 3, | |
'phpunit-integration.xml.dist' => 3, | |
'makepot.php' => 3, | |
'sort.php' => 3, | |
'whois.ip.ripe.php' => 3, | |
'whois.servers.php' => 3, | |
'whois.pro.php' => 3, | |
'whois.pt.php' => 3, | |
'whois.re.php' => 3, | |
'whois.ro.php' => 3, | |
'whois.ru.php' => 3, | |
'whois.rwhois.php' => 3, | |
'whois.sc.php' => 3, | |
'whois.se.php' => 3, | |
'whois.si.php' => 3, | |
'whois.pl.php' => 3, | |
'whois.su.php' => 3, | |
'whois.tel.php' => 3, | |
'whois.travel.php' => 3, | |
'whois.uk.php' => 3, | |
'whois.us.php' => 3, | |
'whois.utils.php' => 3, | |
'whois.ve.php' => 3, | |
'whois.wf.php' => 3, | |
'whois.pm.php' => 3, | |
'whois.parser.php' => 3, | |
'whois.xxx.php' => 3, | |
'whois.main.php' => 3, | |
'scrollupasset.php' => 3, | |
'whois.ir.php' => 3, | |
'whois.is.php' => 3, | |
'whois.it.php' => 3, | |
'whois.jp.php' => 3, | |
'whois.lt.php' => 3, | |
'whois.lu.php' => 3, | |
'whois.ly.php' => 3, | |
'whois.me.php' => 3, | |
'whois.org.za.php' => 3, | |
'whois.mobi.php' => 3, | |
'whois.museum.php' => 3, | |
'whois.mx.php' => 3, | |
'whois.name.php' => 3, | |
'whois.nl.php' => 3, | |
'whois.nu.php' => 3, | |
'whois.nz.php' => 3, | |
'whois.org.php' => 3, | |
'imdb.class.php' => 3, | |
'whois.ws.php' => 3, | |
'maskmoney.php' => 3, | |
'redactormodule.php' => 3, | |
'macros.twig' => 3, | |
'pdf_parser.php' => 3, | |
'sandbox' => 3, | |
'themedefaultasset.php' => 3, | |
'colorbox.php' => 3, | |
'themeclassicasset.php' => 3, | |
'themebootstrapasset.php' => 3, | |
'emongoclient.php' => 3, | |
'emongocriteria.php' => 3, | |
'emongodataprovider.php' => 3, | |
'fpdi_pdf_parser.php' => 3, | |
'emongodocument.php' => 3, | |
'emongoexception.php' => 3, | |
'emongofile.php' => 3, | |
'emongologroute.php' => 3, | |
'metatags.php' => 3, | |
'emongomodel.php' => 3, | |
'emongosort.php' => 3, | |
'codeigniter' => 3, | |
'stats' => 3, | |
'pdf_context.php' => 3, | |
'fpdi.php' => 3, | |
'whois.yt.php' => 3, | |
'bowerassets.php' => 3, | |
'whois.zanet.php' => 3, | |
'markdowneditorasset.php' => 3, | |
'coverage.php' => 3, | |
'team' => 3, | |
'foqelasticabundle.php' => 3, | |
'phar-manifest.php' => 3, | |
'juiasset.php' => 3, | |
'arraycollection.php' => 3, | |
'domain.php' => 3, | |
'scope.php' => 3, | |
'phpunit.xml.nocoverage' => 3, | |
'unit_tests.php' => 3, | |
'forms.php' => 3, | |
'loader.gif' => 3, | |
'.ethna' => 3, | |
'test.sql' => 3, | |
'notfoundexception.php' => 3, | |
'wishlist.php' => 3, | |
'restclient.php' => 3, | |
'css.php' => 3, | |
'whois.fm.php' => 3, | |
'jcropasset.php' => 3, | |
'connectionresolverinterface.php' => 3, | |
'desktop.ini' => 3, | |
'masonryasset.php' => 3, | |
'cssmin.php' => 3, | |
'compare.php' => 3, | |
'exampleconfig.xml' => 3, | |
'connectionresolver.php' => 3, | |
'databasemanager.php' => 3, | |
'datepickerlanguageasset.php' => 3, | |
'go.php' => 3, | |
'phpunit.integration.xml' => 3, | |
'mysqlconnection.php' => 3, | |
'postgresconnection.php' => 3, | |
'queryexception.php' => 3, | |
'sqliteconnection.php' => 3, | |
'appasset.php' => 3, | |
'strings.php' => 3, | |
'sqlserverconnection.php' => 3, | |
'build-phar.sh' => 3, | |
'test_nbbc.php' => 3, | |
'jsonview.php' => 3, | |
'deployment.sample.ini' => 3, | |
'upgrade 2.2' => 3, | |
'upgrade 2.1' => 3, | |
'dbconnectioninterface.php' => 3, | |
'dbquery.php' => 3, | |
'magnificpopupasset.php' => 3, | |
'genemuformbundle.php' => 3, | |
'oldsoundrabbitmqbundle.php' => 3, | |
'dbqueryinterface.php' => 3, | |
'changelog 2.2' => 3, | |
'changelog 2.1' => 3, | |
'sonatablockbundle.php' => 3, | |
'curler.php' => 3, | |
'seedserviceprovider.php' => 3, | |
'sharedhostinstall' => 3, | |
'powered_by_nbbc_small.png' => 3, | |
'sample_distributed.php' => 3, | |
'sample_asn-v6.php' => 3, | |
'gameq.php' => 3, | |
'row.php' => 3, | |
'sample_city-v6.php' => 3, | |
'sample_city.php' => 3, | |
'class.xsl' => 3, | |
'.php.ini' => 3, | |
'sample-v6.php' => 3, | |
'importbundle.php' => 3, | |
'routes.yml' => 3, | |
'gearmanbundle.php' => 3, | |
'multi.php' => 3, | |
'sample_netspeed.php' => 3, | |
'index.html.twig' => 3, | |
'sidebar.xsl' => 3, | |
'geoipregionvars.php' => 3, | |
'aliyunoss.php' => 3, | |
'koowa-component.xml' => 3, | |
'introjsasset.php' => 3, | |
'ohinstagrambundle.php' => 3, | |
'mellatbank.php' => 3, | |
'module.js' => 3, | |
'config.ini.dist' => 3, | |
'config-dist.php' => 3, | |
'apydatagridbundle.php' => 3, | |
'geoipcity.inc' => 3, | |
'lexiktranslationbundle.php' => 3, | |
'project.php' => 3, | |
'datatable.php' => 3, | |
'bcrypt.php' => 3, | |
'whiteoctoberswiftmailerdbbundle.php' => 3, | |
'license-gpl3' => 3, | |
'geoip.inc' => 3, | |
'resourceevents.php' => 3, | |
'powered_by_nbbc.png' => 3, | |
'sample_org.php' => 3, | |
'codemirror.php' => 3, | |
'serviceproviderinterface.php' => 3, | |
'resultaction.php' => 3, | |
'sonatadoctrineormadminbundle.php' => 3, | |
'entityexception.php' => 3, | |
'eventmanagertrait.php' => 3, | |
'successaction.php' => 3, | |
'phpunit-coverage.xml.dist' => 3, | |
'failaction.php' => 3, | |
'odnoklassniki.php' => 3, | |
'apache-license-2.0' => 3, | |
'init.deployment.php' => 3, | |
'besimplessoauthbundle.php' => 3, | |
'promise.php' => 3, | |
'sample.db' => 3, | |
'ivorylucenesearchbundle.php' => 3, | |
'example.jpg' => 3, | |
'servicemanager.php' => 3, | |
'bundle-skel' => 3, | |
'nestedsetquery.php' => 3, | |
'toastrasset.php' => 3, | |
'create.bat' => 3, | |
'spark' => 3, | |
'select2action.php' => 3, | |
'playbook.yml' => 3, | |
'jsonld.php' => 3, | |
'delegate.php' => 3, | |
'notifierinterface.php' => 3, | |
'ip.php' => 3, | |
'install_vendors.sh' => 3, | |
'robo' => 3, | |
'annotations.php' => 3, | |
'baseaction.php' => 3, | |
'cacheexception.php' => 3, | |
'io.php' => 3, | |
'elfinderconnectoraction.php' => 3, | |
'mpdfexception.php' => 3, | |
'nestedset.php' => 3, | |
'pnotify.php' => 3, | |
'dotenv.php' => 3, | |
'phpdoc' => 3, | |
'sami-config.inc.php' => 3, | |
'mediainterface.php' => 3, | |
'subnav.php' => 3, | |
'help.sh' => 3, | |
'.readme.md.swp' => 3, | |
'how' => 3, | |
'padam87attributebundle.php' => 3, | |
'seo.php' => 3, | |
'ipgeobase.php' => 3, | |
'wheel' => 3, | |
'sgdatatablesbundle.php' => 3, | |
'cite.bib' => 3, | |
'crontab.php' => 3, | |
'tinymcecompressoraction.php' => 3, | |
'phpunitbootstrap.php' => 3, | |
'maintenancemode.php' => 3, | |
'meetup.php' => 3, | |
'cleantalk.class.php' => 3, | |
'paceasset.php' => 3, | |
'.env.sample' => 3, | |
'widgetinterface.php' => 3, | |
'duallistbox.php' => 3, | |
'binary.php' => 3, | |
'cartactionevent.php' => 3, | |
'cartpositioninterface.php' => 3, | |
'cartpositionproviderinterface.php' => 3, | |
'cartpositiontrait.php' => 3, | |
'costcalculationevent.php' => 3, | |
'serverfileinput.php' => 3, | |
'discountbehavior.php' => 3, | |
'sample_netspeedcell.php' => 3, | |
'underscore.php' => 3, | |
'cooptilleulsckeditorsonatamediabundle.php' => 3, | |
'cutterasset.php' => 3, | |
'ext.js' => 3, | |
'leaf.php' => 3, | |
'timeagoasset.php' => 3, | |
'test-dist.ini' => 3, | |
'changelog-1.3' => 3, | |
'.htneatindex' => 3, | |
'sonus.sublime-workspace' => 3, | |
'addcommands.php' => 3, | |
'pest.php' => 3, | |
'adapter.php' => 3, | |
'cutter.php' => 3, | |
'deploy.ini' => 3, | |
'redirectresponse.php' => 3, | |
'input.php' => 3, | |
'ext-dev.js' => 3, | |
'autotest_watchr.rb' => 3, | |
'package.pear' => 3, | |
'.htrouter.php' => 3, | |
'test.xml' => 3, | |
'tinymceelfinder.php' => 3, | |
'entrypoint.sh' => 3, | |
'stripe.php' => 3, | |
'controllerdispatcher.php' => 3, | |
'krumo.sample.ini' => 3, | |
'gerrit.json' => 3, | |
'ext-debug.js' => 3, | |
'composer.laravel.json' => 3, | |
'ext-all-debug-w-comments.js' => 3, | |
'ext-all-debug.js' => 3, | |
'.rspec' => 3, | |
'firewall.php' => 3, | |
'ext-all-dev.js' => 3, | |
'ext-debug-w-comments.js' => 3, | |
'quickbase.php' => 3, | |
'pestjson.php' => 3, | |
'altorouter.php' => 3, | |
'abstractextension.php' => 3, | |
'changlog' => 3, | |
'web.php' => 3, | |
'runtests.php' => 3, | |
'generatepackage.php' => 3, | |
'evn.sh' => 3, | |
'config.dist.json' => 3, | |
'twilio.php' => 3, | |
'img.php' => 3, | |
'ru2ftwofactorbundle.php' => 3, | |
'phpunit.idea.xml' => 3, | |
'print.php' => 3, | |
'windowsazuredistributionbundle.php' => 3, | |
'data.json' => 3, | |
'soundcloud.php' => 3, | |
'classes.php' => 3, | |
'configs.php' => 3, | |
'pestxml.php' => 3, | |
'eventlistener.php' => 3, | |
'sonus.sublime-project' => 3, | |
'resumable_example.php' => 3, | |
'multiprocessing_example.php' => 3, | |
'readme.zh-cn' => 3, | |
'coveralls.json' => 3, | |
'authorizenet.php' => 3, | |
'chartasset.php' => 3, | |
'instagram.php' => 3, | |
'akismet.php' => 3, | |
'example_form.php' => 3, | |
'serializerawareinterface.php' => 3, | |
'bootstraprtlasset.php' => 3, | |
'readme_zh' => 3, | |
'phpunit-ms.xml.dist' => 3, | |
'cacheserviceprovider.php' => 3, | |
'elfinderwidget.php' => 3, | |
'mock.php' => 3, | |
'sample_region.php' => 3, | |
'review-1.3' => 3, | |
'sonatapagebundle.php' => 3, | |
'hooker.json' => 3, | |
'jqueryasset.php' => 3, | |
'readme.mediawiki' => 3, | |
'tests.html' => 3, | |
'review-1.5' => 3, | |
'php.html' => 3, | |
'memberlist.php' => 3, | |
'errorhandlertrait.php' => 3, | |
'instructions.html' => 3, | |
'smartyengine.php' => 3, | |
'apache.html' => 3, | |
'pharbuilder.php' => 3, | |
'donate' => 3, | |
'release notes' => 3, | |
'casperjs.php' => 3, | |
'options_user_settings_set.php' => 3, | |
'pre-commit.sample' => 3, | |
'requirements_check.php' => 3, | |
'fontawesomeassets.php' => 3, | |
'oembedserviceprovider.php' => 3, | |
'codeception.travis.yml' => 3, | |
'oembed.php' => 3, | |
'ioniconassets.php' => 3, | |
'thumblib.inc.php' => 3, | |
'jqwidgetsasset.php' => 3, | |
'.agignore' => 3, | |
'thumbbase.inc.php' => 3, | |
'tmplasset.php' => 3, | |
'phpthumb.inc.php' => 3, | |
'exampleusage.php' => 3, | |
'gdthumb.inc.php' => 3, | |
'consolebundle.php' => 3, | |
'htmltag.php' => 3, | |
'cookbook' => 3, | |
'.howiattributes' => 3, | |
'test1.php' => 3, | |
'systeminfo.php' => 3, | |
'catalog.xml' => 3, | |
'alidatatablebundle.php' => 3, | |
'swiftmailsystem.php' => 3, | |
'master.twig' => 3, | |
'matcherinterface.php' => 3, | |
'fileuploadasset.php' => 3, | |
'composer.json.bak' => 3, | |
'readme.upgrading' => 3, | |
'readme.providers' => 3, | |
'readme.provider-guide' => 3, | |
'sonatadatagridbundle.php' => 3, | |
'httprequest.php' => 3, | |
'vagrant-provision.sh' => 3, | |
'read.me' => 3, | |
'passwordgenerator.php' => 3, | |
'providers.php' => 3, | |
'dateintervalbundle.php' => 3, | |
'tables.php' => 3, | |
'test,json' => 3, | |
'coding_standards' => 3, | |
'create.php' => 3, | |
'bootstrap-root.sh' => 3, | |
'dao.php' => 3, | |
'ivoryckeditorbundle.php' => 3, | |
'docmd.json' => 3, | |
'appkernel.php' => 3, | |
'manifest.in' => 3, | |
'doxygen.config' => 3, | |
'gssdk.php' => 3, | |
'cell.php' => 3, | |
'holamon.php' => 3, | |
'web_package.info' => 3, | |
'.parameters.php' => 3, | |
'kint.class.php' => 3, | |
'normalizer.php' => 3, | |
'webtools.php' => 3, | |
'common.xml' => 3, | |
'nestable.php' => 3, | |
'sniff.php' => 3, | |
'haanga-cli.php' => 3, | |
'baseasset.php' => 3, | |
'authmodule.php' => 3, | |
'miniond' => 3, | |
'samiconfig.php' => 3, | |
'bootstrap_all_modules.php' => 3, | |
'example.phpunit.xml' => 3, | |
'index.php.example' => 3, | |
'composer_release_notes' => 3, | |
'bootstrapinterface.php' => 3, | |
'inheritance_release_notes' => 3, | |
'new_features' => 3, | |
'datasource.php' => 3, | |
'asseticbundle.php' => 3, | |
'phalcon.sh' => 3, | |
'doctrine' => 3, | |
'ajaxfilter.php' => 3, | |
'a.php' => 3, | |
'upgrade-1.8' => 3, | |
'.exrc' => 3, | |
'arc2_getpreferredformat.php' => 3, | |
'apikey-dist.php' => 3, | |
'arc2_getformat.php' => 3, | |
'arc2_resource.php' => 3, | |
'arc2_reader.php' => 3, | |
'amazonwebservicesfactory.php' => 3, | |
'amazonwebservices.php' => 3, | |
'trsteelckeditorbundle.php' => 3, | |
'fabfile.py' => 3, | |
'phpunit.oauth1.xml' => 3, | |
'arc2.php' => 3, | |
'extract.php' => 3, | |
'rss2.php' => 3, | |
'rss1.php' => 3, | |
'atom.php' => 3, | |
'packagist.php' => 3, | |
'events' => 3, | |
'example.config.php' => 3, | |
'phpunit.ci.xml' => 3, | |
'multiselectasset.php' => 3, | |
'_tests_boostrap.php' => 3, | |
'pmdrules.xml' => 3, | |
'hello_world.php' => 3, | |
'php-git-hooks.yml.sample' => 3, | |
'registrationinterface.php' => 3, | |
'userinterface.php' => 3, | |
'tinymcelangasset.php' => 3, | |
'coresphereconsolebundle.php' => 3, | |
'widophttpadapterbundle.php' => 3, | |
'datagrid.php' => 3, | |
'defaultvaluesupplier.php' => 3, | |
'resourceregistrar.php' => 3, | |
'doctrinemigrationsbundle.php' => 3, | |
'upgrade-4.0' => 3, | |
'twittercard.php' => 3, | |
'install.json' => 3, | |
'abstractlogger.php' => 3, | |
'braintree.php' => 3, | |
'generatorinterface.php' => 3, | |
'countrycodetoregioncodemapfortesting.php' => 3, | |
'di.php' => 3, | |
'cleanup.sh' => 3, | |
'containerawareinterface.php' => 3, | |
'arc2_class.php' => 3, | |
'failedjob.php' => 3, | |
'querybuilderinterface.php' => 3, | |
'nbt' => 3, | |
'autounit' => 3, | |
'zend-license' => 3, | |
'angularanimateasset.php' => 3, | |
'placeholder.php' => 3, | |
'agpl' => 3, | |
'.htaccess.example' => 3, | |
'whiteoctoberpagerfantabundle.php' => 3, | |
'phpunit.autoload.php.dist' => 3, | |
'datamapperinterface.php' => 3, | |
'qywechat.php' => 3, | |
'uploadevents.php' => 3, | |
'mpwechat.php' => 3, | |
'content-link.php' => 3, | |
'tracker.php' => 3, | |
'hash.php' => 3, | |
'sample.html' => 3, | |
'requireasset.php' => 3, | |
'httpkernel.php' => 3, | |
'forminterface.php' => 3, | |
'formexception.php' => 3, | |
'liuggioexcelbundle.php' => 3, | |
'check.sh' => 3, | |
'js_localize.php' => 3, | |
'global.js' => 3, | |
'lock.php' => 3, | |
'bag.php' => 3, | |
'selection.json' => 3, | |
'cronbundle.php' => 3, | |
'filegetcontentsloader.php' => 3, | |
'maintenance.php' => 3, | |
'example.sh' => 3, | |
'search.html' => 3, | |
'phar.php' => 3, | |
'readme-pt_br' => 3, | |
'expressionfunction.php' => 3, | |
'tasks.xml' => 3, | |
'expressionfunctionproviderinterface.php' => 3, | |
'parsedexpression.php' => 3, | |
'menusserviceprovider.php' => 3, | |
'menuitem.php' => 3, | |
'serializedparsedexpression.php' => 3, | |
'syntaxerror.php' => 3, | |
'.todo' => 3, | |
'tokenstream.php' => 3, | |
'menufacade.php' => 3, | |
'widgets.php' => 3, | |
'rmspushnotificationsbundle.php' => 3, | |
'punkavefileuploaderbundle.php' => 3, | |
'control_registry.inc.php' => 3, | |
'angularrouteasset.php' => 3, | |
'toggle.php' => 3, | |
'chatlibasset.php' => 3, | |
'chatwidget.php' => 3, | |
'tpgextjsbundle.php' => 3, | |
'amchartasset.php' => 3, | |
'commands.php' => 3, | |
'stringutils.php' => 3, | |
' changelog' => 3, | |
'detect.php' => 3, | |
'fxpassetplugin.php' => 3, | |
'assetevents.php' => 3, | |
'abstractclient.php' => 3, | |
'phpunit.xml.dev' => 3, | |
'.classpath' => 3, | |
'createphar.php' => 3, | |
'wp-cli.php' => 3, | |
'modalasset.php' => 3, | |
'modelinterface.php' => 3, | |
'abstractpaginator.php' => 3, | |
'raw.sql' => 3, | |
'formtest.php' => 3, | |
'lengthawarepaginator.php' => 3, | |
'bootstrapthreepresenter.php' => 3, | |
'config.sample' => 3, | |
'urlinterface.php' => 3, | |
'migration' => 3, | |
'bootstrapthreenextpreviousbuttonrenderertrait.php' => 3, | |
'cachetrait.php' => 3, | |
'kindeditorcontroller.php' => 3, | |
'travis-init.sh' => 3, | |
'urlwindow.php' => 3, | |
'migrationgenerator.php' => 3, | |
'memcachedconnector.php' => 3, | |
'.php-cs' => 3, | |
'generate-doc' => 3, | |
'omnipaybundle.php' => 3, | |
'phpmd_rules.xml' => 3, | |
'inspectations.xml' => 3, | |
'invalidargumentexception.php' => 3, | |
'mdruleset.xml' => 3, | |
'phpfastcache.php' => 3, | |
'cmd.php' => 3, | |
'imageinterface.php' => 3, | |
'jmstranslationbundle.php' => 3, | |
'phalcon.bat' => 3, | |
'.env.local.php' => 3, | |
'phalcon.php' => 3, | |
'prove.php' => 3, | |
'test2.php' => 3, | |
'phalcon.pear' => 3, | |
'memcache.php' => 3, | |
'translatorinterface.php' => 3, | |
'abstractdriver.php' => 3, | |
'returnurl.php' => 3, | |
'dbexception.php' => 3, | |
'phalcon-completion.bash' => 3, | |
'apidoc.json' => 3, | |
'thrift_protocol.ini' => 3, | |
'readme.apache' => 3, | |
'plugins.php' => 3, | |
'yuicompressor-2.4.8.jar' => 3, | |
'generate-package.php' => 3, | |
'pom.xml.dist' => 3, | |
'regexp.php' => 3, | |
'makefile-neam' => 3, | |
'gplv3' => 3, | |
'urlwindowpresentertrait.php' => 3, | |
'.gtignore' => 3, | |
'useragent.php' => 3, | |
'simplebootstrapthreepresenter.php' => 3, | |
'makepackage.php' => 3, | |
'scanner.php' => 3, | |
'serverinterface.php' => 3, | |
'oss.php' => 3, | |
'yiiwheels.php' => 3, | |
'filesysteminterface.php' => 3, | |
'content-page.php' => 3, | |
'standard' => 3, | |
'example.composer.json' => 3, | |
'elfinder.html' => 3, | |
'prestacmssandboxbundle.php' => 2, | |
'twocheckoutadapter.php' => 2, | |
'twocheckout.php' => 2, | |
'lincense' => 2, | |
'kcfinderwidgetasset.php' => 2, | |
'config.codekit' => 2, | |
'sami.phar' => 2, | |
'kcfinderinputwidget.php' => 2, | |
'benchmark' => 2, | |
'kcfinder.php' => 2, | |
'phpbu.xml.sample' => 2, | |
'example.json' => 2, | |
'ccdncomponentcrumbtrailbundle.php' => 2, | |
'twocheckoutcharge.php' => 2, | |
'install-apigen.sh' => 2, | |
'flag.php' => 2, | |
'tinymce.gzip.php' => 2, | |
'screenshot.gif' => 2, | |
'twocheckoutmessage.php' => 2, | |
'twocheckoutnotification.php' => 2, | |
'install-apigen.sh.bat' => 2, | |
'push-docs-to-gh-pages.sh' => 2, | |
'yuccaprerenderbundle.php' => 2, | |
'adminltepluginasset.php' => 2, | |
'errors.json' => 2, | |
'twocheckoutreturn.php' => 2, | |
'entitymanagerinterface.php' => 2, | |
'push.sh' => 2, | |
'fkrcssurlrewritebundle.php' => 2, | |
'newscoopfacebookmetabundle.php' => 2, | |
'mailqueue.php' => 2, | |
'migrationmodule.php' => 2, | |
'functions.sh' => 2, | |
'bc-mapi.php' => 2, | |
'remoteserviceprovider.php' => 2, | |
'remotemanager.php' => 2, | |
'multiconnection.php' => 2, | |
'elfindervolumeflysystem.php' => 2, | |
'config.dist.ini' => 2, | |
'run_phpcs_experiment.php' => 2, | |
'resourcecontroller.php' => 2, | |
'colorboxasset.php' => 2, | |
'bc-mapi-cache.php' => 2, | |
'multipleselectasset.php' => 2, | |
'filemodel.php' => 2, | |
'.labname' => 2, | |
'cloner.php' => 2, | |
'seclibgateway.php' => 2, | |
'commentsmodule.php' => 2, | |
'trustyserviceprovider.php' => 2, | |
'addtrustexternalcaroot.crt' => 2, | |
'command_classes.php' => 2, | |
'anvil.php' => 2, | |
'yaml_translation_patterns.yml' => 2, | |
'cps_api.php' => 2, | |
'cps_simple.php' => 2, | |
'trusty.php' => 2, | |
'.atoum.coverage.php' => 2, | |
'validatorserviceprovider.php' => 2, | |
'.lgtm' => 2, | |
'lgpl-license' => 2, | |
'_autoload.php' => 2, | |
'tagsinput.php' => 2, | |
'tagsinputasset.php' => 2, | |
'coveralls.yml' => 2, | |
'documentation.config.xml' => 2, | |
'daemoncontroller.php' => 2, | |
'keys.php' => 2, | |
'event.js' => 2, | |
'multipleselect.php' => 2, | |
'baseyii.php' => 2, | |
'intltelinputasset.php' => 2, | |
'matrix.php' => 2, | |
'uploadcare.php' => 2, | |
'datacolumn.php' => 2, | |
'vreshtwiliobundle.php' => 2, | |
'filesbehavior.php' => 2, | |
'set_guzzle5.sh' => 2, | |
'template.js' => 2, | |
'config.inc.php.sample' => 2, | |
'screenshot1.jpg' => 2, | |
'ueditorcontroller.php' => 2, | |
'fatalerrorexception.php' => 2, | |
'magic.php' => 2, | |
'game.php' => 2, | |
'colorpickerwidget.php' => 2, | |
'xlsview.php' => 2, | |
'easyimageasset.php' => 2, | |
'phpzone.yml' => 2, | |
'ueditorwidget.php' => 2, | |
'uploadifyaction.php' => 2, | |
'uploadcropasset.php' => 2, | |
'uploadcrop.php' => 2, | |
'inarrayvalidator.php' => 2, | |
'.hound.yml' => 2, | |
'documentfactoryinterface.php' => 2, | |
'preview.php' => 2, | |
'defaultdocumentfactory.php' => 2, | |
'statistics.php' => 2, | |
'widgetmanager.php' => 2, | |
'prompts.json' => 2, | |
'dsl_config.dist' => 2, | |
'tikaapp.php' => 2, | |
'readmegen' => 2, | |
'soqratehtml2pdfbundle.php' => 2, | |
'openpayu.php' => 2, | |
'unitpay.php' => 2, | |
'readmegen.yml' => 2, | |
'phpbu' => 2, | |
'b2_api.php' => 2, | |
'iso4217test.php' => 2, | |
'newscoopeditorbundle.php' => 2, | |
'coverage.sh' => 2, | |
'ajax.js' => 2, | |
'validatorexception.php' => 2, | |
'fnactivefield.php' => 2, | |
'curlchannel.php' => 2, | |
'note.json' => 2, | |
'checklicense.php' => 2, | |
'frequencewebcalendrbundle.php' => 2, | |
'cjson.php' => 2, | |
'stfalcontinymcebundle.php' => 2, | |
'liipimaginebundle.php' => 2, | |
'annotationreader.php' => 2, | |
'phinx.dist.yml' => 2, | |
'recaptchalib.php' => 2, | |
'containerloader.php' => 2, | |
'rcserviredbundle.php' => 2, | |
'iso4217.php' => 2, | |
'httpkernelinterface.php' => 2, | |
'coverage.yml' => 2, | |
'migrationmanager.php' => 2, | |
'weixin.php' => 2, | |
'peridot.coverage.php' => 2, | |
'nginx.sample.conf' => 2, | |
'send24.php' => 2, | |
'config.php.sample' => 2, | |
'clientjson.php' => 2, | |
'angular-resource.min.js' => 2, | |
'upyun.class.php' => 2, | |
'qrcode.class.php' => 2, | |
'stageinterface.php' => 2, | |
'exceptionserviceprovider.php' => 2, | |
'.phptidy-config.php' => 2, | |
'composerextension.php' => 2, | |
'jorobo.dist.ini' => 2, | |
'jorobo.ini' => 2, | |
'config.yaml.dist' => 2, | |
'backbee' => 2, | |
'angular-resource.js' => 2, | |
'yo.php' => 2, | |
'jquery-ui.min.js' => 2, | |
'php' => 2, | |
'emigratecommand.php' => 2, | |
'docker-compose-example.yml' => 2, | |
'pear5.php' => 2, | |
'serializeattributeexception.php' => 2, | |
'deserializeattributeexception.php' => 2, | |
'payubundle.php' => 2, | |
'ccdncomponentbbcodebundle.php' => 2, | |
'readme.wiki' => 2, | |
'memberserviceprovider.php' => 2, | |
'.docgen' => 2, | |
'emailaddressvalidator.php' => 2, | |
'gatewayfactory.php' => 2, | |
'readme-laravel' => 2, | |
'webmoney.php' => 2, | |
'angular-route.js' => 2, | |
'ext-theme-classic-sandbox.js' => 2, | |
'membertab.php' => 2, | |
'upgrade-2.0.0' => 2, | |
'listview.php' => 2, | |
'options_user_settings.php' => 2, | |
'ckeditorwidget.php' => 2, | |
'slyrelationbundle.php' => 2, | |
'extdirectbundle.php' => 2, | |
'makefile.docker' => 2, | |
'class.phpmaileroauthgoogle.php' => 2, | |
'deploy.example.php' => 2, | |
'runtime.php' => 2, | |
'class.phpmaileroauth.php' => 2, | |
'editableaction.php' => 2, | |
'csvview.php' => 2, | |
'languarasymfonybundle.php' => 2, | |
'sendgrid_loader.php' => 2, | |
'gateway.php' => 2, | |
'stat.php' => 2, | |
'ccdnforumadminbundle.php' => 2, | |
'sendgrid.php' => 2, | |
'readonly.php' => 2, | |
'sake' => 2, | |
'colorpickerasset.php' => 2, | |
'fpjsformvalidatorbundle.php' => 2, | |
'ccdncomponentcommonbundle.php' => 2, | |
'main.php5' => 2, | |
'cli-script.php' => 2, | |
'readme_composerinstall' => 2, | |
'.htaccess.original' => 2, | |
'extender.php' => 2, | |
'zayassborisbundle.php' => 2, | |
'solrinterface.php' => 2, | |
'autogitpull.sublime-project' => 2, | |
'get_oauth_token.php' => 2, | |
'pagesize.php' => 2, | |
'lisezmoi.mkd' => 2, | |
'externallib.php' => 2, | |
'serializedattributes.php' => 2, | |
'_read_me' => 2, | |
'channelinterface.php' => 2, | |
'shortcode.php' => 2, | |
'phpbu.xsd' => 2, | |
'tokenizer.php' => 2, | |
'baseform.php' => 2, | |
'bootstrapevents.php' => 2, | |
'restbundle.php' => 2, | |
'multilanguagebehavior.php' => 2, | |
'apiquery.php' => 2, | |
'ajaxform.php' => 2, | |
'deploy_cfg.sh.init' => 2, | |
'singleasset.php' => 2, | |
'multipleasset.php' => 2, | |
'countries.php' => 2, | |
'multilanguagehelper.php' => 2, | |
'confighelper.php' => 2, | |
'.module.php' => 2, | |
'docs.ini' => 2, | |
'deploy_cfg.sh.travis' => 2, | |
'command' => 2, | |
'super-cpt.php' => 2, | |
'ccdncomponentdashboardbundle.php' => 2, | |
'devicedetector.php' => 2, | |
'conf.json' => 2, | |
'.scrutiizer.yml' => 2, | |
'extend_doc' => 2, | |
'caxyelasticsearchbundle.php' => 2, | |
'readme-pt-br' => 2, | |
'example_debug.png' => 2, | |
'developer' => 2, | |
'phpsigepfpdf.php' => 2, | |
'servicecontainer.php' => 2, | |
'tableview.php' => 2, | |
'abstractfixture.php' => 2, | |
'exporterview.php' => 2, | |
'multilanguagetrait.php' => 2, | |
'_lisez_moi' => 2, | |
'phploy.bat' => 2, | |
'bootswatchasset.php' => 2, | |
'staffimrollbarbundle.php' => 2, | |
'phpunit-mysql.xml' => 2, | |
't3jquery' => 2, | |
'rollbarreporter.php' => 2, | |
'phploy.php' => 2, | |
'schebtwofactorbundle.php' => 2, | |
'tests' => 2, | |
'assetmanagerinterface.php' => 2, | |
'reportdecisionmanager.php' => 2, | |
'jquerycookieasset.php' => 2, | |
'runphpunittests.sh' => 2, | |
'angular-route.min.js' => 2, | |
'html2pdf.php' => 2, | |
'admin_tools.php' => 2, | |
'fnactiveform.php' => 2, | |
'excelformatter.php' => 2, | |
'subscriber.php' => 2, | |
'adminer.css' => 2, | |
'multilanguageurlmanager.php' => 2, | |
'kwattromarkdownbundle.php' => 2, | |
'kernelevents.php' => 2, | |
'database_mysql.sql' => 2, | |
'.travis-build.sh' => 2, | |
'dates.php' => 2, | |
1 => 2, | |
'json_io.php' => 2, | |
'magnificpopup.php' => 2, | |
'head' => 2, | |
'ccdncomponentattachmentbundle.php' => 2, | |
'easyuiasset.php' => 2, | |
'credentials.json' => 2, | |
'bindinginterface.php' => 2, | |
'index.php.bak' => 2, | |
'reflected_runner.php' => 2, | |
'observer.php' => 2, | |
'svggraphdatalabels.php' => 2, | |
'svggraphcolours.php' => 2, | |
'svggraphbarandlinegraph.php' => 2, | |
'importinterface.php' => 2, | |
'dynamicformbundle.php' => 2, | |
'phpunit_pgsql.xml' => 2, | |
'bootstrapbundle.php' => 2, | |
'drupal-ti' => 2, | |
'pdfresponseformatter.php' => 2, | |
'ansible.cfg' => 2, | |
'baseconverter.php' => 2, | |
'makefile.in' => 2, | |
'glorpenpropelbundle.php' => 2, | |
'grunt-menu.sh' => 2, | |
'locationpickerasset.php' => 2, | |
'multiselectwidget.php' => 2, | |
'readme_zh-cn' => 2, | |
'.vagrant' => 2, | |
'portlet.php' => 2, | |
'sparklineasset.php' => 2, | |
'wsdlgenerator.php' => 2, | |
'webservice.php' => 2, | |
'select2widget.php' => 2, | |
'knobasset.php' => 2, | |
'class-plugin.php' => 2, | |
'jcropwidget.php' => 2, | |
'grunt-installer.sh' => 2, | |
'waveform.php' => 2, | |
'consulta' => 2, | |
'ohformerrorlogbundle.php' => 2, | |
'readme_1' => 2, | |
'filecontroller.php' => 2, | |
'menubundle.php' => 2, | |
'watcher' => 2, | |
'nestableasset.php' => 2, | |
'config.json.sample' => 2, | |
'phar-cli-stub.php' => 2, | |
'phphelper.php' => 2, | |
'slickwidget.php' => 2, | |
'generate_package_xml.php' => 2, | |
'.pharcc.yml' => 2, | |
'convention.php' => 2, | |
'ci.sh' => 2, | |
'added info fonts' => 2, | |
'container.xml' => 2, | |
'simplecache.php' => 2, | |
'readme_fr' => 2, | |
'tadckatreeevents.php' => 2, | |
'autoload.php-dist' => 2, | |
'ldap.php' => 2, | |
'filename.sql' => 2, | |
'apex' => 2, | |
'pusher.php' => 2, | |
'readme.pdf' => 2, | |
'flintlabsformmetadatabundle.php' => 2, | |
'release-1.0.0' => 2, | |
'highlightjsasset.php' => 2, | |
'notificacao' => 2, | |
'package.png' => 2, | |
'syntaxhighlighter.php' => 2, | |
'emailer.php' => 2, | |
'amqplibconnector.php' => 2, | |
'amqp.php' => 2, | |
'.nojekyll' => 2, | |
'how-to' => 2, | |
'constraintvalidatorfactory.php' => 2, | |
'apimodule.php' => 2, | |
'twigengine.php' => 2, | |
'yiinewrelic.php' => 2, | |
'yiinewrelicclientscript.php' => 2, | |
'picture.png' => 2, | |
'fieldinterface.php' => 2, | |
'init.sql' => 2, | |
'.vimproject' => 2, | |
'.phpspec.yml' => 2, | |
'plugin.png' => 2, | |
'clean' => 2, | |
'region.php' => 2, | |
'swiper.php' => 2, | |
'hierarchy.php' => 2, | |
'imgur.php' => 2, | |
'smsserviceinterface.php' => 2, | |
'.travis.yml.old' => 2, | |
'curlwrapper.php' => 2, | |
'bmatznerfoundationbundle.php' => 2, | |
'invalidconfigexception.php' => 2, | |
'travis.yaml' => 2, | |
'amqplibconnectorssl.php' => 2, | |
'requisicao_pagamento' => 2, | |
'param' => 2, | |
'flotasset.php' => 2, | |
'excanvasasset.php' => 2, | |
'gitmanager.sh' => 2, | |
'codemirrorwidget.php' => 2, | |
'restexception.php' => 2, | |
'admingeneratoruserbundle.php' => 2, | |
'ifilter.php' => 2, | |
'redisconnector.php' => 2, | |
'install_amqp.sh' => 2, | |
'bootstrap-media-lightbox.min.js' => 2, | |
'bootstrap-media-lightbox.less' => 2, | |
'forms' => 2, | |
'bootstrap-media-lightbox.js' => 2, | |
'array.php' => 2, | |
'bootstrap-media-lightbox.css' => 2, | |
'gauges.yml' => 2, | |
'ooyalaapi.php' => 2, | |
'tpredactorbundle.php' => 2, | |
'celery.php' => 2, | |
'sample-data.sql' => 2, | |
'plex.php' => 2, | |
'getid3core.php' => 2, | |
'routeproviderinterface.php' => 2, | |
'routecompilerinterface.php' => 2, | |
'routecompiler.php' => 2, | |
'amqppeclconnector.php' => 2, | |
'apns.php' => 2, | |
'apnsgcm.php' => 2, | |
'phpmqtt.php' => 2, | |
'knppiwikbundle.php' => 2, | |
'roller_xhprof.php' => 2, | |
'knpdisqusbundle.php' => 2, | |
'mcapi.class.php' => 2, | |
'sample.htaccess' => 2, | |
'propel.yaml' => 2, | |
'now.php' => 2, | |
'doxygen' => 2, | |
'knpmarkdownbundle.php' => 2, | |
'markdownparserinterface.php' => 2, | |
'phpunit-cov.xml' => 2, | |
'presentableinterface.php' => 2, | |
'knpmenubundle.php' => 2, | |
'bootstrapconfirmationasset.php' => 2, | |
'update.readme' => 2, | |
'abstractdocument.php' => 2, | |
'knpradbundle.php' => 2, | |
'knpsnappybundle.php' => 2, | |
'datetimeformatter.php' => 2, | |
'pagesbundle.php' => 2, | |
'composer.json.save' => 2, | |
'escaper.php' => 2, | |
'expr.php' => 2, | |
'record.php' => 2, | |
'updating' => 2, | |
'h2o.php' => 2, | |
'agent.php' => 2, | |
'support.readme' => 2, | |
'kitanoconnectionbundle.php' => 2, | |
'doctrine-extensions-mapping.xsd' => 2, | |
'bootstrapselectasset.php' => 2, | |
'owners' => 2, | |
'b' => 2, | |
'connectionmanager.php' => 2, | |
'panel.phtml' => 2, | |
'google-analytics-readme' => 2, | |
'ruleschecker.php' => 2, | |
'statementinterface.php' => 2, | |
'travis-ci-apache' => 2, | |
'association.php' => 2, | |
'associationcollection.php' => 2, | |
'tags.php' => 2, | |
'assetconverter.php' => 2, | |
'resultset.php' => 2, | |
'cacheevents.php' => 2, | |
'how-to-install' => 2, | |
'how-to-use' => 2, | |
'travisphp.ini' => 2, | |
'sync_data.py' => 2, | |
'tableregistry.php' => 2, | |
'db' => 2, | |
'imageuploadbehavior.php' => 2, | |
'main.css' => 2, | |
'phpdir.h' => 2, | |
'phpdir.c' => 2, | |
'path.h' => 2, | |
'path.c' => 2, | |
'kptivepaymentsipsbundle.php' => 2, | |
'fsidoctrineextensionsbundle.php' => 2, | |
'model.class.php' => 2, | |
'upgrade_from_ratchet' => 2, | |
'cmakelists' => 2, | |
'_aerospike_ide_helper.php' => 2, | |
'phpcs_rules.xml' => 2, | |
'videojsasset.php' => 2, | |
'apicontroller.php' => 2, | |
'modelhelper.php' => 2, | |
'bulutyazilimlocationbundle.php' => 2, | |
'kgstaticbundle.php' => 2, | |
'bulutyazilimfeedbackbundle.php' => 2, | |
'opcache.php' => 2, | |
'usersasset.php' => 2, | |
'routemanager.php' => 2, | |
'rollbar.php' => 2, | |
'curlhttp.php' => 2, | |
'wpcept' => 2, | |
'wpcept.bat' => 2, | |
'ext_icon.svg' => 2, | |
'.env.php' => 2, | |
'lswapicallerbundle.php' => 2, | |
'prestasonatagedmodoctrineextensionsbundle.php' => 2, | |
'refactor' => 2, | |
'twillio.php' => 2, | |
'lswmemcachebundle.php' => 2, | |
'offsitepaymentfactory.php' => 2, | |
'gcm.php' => 2, | |
'filehandler.php' => 2, | |
'zray.php' => 2, | |
'releasing' => 2, | |
'sami_config.php' => 2, | |
'googlecalendarasset.php' => 2, | |
'test.log' => 2, | |
'getstorage.php' => 2, | |
'upgrade-3.3' => 2, | |
'source' => 2, | |
'upgrade-3.4' => 2, | |
'lock.png' => 2, | |
'dns.php' => 2, | |
'kunstmaansentrybundle.php' => 2, | |
'datastore.php' => 2, | |
'domains.php' => 2, | |
'aceeditorasset.php' => 2, | |
'mailgun.php' => 2, | |
'twitter_client.json' => 2, | |
'whiteoctoberbreadcrumbsbundle.php' => 2, | |
'adjacencylistbehavior.php' => 2, | |
'materializedpathbehavior.php' => 2, | |
'builddocs.sh' => 2, | |
'upgrade-1.7' => 2, | |
'example_config.yml' => 2, | |
'whats_new' => 2, | |
'upgrade-1.6' => 2, | |
'geoip.php' => 2, | |
'passwordbehavior.php' => 2, | |
'.lin3s_cs.yml.dist' => 2, | |
'loginform.php' => 2, | |
'usermanager.php' => 2, | |
'dump.rdb' => 2, | |
'filereader.php' => 2, | |
'fieldset.php' => 2, | |
'cacheclientinterface.php' => 2, | |
'configurator.php' => 2, | |
'easythumbnail.php' => 2, | |
'easythumbnailimage.php' => 2, | |
'extendabletrait.php' => 2, | |
'errorstack.php' => 2, | |
'formevent.php' => 2, | |
'opencall.php' => 2, | |
'neklandfeedbundle.php' => 2, | |
'setterbuilder.php' => 2, | |
'imageservice.php' => 2, | |
'ss_upgrade_log' => 2, | |
'abstractevent.php' => 2, | |
'berylliumcachebundle.php' => 2, | |
'containerbuilder.php' => 2, | |
'filewriter.php' => 2, | |
'streamresponse.php' => 2, | |
'streamwriterinterface.php' => 2, | |
'streamwriterwrapper.php' => 2, | |
'readme-cn' => 2, | |
'accessor.php' => 2, | |
'util.js' => 2, | |
'processing.js' => 2, | |
'jquery.cookie.js' => 2, | |
'extendable.php' => 2, | |
'excanvas.min.js' => 2, | |
'theme.yaml' => 2, | |
'install_fr' => 2, | |
'extensionbase.php' => 2, | |
'confirm.js' => 2, | |
'phpspec-with-coverage.yml' => 2, | |
'networkserviceprovider.php' => 2, | |
'file-header.js' => 2, | |
'ext-theme-neptune.js' => 2, | |
'urlserviceprovider.php' => 2, | |
'ext-theme-gray.js' => 2, | |
'ext-theme-classic.js' => 2, | |
'graphinterface.php' => 2, | |
'ext-theme-access.js' => 2, | |
'ext-all-rtl.js' => 2, | |
'ext-all-rtl-dev.js' => 2, | |
'ext-all-rtl-debug.js' => 2, | |
'ext-all-rtl-debug-w-comments.js' => 2, | |
'mangopayevents.php' => 2, | |
'facebookstrategy.php' => 2, | |
'blockbuilder.php' => 2, | |
'vincetbootstrapformbundle.php' => 2, | |
'extensiontrait.php' => 2, | |
'divider.php' => 2, | |
'stfalconblogbundle.php' => 2, | |
'supported_apis' => 2, | |
'php-ups-api-logo.svg' => 2, | |
'replica2.php' => 2, | |
'replica2-win.php' => 2, | |
'p533patch.php' => 2, | |
'deepfreeze.php' => 2, | |
'googlestrategy.php' => 2, | |
'excanvas.js' => 2, | |
'url.js' => 2, | |
'tfoxmpdfportbundle.php' => 2, | |
'tasks.php' => 2, | |
'propelbundle.php' => 2, | |
'task' => 2, | |
'apitest.php' => 2, | |
'ext.store_rabobank.php' => 2, | |
'clarolinesurveybundle.php' => 2, | |
'distelli-manifest.yml' => 2, | |
'curltransport.php' => 2, | |
'autoload_proto.php' => 2, | |
'directbundle.php' => 2, | |
'simple-php-captcha.php' => 2, | |
'gpl-2.0' => 2, | |
'.env.example.php' => 2, | |
'jsonformatter.php' => 2, | |
'mediaevents.php' => 2, | |
'jsonparser.php' => 2, | |
'heroku' => 2, | |
'proxyclient.php' => 2, | |
'releasenotes-2.22' => 2, | |
'icalcreator.php' => 2, | |
'upgrade.php' => 2, | |
'wizardevent.php' => 2, | |
'streamtransport.php' => 2, | |
'urlencodedformatter.php' => 2, | |
'urlencodedparser.php' => 2, | |
'wizardbehavior.php' => 2, | |
'xmlformatter.php' => 2, | |
'clarolinescormbundle.php' => 2, | |
'kos4liveacldoctrinequerybundle.php' => 2, | |
'date.js' => 2, | |
'node.jpeg' => 2, | |
'emailtemplatebundle.php' => 2, | |
'updater.php' => 2, | |
'knptranslatorbundle.php' => 2, | |
'constraintviolation.php' => 2, | |
'treecollection.php' => 2, | |
'pivot.php' => 2, | |
'markdownextra.php' => 2, | |
'nestedtreescope.php' => 2, | |
'modelexception.php' => 2, | |
'dongle.php' => 2, | |
'datafeed.php' => 2, | |
'configserviceprovider.php' => 2, | |
'crouter.php' => 2, | |
'scrollpager.php' => 2, | |
'authexception.php' => 2, | |
'microtpl.php' => 2, | |
'phpimageoptim.iml' => 2, | |
'maesboxvideobundle.php' => 2, | |
'extensions.php' => 2, | |
'jshrink.php' => 2, | |
'sdk_config.ini' => 2, | |
'ftrrtfrollbarbundle.php' => 2, | |
'class.magic-min.php' => 2, | |
'gettoken.php' => 2, | |
'plugin_classmap.php' => 2, | |
'deployment.ini' => 2, | |
'version.properties' => 2, | |
'markdowndata.php' => 2, | |
'ion.php' => 2, | |
'videowidget.php' => 2, | |
'phpunit.config.xml' => 2, | |
'lazyloadasset.php' => 2, | |
'.hgsubstate' => 2, | |
'.hgsub' => 2, | |
'apikey.php.dist' => 2, | |
'clientconfiguration.php' => 2, | |
'tmdbsymfonybundle.php' => 2, | |
'statementrepository.php' => 2, | |
'chrome.xsl' => 2, | |
'content.xsl' => 2, | |
'harvest_api_config.json.dist' => 2, | |
'contenttools.php' => 2, | |
'filevalidator.php' => 2, | |
'datetimefilewriter.php' => 2, | |
'fileuploadaction.php' => 2, | |
'class.html.twig' => 2, | |
'htaccess.dist' => 2, | |
'bitpay_callback.php' => 2, | |
'layout.html.twig' => 2, | |
'namespace.html.twig' => 2, | |
'rootzone.php' => 2, | |
'bitgooglebundle.php' => 2, | |
'bitecodesfactrinebundle.php' => 2, | |
'showthread.php' => 2, | |
'showpost.php' => 2, | |
'container.html' => 2, | |
'xmlhelper.php' => 2, | |
'character.php' => 2, | |
'phpunit-xhprof.xml' => 2, | |
'example.yml' => 2, | |
'luneticszodiacbundle.php' => 2, | |
'ja_jp.csv' => 2, | |
'de_de.csv' => 2, | |
'es_ar.csv' => 2, | |
'jsonrpc.php' => 2, | |
'fr_fr.csv' => 2, | |
'pakefile_bootstrap.php' => 2, | |
'pl_pl.csv' => 2, | |
'ru_ru.csv' => 2, | |
'examples-static.php' => 2, | |
'baseactiverecord.php' => 2, | |
'datetimerangebehaviorfinder.php' => 2, | |
'datetimerangebehavior.php' => 2, | |
'apifactory.php' => 2, | |
'datetimeattributefinder.php' => 2, | |
'blueprint.yml' => 2, | |
'fr3dldapbundle.php' => 2, | |
'testbundle.php' => 2, | |
'cacheitem.php' => 2, | |
'daterangeconfig.php' => 2, | |
'dbup.phar' => 2, | |
'jquery.form.js' => 2, | |
'abstracttypeextension.php' => 2, | |
'jquery.metadata.js' => 2, | |
'team.php' => 2, | |
'datepickerconfig.php' => 2, | |
'pull-tests' => 2, | |
'graph.html' => 2, | |
'shellcontroller.php' => 2, | |
'articles.php' => 2, | |
'toastrajaxfeedasset.php' => 2, | |
'toastrajaxfeed.php' => 2, | |
'toastr.php' => 2, | |
'fmt.phar' => 2, | |
'fmt.phar.sha1' => 2, | |
'fmt.php' => 2, | |
'phpstorm-configuration.png' => 2, | |
'phpforcesalesforcebundle.php' => 2, | |
'imagescontroller.php' => 2, | |
'class-autoload.php' => 2, | |
'schema.sqlite.sql' => 2, | |
'videoembed.php' => 2, | |
'fileuploadbehavior.php' => 2, | |
'toastrflash.php' => 2, | |
'bash_completion' => 2, | |
'foursquare.php' => 2, | |
'relationship.php' => 2, | |
'blade.php' => 2, | |
'known-broken-words' => 2, | |
'runtest.sh' => 2, | |
'phpunit.autoload.php' => 2, | |
'start' => 2, | |
'test1' => 2, | |
'moduleserviceprovider.php' => 2, | |
'xacml-core-v3-schema-wd-17.xsd' => 2, | |
'parseserviceprovider.php' => 2, | |
'toastrcustomasset.php' => 2, | |
'aphpfmt' => 2, | |
'layout.xsl' => 2, | |
'testloader.php' => 2, | |
'namespaces.xsl' => 2, | |
'signals.yml' => 2, | |
'packages.xsl' => 2, | |
'search.json.xsl' => 2, | |
'.travic.yml' => 2, | |
'jpush.php' => 2, | |
'xoops_version.php' => 2, | |
'annotationparser.php' => 2, | |
'faq.php' => 2, | |
'mcp.php' => 2, | |
'operation.php' => 2, | |
'ucp.php' => 2, | |
'viewonline.php' => 2, | |
'my_model.php' => 2, | |
'tinypng.php' => 2, | |
'json_response.php' => 2, | |
'errors' => 2, | |
'build-config.js' => 2, | |
'ckeditor.js' => 2, | |
'smartybundle.php' => 2, | |
'contents.css' => 2, | |
'styles.js' => 2, | |
'license-en' => 2, | |
'apigen.neon.dist' => 2, | |
'apigen-dev.neon.dist' => 2, | |
'spy.php' => 2, | |
'autoload.php.dist.php' => 2, | |
'wmusedrootcas.cer' => 2, | |
'silex' => 2, | |
'ornicarakismetbundle.php' => 2, | |
'highcharts-3d.src.js' => 2, | |
'resque' => 2, | |
'inspector.php' => 2, | |
'curlresponse.php' => 2, | |
'jquery.min.map' => 2, | |
'setup_locale' => 2, | |
'jquery-ui.js' => 2, | |
'solrdataprovider.php' => 2, | |
'solrdocumentinterface.php' => 2, | |
'slimscroll.php' => 2, | |
'src' => 2, | |
'highcharts-all.js' => 2, | |
'deployment.sample.php' => 2, | |
'.ohloh' => 2, | |
'highcharts-3d.js' => 2, | |
'database.db' => 2, | |
'example-atom.php' => 2, | |
'userasset.php' => 2, | |
'user_agent.php' => 2, | |
'elfinderasset.php' => 2, | |
'example-rss.php' => 2, | |
'template.html' => 2, | |
'sassparser.php' => 2, | |
'basewechat.php' => 2, | |
'hps.php' => 2, | |
'sassfile.php' => 2, | |
'app.js' => 2, | |
'audittrail.php' => 2, | |
'sassexception.php' => 2, | |
'highlightjs.php' => 2, | |
'nomad_mimemail.inc.php' => 2, | |
'nomad_mimemail.test.php' => 2, | |
'abstractconnection.php' => 2, | |
'css.js' => 2, | |
'drag.js' => 2, | |
'phpspec-test.yml' => 2, | |
'looptribeformspatialbundle.php' => 2, | |
'composer.xml' => 2, | |
'dic.info' => 2, | |
'dic.install' => 2, | |
'dic.module' => 2, | |
'add-textdomain.php' => 2, | |
'.scruitinizer.yml' => 2, | |
'mongocursor.php' => 2, | |
'emongocursor.php' => 2, | |
'mapinput.php' => 2, | |
'phpunit.xml.dist.xml' => 2, | |
'dataflow.php' => 2, | |
'copyright.inc.php' => 2, | |
'podioapi.php' => 2, | |
'cursor.php' => 2, | |
'cron-svn-pots.php' => 2, | |
'importers-i18n.php' => 2, | |
'composer.json.hhvm' => 2, | |
'masonry.php' => 2, | |
'softdeletebehavior.php' => 2, | |
'privacy' => 2, | |
'phpstd' => 2, | |
'senchalogo.png' => 2, | |
'fullcalendarevent.php' => 2, | |
'vvv-init.sh' => 2, | |
'vvv-nginx.conf' => 2, | |
'singletontrait.php' => 2, | |
'notywidget.php' => 2, | |
'syliustranslationbundle.php' => 2, | |
'ui.js' => 2, | |
'.platform.app.yaml' => 2, | |
'networkinginitcmsbundle.php' => 2, | |
'gearmanevents.php' => 2, | |
'gearmanmethods.php' => 2, | |
'componenttrait.php' => 2, | |
'tinymcepluginsasset.php' => 2, | |
'vvv-hosts' => 2, | |
'memcached.php' => 2, | |
'simplepdo.php' => 2, | |
'securityexception.php' => 2, | |
'securityevent.php' => 2, | |
'phpunit-skelgen' => 2, | |
'settings.json' => 2, | |
'logo-icon-64.png' => 2, | |
'newscoopingestpluginbundle.php' => 2, | |
'newscoopsolrsearchpluginbundle.php' => 2, | |
'onioninit.php' => 2, | |
'mongo.php' => 2, | |
'makephar.php' => 2, | |
'templateengineinterface.php' => 2, | |
'twitteroauthexception.php' => 2, | |
'ruckus.php' => 2, | |
'scabbia' => 2, | |
'loggable.php' => 2, | |
'bcccronmanagerbundle.php' => 2, | |
'tabularinput.php' => 2, | |
'config.xml.dist' => 2, | |
'text' => 2, | |
'paymentsaferpaybundle.php' => 2, | |
'ckeditorinline.php' => 2, | |
'varspoolpygmentsbundle.php' => 2, | |
'services.xml' => 2, | |
'skeleton.php' => 2, | |
'license-flask' => 2, | |
'buzzclient.php' => 2, | |
'nullclient.php' => 2, | |
'cpanel.php' => 2, | |
'pagelink.php' => 2, | |
'nullresponse.php' => 2, | |
'index-example.php' => 2, | |
'coding_standard' => 2, | |
'skud.php' => 2, | |
'phpspec.yml.coverage' => 2, | |
'configboilerplate.php' => 2, | |
'jarvis.php' => 2, | |
'helper.class.php' => 2, | |
'emt.php' => 2, | |
'breadcrumblist.php' => 2, | |
'sweetalert.php' => 2, | |
'setup.html' => 2, | |
'nomad_mimemail.es.doc.html' => 2, | |
'loggerexception.php' => 2, | |
'grid-shortcodes.php' => 2, | |
'documentproperties.php' => 2, | |
'calculation.php' => 2, | |
'cachedobjectstoragefactory.php' => 2, | |
'sluggablebehavior.php' => 2, | |
'company.php' => 2, | |
'minkbundle.php' => 2, | |
'timerasset.php' => 2, | |
'sursecuritybundle.php' => 2, | |
'dockerfile.sh' => 2, | |
'generate' => 2, | |
'migrant-cfg.php' => 2, | |
'config.ini.example' => 2, | |
'hashtable.php' => 2, | |
't.php' => 2, | |
'micro.php' => 2, | |
'configure' => 2, | |
'bugsnagbundle.php' => 2, | |
'olixadminbundle.php' => 2, | |
'thumbnail.png' => 2, | |
'filetypeguesser.php' => 2, | |
'syntax' => 2, | |
'weberrorhandler.php' => 2, | |
'seoviewbehavior.php' => 2, | |
'filetypeguesserinterface.php' => 2, | |
'sitemapcontroller.php' => 2, | |
'documentsecurity.php' => 2, | |
'icomparable.php' => 2, | |
'panelasset.php' => 2, | |
'sieve.php' => 2, | |
'_project.properties' => 2, | |
'default.htaccess' => 2, | |
'php_functions.php' => 2, | |
'root.htaccess' => 2, | |
'fw.php' => 2, | |
'fileutil.php' => 2, | |
'stringutil.php' => 2, | |
'jsapipay.php' => 2, | |
'sandbox_setup.sh' => 2, | |
'sandbox_destroy.sh' => 2, | |
'instagramcomponent.php' => 2, | |
'embedjs.php' => 2, | |
'header' => 2, | |
'iofactory.php' => 2, | |
'angularresourceasset.php' => 2, | |
'expander.php' => 2, | |
'handsontable.php' => 2, | |
'handsontableasset.php' => 2, | |
'jaxlctl' => 2, | |
'jaxl.php' => 2, | |
'sitemapgenerator.php' => 2, | |
'worksheetiterator.php' => 2, | |
'worksheet.php' => 2, | |
'richtext.php' => 2, | |
'referencehelper.php' => 2, | |
'namedrange.php' => 2, | |
'liuggiorackspacecloudfilesbundle.php' => 2, | |
'backstretch.php' => 2, | |
'sismo.sh' => 2, | |
'sencha-touch-debug.js' => 2, | |
'chosenasset.php' => 2, | |
'graylogtarget.php' => 2, | |
'arrayobject.php' => 2, | |
'settings-example.php' => 2, | |
'rtxlabsdatatransformationbundle.php' => 2, | |
'ethna.php' => 2, | |
'redactorasset.php' => 2, | |
'nepalidatepickerasset.php' => 2, | |
'nepalidatepicker.php' => 2, | |
'index.consist.php' => 2, | |
'invoice.php' => 2, | |
'sencha-touch.js' => 2, | |
'sencha-touch-all.js' => 2, | |
'subsplit.sh' => 2, | |
'sencha-touch-all-debug.js' => 2, | |
'file-header' => 2, | |
'dd.sql' => 2, | |
'nprogressasset.php' => 2, | |
'rezzzabitterbundle.php' => 2, | |
'copying-lesser' => 2, | |
'plugin-update-checker.php' => 2, | |
'debug-bar-plugin.php' => 2, | |
'debug-bar-panel.php' => 2, | |
'database.sql' => 2, | |
'emutex.php' => 2, | |
'nomad_mimemail.en.doc.html' => 2, | |
'chosen.php' => 2, | |
'scrutinizr.yml' => 2, | |
'backstretchasset.php' => 2, | |
'fkrnominatimbundle.php' => 2, | |
'theme-my-login.css' => 2, | |
'sortableasset.php' => 2, | |
'oauthsignaturemethod_hmac_sha1.php' => 2, | |
'oauthsignaturemethod_plaintext.php' => 2, | |
'oauthsignaturemethod_rsa_sha1.php' => 2, | |
'seomodule.php' => 2, | |
'fsm.php' => 2, | |
'runtest.php' => 2, | |
'baffordpasswordstrengthbundle.php' => 2, | |
'jquerybundle.php' => 2, | |
'tagcachefactory.php' => 2, | |
'generate-website.sh' => 2, | |
'riperactivedirectorybundle.php' => 2, | |
'ewzuploaderbundle.php' => 2, | |
'do-source-release.sh' => 2, | |
'aria2.php' => 2, | |
'filesize.php' => 2, | |
'whmcs.php' => 2, | |
'cacheelement.php' => 2, | |
'zfdeploy.phar' => 2, | |
'sockettransport.class.php' => 2, | |
'smppclient.class.php' => 2, | |
'gsmencoder.class.php' => 2, | |
'jhgnexmobundle.php' => 2, | |
'jqwidgets.php' => 2, | |
'imagesloadedasset.php' => 2, | |
'seopresentation.php' => 2, | |
'seopresentationinterface.php' => 2, | |
'classutil.php' => 2, | |
'bazingapropeleventdispatcherbundle.php' => 2, | |
'smtpd.sublime-project' => 2, | |
'default.info' => 2, | |
'g' => 2, | |
'backup-restore.png' => 2, | |
'default.module' => 2, | |
'env.dist' => 2, | |
'masonry.yaml' => 2, | |
'dtcqueuebundle.php' => 2, | |
'iloader.php' => 2, | |
'froalaeditorasset.php' => 2, | |
'froalaeditorwidget.php' => 2, | |
'processcommunicationtrait.php' => 2, | |
'index.example.php' => 2, | |
'logentries.php' => 2, | |
'lelogger.php' => 2, | |
'processslave.php' => 2, | |
'authinterface.php' => 2, | |
'sonatadashboardbundle.php' => 2, | |
'uninstall' => 2, | |
'apcstore.php' => 2, | |
'arraystore.php' => 2, | |
'filestore.php' => 2, | |
'memcachedstore.php' => 2, | |
'nullstore.php' => 2, | |
'define.php' => 2, | |
' .travis.yml' => 2, | |
'behat.d8.drush.inc' => 2, | |
'mkdocs.php' => 2, | |
'onsitepaymentfactory.php' => 2, | |
'.mondrian.yml' => 2, | |
'.example.env' => 2, | |
'ganon.php' => 2, | |
'layout.tpl' => 2, | |
'coreutils.php' => 2, | |
'cypresstranslationbundle.php' => 2, | |
'install_libsmbclient.sh' => 2, | |
'petrovich.php' => 2, | |
'tinyrouter.php' => 2, | |
'sessions.php' => 2, | |
'showloadingasset.php' => 2, | |
'ekofeedbundle.php' => 2, | |
'chat.php' => 2, | |
'behat.d7.drush.inc' => 2, | |
'croncommand.php' => 2, | |
'xhprofcomponent.php' => 2, | |
'xhprofpanel.php' => 2, | |
'push-tags' => 2, | |
'subtree-split' => 2, | |
'datetimevalidator.php' => 2, | |
'concrete.json' => 2, | |
'bootstrap.test.php' => 2, | |
'cli.bat' => 2, | |
'behat-drush-common.inc' => 2, | |
'mailsender.php' => 2, | |
'theapicctvbundle.php' => 2, | |
'phpagi-fastagi.php' => 2, | |
'filelocator.php' => 2, | |
'index.js' => 2, | |
'resourcebundleinterface.php' => 2, | |
'querycountclient.php' => 2, | |
'syliuscontentbundle.php' => 2, | |
'syliusinventorybundle.php' => 2, | |
'liipfunctionaltestbundle.php' => 2, | |
'shortcuts.php' => 2, | |
'hydrator.php' => 2, | |
'require.js' => 2, | |
'run.ini' => 2, | |
'run.bat' => 2, | |
'html5-quick-template.html.php' => 2, | |
'syliusproductbundle.php' => 2, | |
'abstractresourcebundle.php' => 2, | |
'screen-copy.jpg' => 2, | |
'tmsolutiondatagridbundle.php' => 2, | |
'syliusresourcebundle.php' => 2, | |
'basetestcase.php' => 2, | |
'sidebar-footer.php' => 2, | |
'syliusthemebundle.php' => 2, | |
'decorator.php' => 2, | |
'voting.php' => 2, | |
'cybernoxamazonwebservicesbundle.php' => 2, | |
'phone.php' => 2, | |
'emadsdisplaywidget.php' => 2, | |
'emclientaction.php' => 2, | |
'integration' => 2, | |
'sftp-config.json' => 2, | |
'querycounter.php' => 2, | |
'savvyfilternatorbundle.php' => 2, | |
'pdodriver.php' => 2, | |
'config.tpl' => 2, | |
'exchangemanager.php' => 2, | |
'exchangerate.php' => 2, | |
'detectslostconnections.php' => 2, | |
'unknowncurrencyexception.php' => 2, | |
'php-cs-fixer.sh' => 2, | |
'host.php' => 2, | |
'supercluster.ini' => 2, | |
'ibrowssonatatranslationbundle.php' => 2, | |
'bitcoindbundle.php' => 2, | |
'monitoring.php' => 2, | |
'apc.php' => 2, | |
'phparray.php' => 2, | |
'plugin_update.php' => 2, | |
'syliuspromotionevents.php' => 2, | |
'plugin_info.php' => 2, | |
'sgkbarcodebundle.php' => 2, | |
'kalturaclient.php' => 2, | |
'kalturaclientbase.php' => 2, | |
'vagrant-bootstrap.sh' => 2, | |
'vagrantfile.example' => 2, | |
'kalturaenums.php' => 2, | |
'readerexception.php' => 2, | |
'kalturatypes.php' => 2, | |
'configurableinterface.php' => 2, | |
'codeclimate.json' => 2, | |
'splunk.php' => 2, | |
'posnetgercektest.php' => 2, | |
'demo.sh' => 2, | |
'ztreeasset.php' => 2, | |
'imageaction.php' => 2, | |
'copyscripts.sh' => 2, | |
'.environment' => 2, | |
'javascriptunpacker.php' => 2, | |
'amorestapi.php' => 2, | |
'daemon' => 2, | |
'wampyasset.php' => 2, | |
'ragenotificationbundle.php' => 2, | |
'slikdompdfbundle.php' => 2, | |
'emailfactory.php' => 2, | |
'dompdf_config.custom.inc.php.dist' => 2, | |
'dompdf_config.inc.php.dist' => 2, | |
'config.sample.ini' => 2, | |
'pixsortablebehaviorbundle.php' => 2, | |
'matmtypeaheadbundle.php' => 2, | |
'selectizeasset.php' => 2, | |
'raulfraileladybugbundle.php' => 2, | |
'bccresquebundle.php' => 2, | |
'.tm_properties' => 2, | |
'example-simple.php' => 2, | |
'commandbus.php' => 2, | |
'nginx.conf.sample' => 2, | |
'master' => 2, | |
'contextualbindingbuilder.php' => 2, | |
'class.javascriptpacker.php' => 2, | |
'ddeboerguzzlebundle.php' => 2, | |
'vxjsuploadbundle.php' => 2, | |
'vagrant' => 2, | |
'vagrant_bootstrap.sh' => 2, | |
'stop.php' => 2, | |
'ztree.php' => 2, | |
'vagrant.sh' => 2, | |
'configcache.php' => 2, | |
'cadvancedarbehavior.php' => 2, | |
'pasinteradmanagerbundle.php' => 2, | |
'gps.php' => 2, | |
'api.sh' => 2, | |
'tile-wide.png' => 2, | |
'dizdacloudbackupbundle.php' => 2, | |
'contributing_ru' => 2, | |
'gnugatwizardbundle.php' => 2, | |
'server' => 2, | |
'templateguesser.php' => 2, | |
'mailjetbundle.php' => 2, | |
'plancakeemailparser.php' => 2, | |
'escapewsseauthenticationbundle.php' => 2, | |
'travisphpconfig.ini' => 2, | |
'example.pdf' => 2, | |
'misdguzzlebundle.php' => 2, | |
'quality-report.sh' => 2, | |
'create-c.bat' => 2, | |
'anchor.php' => 2, | |
'global.inc.php.tpl' => 2, | |
'br.php' => 2, | |
'correios.php' => 2, | |
'en.php' => 2, | |
'xmppclient.php' => 2, | |
'room.php' => 2, | |
'schema.json' => 2, | |
'matchtype.php' => 2, | |
'classconvertor.php' => 2, | |
'inventory.php' => 2, | |
'universiboshibbolethbundle.php' => 2, | |
'ordering.php' => 2, | |
'regulation.php' => 2, | |
'lexikmaintenancebundle.php' => 2, | |
'validationresult.php' => 2, | |
'phonenumbertype.php' => 2, | |
'phonenumberformat.php' => 2, | |
'phonenumberdesc.php' => 2, | |
'numberformat.php' => 2, | |
'license_ru' => 2, | |
'phpunit.int.xml' => 2, | |
'dummy.php' => 2, | |
'countrycodesource.php' => 2, | |
'id.php' => 2, | |
'sparkcentralpsredisbundle.php' => 2, | |
'filemanagerasset.php' => 2, | |
'config.example.yml' => 2, | |
'widopgoogleanalyticsbundle.php' => 2, | |
'.travis_after_script.sh' => 2, | |
'mailerevents.php' => 2, | |
'import.html' => 2, | |
'xsl.ini' => 2, | |
'editor.html' => 2, | |
'abstractbundle.php' => 2, | |
'ddrgitkibundle.php' => 2, | |
'cdrs.php' => 2, | |
'jid.php' => 2, | |
'aaa' => 2, | |
'result' => 2, | |
'doctrineoxmbundle.php' => 2, | |
'tests_bootstrap.php' => 2, | |
'phpunit-all.xml' => 2, | |
'corebundle.php' => 2, | |
'copyright & license' => 2, | |
'columns.php' => 2, | |
'propertyaccessor.php' => 2, | |
'openstack_queues.services.yml' => 2, | |
'configservice.php' => 2, | |
'openstack_queues.routing.yml' => 2, | |
'openstack_queues.links.menu.yml' => 2, | |
'vagrant.yml' => 2, | |
'example-admin.php' => 2, | |
'ban.php' => 2, | |
'opensearch.php' => 2, | |
'databaseservice.php' => 2, | |
'games.php' => 2, | |
'smoketest.php' => 2, | |
'vlabsmediabundle.php' => 2, | |
'relationtrait.php' => 2, | |
'baseevent.php' => 2, | |
'extendedbehavior.php' => 2, | |
'submit.php' => 2, | |
'tablebuilder.php' => 2, | |
'wordpress-plugin.php' => 2, | |
'rudrax.php' => 2, | |
'xcacheclassloader.php' => 2, | |
'jsonldserializable.php' => 2, | |
'geonamesimportevents.php' => 2, | |
'pacewidget.php' => 2, | |
'sequencejs.php' => 2, | |
'nivoslider.php' => 2, | |
'server.sh' => 2, | |
'mongodb.php' => 2, | |
'redisclass.php' => 2, | |
'image_driver.php' => 2, | |
'cimagecomponent.php' => 2, | |
'imageattachmentwidget.php' => 2, | |
'imageattachmentbehavior.php' => 2, | |
'imageattachmentaction.php' => 2, | |
'giosh94mhzgeonamesbundle.php' => 2, | |
'websocket.php' => 2, | |
'b.php' => 2, | |
'ros.jpg' => 2, | |
'webshop-shopping-basket.iml' => 2, | |
'bridge.php' => 2, | |
'authserver.php' => 2, | |
'phpmailer.php' => 2, | |
'sessionhandlerinterface.php' => 2, | |
'consolemodule.php' => 2, | |
'upgrade from 1.1.x rc3' => 2, | |
'mit' => 2, | |
'logging.php' => 2, | |
'phpunit.build.xml' => 2, | |
'ayuco' => 2, | |
'criteria.php' => 2, | |
'phpmetrics.js' => 2, | |
'strategy.php' => 2, | |
'qiniu.php' => 2, | |
'readme 2' => 2, | |
'mustachejsasset.php' => 2, | |
'twitterbootstrapbundle.php' => 2, | |
'etcpasswdoauthbundle.php' => 2, | |
'jquerypaymentasset.php' => 2, | |
'db_create.php' => 2, | |
'spec.yml' => 2, | |
'todo.fr' => 2, | |
'homeslide.php' => 2, | |
'ajax_homeslider.php' => 2, | |
'html5sortableasset.php' => 2, | |
'loggerawareinterface.php' => 2, | |
'mandangobundle.php' => 2, | |
'wp-stage-switcher.php' => 2, | |
'htmldiff.php' => 2, | |
'chartjs.php' => 2, | |
'chartjsasset.php' => 2, | |
'commithook.xml' => 2, | |
'users.sql' => 2, | |
'test.sqlite' => 2, | |
'comparator.php' => 2, | |
'custom.php' => 2, | |
'count.php' => 2, | |
'commander.php' => 2, | |
'callbackcommand.php' => 2, | |
'googlecodeprettifyasset.php' => 2, | |
'.phpmetrics.yml' => 2, | |
'subscriberinterface.php' => 2, | |
'.travis-behat.yml' => 2, | |
'googleanalytics.php' => 2, | |
'.floo' => 2, | |
'common-words-cs_cz.php' => 2, | |
'common-words-de_de.php' => 2, | |
'common-words-en_gb.php' => 2, | |
'templates.php' => 2, | |
'builderinterface.php' => 2, | |
'pages.json' => 2, | |
'plans' => 2, | |
'index.html.php' => 2, | |
'swagger.php' => 2, | |
'dbcommand.php' => 2, | |
'mcapi.php' => 2, | |
'.travis-phpspec.yml' => 2, | |
'simditor.php' => 2, | |
'simditorasset.php' => 2, | |
'indexschema.php' => 2, | |
'taggablebehavior.php' => 2, | |
'smxsimplemeetings.php' => 2, | |
'directivegroup.php' => 2, | |
'serviceinterface.php' => 2, | |
'i.php' => 2, | |
'sample.gif' => 2, | |
'directivecollection.php' => 2, | |
'backlog' => 2, | |
'blueprint.php' => 2, | |
'readme_ja' => 2, | |
'twitter_result.data' => 2, | |
'eclientscript.php' => 2, | |
'example.gitignore' => 2, | |
'license.gpl' => 2, | |
'sbbcodeparser.php' => 2, | |
'nbbc.php' => 2, | |
'psr4classloader.php' => 2, | |
'diff.php' => 2, | |
'phpunit.fixtures.xml' => 2, | |
'loader.class.php' => 2, | |
'colourstreamcronbundle.php' => 2, | |
'ieasset.php' => 2, | |
'algoliaalgoliasearchbundle.php' => 2, | |
'jsminplus.php' => 2, | |
'firephptarget.php' => 2, | |
'dailymotion.php' => 2, | |
'license_german' => 2, | |
'sbkcronbundle.php' => 2, | |
'postmanbundle.php' => 2, | |
'picture.jpg' => 2, | |
'phpredisbundle.php' => 2, | |
'composer.json.update' => 2, | |
'wishlist' => 2, | |
'slides.pdf' => 2, | |
'upload.js' => 2, | |
'hybridxmlparser.php' => 2, | |
'sample_domain.php' => 2, | |
'sphpdox.php' => 2, | |
'activejob.php' => 2, | |
'_version' => 2, | |
'nucleus.json' => 2, | |
'fileutils.php' => 2, | |
'fixturecontroller.php' => 2, | |
'lyracontentbundle.php' => 2, | |
'jbconfigknpmenubundle.php' => 2, | |
'mrafalkocommandrunnerbundle.php' => 2, | |
'delete.gif' => 2, | |
'add.png' => 2, | |
'neutronformbundle.php' => 2, | |
'neutrondatagridbundle.php' => 2, | |
'rendererinterface.php' => 2, | |
'.insight.yml' => 2, | |
'shopware.php' => 2, | |
'phpspec.build.yml' => 2, | |
'basepage.php' => 2, | |
'multiinput.php' => 2, | |
'qandidatetogglebundle.php' => 2, | |
'qcubed.inc.php' => 2, | |
'idna_convert.class.php' => 2, | |
'verification.php' => 2, | |
'transcode_wrapper.php' => 2, | |
'uctc.php' => 2, | |
'limitations' => 2, | |
'.pharpiler.yml' => 2, | |
'berriartsitemapbundle.php' => 2, | |
'bootstrap-config.json' => 2, | |
'installer.sh' => 2, | |
'doctrine.php' => 2, | |
'autounit.rb' => 2, | |
'class.contextioresponse.php' => 2, | |
'quad.php' => 2, | |
'intl.php' => 2, | |
'languagetaggedstring.php' => 2, | |
'nquads.php' => 2, | |
'de.php' => 2, | |
'nodeinterface.php' => 2, | |
'wizard.php' => 2, | |
'snowcapmailjetbundle.php' => 2, | |
'category-tree-branch.tpl' => 2, | |
'sort_alphabet.png' => 2, | |
'sort_number.png' => 2, | |
'compass.inc.php' => 2, | |
'phpunithelper.php' => 2, | |
'sortablebehavior.php' => 2, | |
'doap.rdf' => 2, | |
'schema.class.php' => 2, | |
'quadparserinterface.php' => 2, | |
'makedatadefs.php' => 2, | |
'quadserializerinterface.php' => 2, | |
'rdfconstants.php' => 2, | |
'remotedocument.php' => 2, | |
'apidoc' => 2, | |
'iauth.php' => 2, | |
'typedvalue.php' => 2, | |
'apidoc.bat' => 2, | |
'fixtures.php' => 2, | |
'baidu.php' => 2, | |
'class.contextio.php' => 2, | |
'messentesms.php' => 2, | |
'requestcontext.php' => 2, | |
'eguliasquizbundle.php' => 2, | |
'.composer.json' => 2, | |
'draggable.php' => 2, | |
'dumpermanager.php' => 2, | |
'droppable.php' => 2, | |
'bazingageocoderbundle.php' => 2, | |
'provisioning.sh' => 2, | |
'craueformflowbundle.php' => 2, | |
'resizable.php' => 2, | |
'crauetwigextensionsbundle.php' => 2, | |
'neo4jogmbundle.php' => 2, | |
'sliderinput.php' => 2, | |
'cheque.php' => 2, | |
'cronjobs.php' => 2, | |
'catus.php' => 2, | |
'rukbatbitlybundle.php' => 2, | |
'upgrade-1.0.1' => 2, | |
'calculate.php' => 2, | |
'resources' => 2, | |
'nelmiosolariumbundle.php' => 2, | |
'clientregistry.php' => 2, | |
'yiiphealng.php' => 2, | |
'testsuite.phar' => 2, | |
'emformwidget.php' => 2, | |
'ekinonewrelicbundle.php' => 2, | |
'ghangelog' => 2, | |
'pinocchio.json' => 2, | |
'usersbundle.php' => 2, | |
'felis.php' => 2, | |
'mediamanager.php' => 2, | |
'common.default.properties' => 2, | |
'oauthsimple-license' => 2, | |
'arc2_graph.php' => 2, | |
'description.php' => 2, | |
'settingsmodel.php' => 2, | |
'baikalrestbundle.php' => 2, | |
'passwordhash.php' => 2, | |
'extendeddatetimeformattingbehavior.php' => 2, | |
'whois.servers.json' => 2, | |
'whois.php' => 2, | |
'readme.old' => 2, | |
'.env-dist' => 2, | |
'config.example' => 2, | |
'leiame.json' => 2, | |
'lm2php.php' => 2, | |
'dropdownasset.php' => 2, | |
'core_routes.php' => 2, | |
'_.htaccess.example' => 2, | |
'lktwigstringbundle.php' => 2, | |
'security-checker' => 2, | |
'menutoplinks.class.php' => 2, | |
'jqgridwidget.php' => 2, | |
'jqgridasset.php' => 2, | |
'swoole.php' => 2, | |
'engineinterface.php' => 2, | |
'n98-magerun.phar' => 2, | |
'twigbundle.php' => 2, | |
'clienttest.php' => 2, | |
'render_public_folders.php' => 2, | |
'universalclassloader.php' => 2, | |
'index_treemenu.php' => 2, | |
'release_notes-1.0' => 2, | |
'webprofilerserviceprovider.php' => 2, | |
'serializerserviceprovider.php' => 2, | |
'webdav.php' => 2, | |
'release_notes-0.9' => 2, | |
'release_notes-0.11' => 2, | |
'release_notes-0.10' => 2, | |
'license-unicode_cldr' => 2, | |
'license-schematron' => 2, | |
'runcronjobs.php' => 2, | |
'kickstart.ini-dist' => 2, | |
'index_rest.php' => 2, | |
'opengraphtest.php' => 2, | |
'index_cluster.php' => 2, | |
'ezpublish.cron' => 2, | |
'ezpm.php' => 2, | |
'config.php-recommended' => 2, | |
'.htaccess_root' => 2, | |
'phpunit-integration-rest-xml.xml' => 2, | |
'license-icu' => 2, | |
'license-agavi' => 2, | |
'changelog-0.9' => 2, | |
'dcsformselectcityformfieldbundle.php' => 2, | |
'changelog-0.11' => 2, | |
'phpunit-integration-rest-json.xml' => 2, | |
'verify.php' => 2, | |
'agitcommonbundle.php' => 2, | |
'phpunit-functional-rest.xml' => 2, | |
'agitvalidationbundle.php' => 2, | |
'slideshow.php' => 2, | |
'screenshot-6.png' => 2, | |
'screenshot-5.png' => 2, | |
'example.xls' => 2, | |
'webclient_example.php' => 2, | |
'sendmessage_example.php' => 2, | |
'cli_longrun_example_bosh.php' => 2, | |
'migration_guide' => 2, | |
'cli_longrun_example.php' => 2, | |
'unicode.php' => 2, | |
'scan.php' => 2, | |
'internals' => 2, | |
'moduleadmin.php' => 2, | |
'solutioncodemirrorbundle.php' => 2, | |
'agitutilbundle.php' => 2, | |
'agituserbundle.php' => 2, | |
'staticfile' => 2, | |
'agituibundle.php' => 2, | |
'agitsettingbundle.php' => 2, | |
'agitpluggablebundle.php' => 2, | |
'agitlocaledatabundle.php' => 2, | |
'definition.json' => 2, | |
'build.properties.sample' => 2, | |
'agitintlbundle.php' => 2, | |
'agitcontactformbundle.php' => 2, | |
'config.yml.example' => 2, | |
'docgen.sh' => 2, | |
'changelog-0.10' => 2, | |
'aliconfig.php' => 2, | |
'pay.php' => 2, | |
'textconsole' => 2, | |
'responseformatter.php' => 2, | |
'fancytreewidget.php' => 2, | |
'liloconwechatbundle.php' => 2, | |
'fancytreeasset.php' => 2, | |
'progress' => 2, | |
'docblox.xml' => 2, | |
'uml.png' => 2, | |
'uml.mdj' => 2, | |
'.magnum.yml' => 2, | |
'ewzsearchbundle.php' => 2, | |
'subscription.php' => 2, | |
'apcuniversalclassloader.php' => 2, | |
'jphp.json' => 2, | |
'composer-travis-ci.json' => 2, | |
'unicode-license' => 2, | |
'mailbuilder.php' => 2, | |
'menu.xml' => 2, | |
'httpresponse.php' => 2, | |
'test.class.php' => 2, | |
'typeresolver.php' => 2, | |
'debuguniversalclassloader.php' => 2, | |
'plainfilehandler.php' => 2, | |
'fetchdatafile.php' => 2, | |
'excelfilehandler.php' => 2, | |
'errorexception.php' => 2, | |
'zf.php' => 2, | |
'creator.php' => 2, | |
'api_changelog' => 2, | |
'license-gplv3' => 2, | |
'bisect_phpunit.sh' => 2, | |
'processevent.php' => 2, | |
'logevent.php' => 2, | |
'urlizer.php' => 2, | |
'paradigmaimagebundle.php' => 2, | |
'ferrandinitwigextensionbundle.php' => 2, | |
'test-coverage.sh' => 2, | |
'behat_suites.yml' => 2, | |
'respondasset.php' => 2, | |
'html5shivasset.php' => 2, | |
'googletagmanager.php' => 2, | |
'broker.php' => 2, | |
'line.php' => 2, | |
'wufooapiexamples.php' => 2, | |
'adesignscalendarbundle.php' => 2, | |
'social' => 2, | |
'sfkemailtemplatebundle.php' => 2, | |
'jenkins.yaml' => 2, | |
'liipmagentobundle.php' => 2, | |
'magento-autoloader.patch' => 2, | |
'skonsoftcveditorbundle.php' => 2, | |
'sender.php' => 2, | |
'streamable.php' => 2, | |
'serverrequest.php' => 2, | |
'metric.php' => 2, | |
'test.json' => 2, | |
'textsmser.php' => 2, | |
'r' => 2, | |
'javascript.js' => 2, | |
'sonatanewsbundle.php' => 2, | |
'subscribe.php' => 2, | |
'subscribe.mail.tpl' => 2, | |
'subscribe.layer.json' => 2, | |
'sonatacachebundle.php' => 2, | |
'sonataclassificationbundle.php' => 2, | |
'simplecomment.php' => 2, | |
'seo.ext.php' => 2, | |
'sonatacommentbundle.php' => 2, | |
'.fix_stability.php' => 2, | |
'sonatadoctrinephpcradminbundle.php' => 2, | |
'left.php' => 2, | |
'list.php' => 2, | |
'basket_delete.png' => 2, | |
'sonatanotificationbundle.php' => 2, | |
'sonataseobundle.php' => 2, | |
'sonatatimelinebundle.php' => 2, | |
'spytimelinebundle.php' => 2, | |
'sources.mk' => 2, | |
'make-phar.php' => 2, | |
'make-loader.php' => 2, | |
'mopabootstrapsandboxbundle.php' => 2, | |
'seojson.php' => 2, | |
'config.mk' => 2, | |
'parsecsv.lib.php' => 2, | |
'readme3' => 2, | |
'page_edit.png' => 2, | |
'application_home.png' => 2, | |
'readme5' => 2, | |
'grade.php' => 2, | |
'phpunit-no-cc.xml.dist' => 2, | |
'liquibase.jar' => 2, | |
'liquibase' => 2, | |
'decisions.php' => 2, | |
'interval.php' => 2, | |
'signed' => 2, | |
'picofeed' => 2, | |
'config.html' => 2, | |
'module.xml' => 2, | |
'dump.php' => 2, | |
'yiilite.php' => 2, | |
'yii-powered.png' => 2, | |
'yiibase.php' => 2, | |
'googleadsense.php' => 2, | |
'commit.php' => 2, | |
'frequencewebcontactbundle.php' => 2, | |
'readme.de' => 2, | |
'reset.php' => 2, | |
'filebag.php' => 2, | |
'yml.tpl' => 2, | |
'yml.php' => 2, | |
'rzcontactbundle.php' => 2, | |
'contenttypes.php' => 2, | |
'smartybc.class.php' => 2, | |
'timezone.js' => 2, | |
'subscribe.tpl' => 2, | |
'readme4' => 2, | |
'.providence' => 2, | |
'entities_generator.php' => 2, | |
'datepickerredblackthemeasset.php' => 2, | |
'evariojanrainbundle.php' => 2, | |
'readme-kr' => 2, | |
'bootstrap_test.php' => 2, | |
'phpspec.yaml' => 2, | |
'personaltranslationswidgetbundle.php' => 2, | |
'raindropsonatathemebundle.php' => 2, | |
'wavfile.php' => 2, | |
'db.sh' => 2, | |
'filemakervalidationexception.php' => 2, | |
'filemakerexception.php' => 2, | |
'piechart.php' => 2, | |
'nestedsetsbehavior.php' => 2, | |
'datepickerdarkthemeasset.php' => 2, | |
'resource.php' => 2, | |
'barchart.php' => 2, | |
'datepickercheerupthemeasset.php' => 2, | |
'datepickerbluethemeasset.php' => 2, | |
'dateasset.php' => 2, | |
'vkphpsdk.jpg' => 2, | |
'resqueautoloader.php' => 2, | |
'mongodatebehavior.php' => 2, | |
'initialize.php' => 2, | |
'tinymceassets.php' => 2, | |
'configuration.json.example' => 2, | |
'activerecordtrait.php' => 2, | |
'visitor.php' => 2, | |
'phpmanager.php' => 2, | |
'pipelineexception.php' => 2, | |
'robertotrutoinlinestyleemailbundle.php' => 2, | |
'localehttprequest.php' => 2, | |
'formfieldregistry.php' => 2, | |
'genericevent.php' => 2, | |
'license.gpl2' => 2, | |
'docx.php' => 2, | |
'mail.tpl' => 2, | |
'authorization.php' => 2, | |
'test.jpg' => 2, | |
'vipxbotdetectbundle.php' => 2, | |
'methodinvoker.php' => 2, | |
'gridsterasset.php' => 2, | |
'gridster.php' => 2, | |
'localeurlmanager.php' => 2, | |
'changelog-1.5' => 2, | |
'ormexception.php' => 2, | |
'changelog-1.4' => 2, | |
'license_sentinel' => 2, | |
'license_soa' => 2, | |
'phpspec-scrutinizer.yml' => 2, | |
'assetsautocompresscomponent.php' => 2, | |
'demo-sqlite.php' => 2, | |
'variantgroupdataprovider.php' => 2, | |
'pimdatageneratorbundle.php' => 2, | |
'pimcustomentitybundle.php' => 2, | |
'provider.php' => 2, | |
'routing.yml.dist' => 2, | |
'asana.php' => 2, | |
'openstack_queues.info.yml' => 2, | |
'dm.sql' => 2, | |
'eventlistenerinterface.php' => 2, | |
'pull.bat' => 2, | |
'samples-generator.php' => 2, | |
'review-1.0' => 2, | |
'ajax-loader.gif' => 2, | |
'constructor.php' => 2, | |
'phpdoc.xml.dist' => 2, | |
'parametersescaper.php' => 2, | |
'exercisegoogletranslatebundle.php' => 2, | |
'paris.php' => 2, | |
'consoleapplication.php' => 2, | |
'test_bootstrap.php' => 2, | |
'echo.php' => 2, | |
'travis-tests.sh' => 2, | |
'psurface.php' => 2, | |
'puzzles' => 2, | |
'push.bat' => 2, | |
'topic.php' => 2, | |
'jqueryeasingasset.php' => 2, | |
'.rultor.yml' => 2, | |
'wp-media-categories.php' => 2, | |
'pstock.php' => 2, | |
'harness.example.php' => 2, | |
'restapi.php' => 2, | |
'alchemyapi.php' => 2, | |
'routeprovider.php' => 2, | |
'namespace.sh' => 2, | |
'login.html' => 2, | |
'sncredisbundle.php' => 2, | |
'pspring.php' => 2, | |
'rss.xml' => 2, | |
'psplit.php' => 2, | |
'sample-tpl.php' => 2, | |
'frontbundle.php' => 2, | |
'initialise.php' => 2, | |
'wsdlclassfiletpl.php' => 2, | |
'runserver.sh' => 2, | |
'tags.sh' => 2, | |
'jquery.php' => 2, | |
'fonts.php' => 2, | |
'index.php~' => 2, | |
'phpquery.php' => 2, | |
'datagridexception.php' => 2, | |
'generate_readme' => 2, | |
'httputils.php' => 2, | |
'basenumber.php' => 2, | |
'testbild.jpg' => 2, | |
'baseip.php' => 2, | |
'description.html' => 2, | |
'misc.php' => 2, | |
'hooks' => 2, | |
'wsdltophpstructvalue.php' => 2, | |
'odoo.php' => 2, | |
'todo-list' => 2, | |
'basegravatar.php' => 2, | |
'wsdltophpfunction.php' => 2, | |
'wsdltophpgenerator.php' => 2, | |
'aa' => 2, | |
'mimetypes.php' => 2, | |
'yiiwhoopsrunner.php' => 2, | |
'bundleinterface.php' => 2, | |
'wsdltophpmodel.php' => 2, | |
'cryptastic.class.php' => 2, | |
'wsdltophpservice.php' => 2, | |
'wsdltophpstruct.php' => 2, | |
'wsdltophpstructattribute.php' => 2, | |
'commit' => 2, | |
'pscatter.php' => 2, | |
'whoopserrorhandler.php' => 2, | |
'license.apache2' => 2, | |
'pimage.php' => 2, | |
'pdraw.php' => 2, | |
'shortlog' => 2, | |
'iri.php' => 2, | |
'validators.php' => 2, | |
'deployment.xml' => 2, | |
'pdata.php' => 2, | |
'fmbbcodebundle.php' => 2, | |
'fmelfinderbundle.php' => 2, | |
'desktop.php' => 2, | |
'pcache.php' => 2, | |
'appbundle.php' => 2, | |
'elaomcemediabundle.php' => 2, | |
'pbubble.php' => 2, | |
'mongohelper.php' => 2, | |
'interfaces.php' => 2, | |
'redissessionhandlerbundle.php' => 2, | |
'pbarcode39.php' => 2, | |
'publisher.php' => 2, | |
'module.config.php' => 2, | |
'decode.php' => 2, | |
'all.php' => 2, | |
'pbarcode128.php' => 2, | |
'basebucket.php' => 2, | |
'tor.php' => 2, | |
'drupal-org.make' => 2, | |
'bucketinterface.php' => 2, | |
'bucketsubdirtemplate.php' => 2, | |
'relativepath.php' => 2, | |
'gnu lesser general public license v2.1 - gnu project - free software foundation.html' => 2, | |
'pindicator.php' => 2, | |
'uspszipcodelookup.php' => 2, | |
'exceldatareader.php' => 2, | |
'uspsaddress.php' => 2, | |
'hook.php' => 2, | |
'mailtankclient.php' => 2, | |
'phpqa.yml' => 2, | |
'exceldatawriter.php' => 2, | |
'slacktarget.php' => 2, | |
'exceltemplatewriter.php' => 2, | |
'.rubocop.yml' => 2, | |
'docdatapayments.php' => 2, | |
'endroidgcmbundle.php' => 2, | |
'.scrutinitzer.yml' => 2, | |
'mailtankexception.php' => 2, | |
'.rubocop_todo.yml' => 2, | |
'external.php' => 2, | |
'usps-php-api.iml' => 2, | |
'uspsaddressverify.php' => 2, | |
'ppie.php' => 2, | |
'uspscitystatelookup.php' => 2, | |
'uspstrackconfirm.php' => 2, | |
'test.js' => 2, | |
'version.js' => 2, | |
'error.png' => 2, | |
'posttype.php' => 2, | |
'uspsrate.php' => 2, | |
'index_dev.php' => 2, | |
'old_readme' => 2, | |
'readme-2.png' => 2, | |
'koala-config.json' => 2, | |
'pradar.php' => 2, | |
'readme-1.png' => 2, | |
'uspsbase.php' => 2, | |
'iats.php' => 2, | |
'commentmodule.php' => 2, | |
'file' => 2, | |
'containeraware.php' => 2, | |
'config-manager.php' => 2, | |
'content-video.php' => 2, | |
'contactevents.php' => 2, | |
'mremicontactbundle.php' => 2, | |
'acf-qtranslate.php' => 2, | |
'taxonomy-post_format.php' => 2, | |
'uploadcare-php' => 2, | |
'arrowdown.png' => 2, | |
'arrowup.png' => 2, | |
'entityfactory.php' => 2, | |
'transportinterface.php' => 2, | |
'tokenable.php' => 2, | |
'description.json' => 2, | |
'opensearch.xml' => 2, | |
'chosenselect.php' => 2, | |
'servergrovetranslationeditorbundle.php' => 2, | |
'license-lgpl3' => 2, | |
'chosenselectasset.php' => 2, | |
'fragment.php' => 2, | |
'checkbox.php' => 2, | |
'credentials.php.dist' => 2, | |
'jobs.sql' => 2, | |
'notificationevent.php' => 2, | |
'mongostoragemanager.php' => 2, | |
'luneticslocalebundle.php' => 2, | |
'reflectionclass.php' => 2, | |
'dictionary.php' => 2, | |
'credentials.yml.dist' => 2, | |
'adodb-active-record.inc.php' => 2, | |
'adodb-active-recordx.inc.php' => 2, | |
'adodb-csvlib.inc.php' => 2, | |
'pmmodule.php' => 2, | |
'license-gpl2' => 2, | |
'sequence.php' => 2, | |
'types.php' => 2, | |
'bigfootcorebundle.php' => 2, | |
'bigfootmediabundle.php' => 2, | |
'rsapublic.php' => 2, | |
'bigfootnavigationbundle.php' => 2, | |
'paginatorinterface.php' => 2, | |
'factual.php' => 2, | |
'bigfootuserbundle.php' => 2, | |
'limit.php' => 2, | |
'rsaprivate.php' => 2, | |
'messages.yml' => 2, | |
'guzzlebundle.php' => 2, | |
'table.sql' => 2, | |
'fcrnmodule.php' => 2, | |
'httpresourceinterface.php' => 2, | |
'mosquitto.php' => 2, | |
'content-quote.php' => 2, | |
'vcard.php' => 2, | |
'jqplotwidget.php' => 2, | |
'content-image.php' => 2, | |
'bump-ver' => 2, | |
'editablesaver.php' => 2, | |
'cronserviceprovider.php' => 2, | |
'content-gallery.php' => 2, | |
'content-audio.php' => 2, | |
'pgsql.php' => 2, | |
'content-aside.php' => 2, | |
'author-bio.php' => 2, | |
'gravatarserviceprovider.php' => 2, | |
'editablefield.php' => 2, | |
'editabledetailview.php' => 2, | |
'editableconfig.php' => 2, | |
'adodb-datadict.inc.php' => 2, | |
'simplethingsformserializerbundle.php' => 2, | |
'metadata.json' => 2, | |
'bootstrap' => 2, | |
'studio.json' => 2, | |
'ftpwidget.php' => 2, | |
'msg-config.php' => 2, | |
'fineuploader.php' => 2, | |
'fineuploaderasset.php' => 2, | |
'.scruntinizer.yml' => 2, | |
'phonevalidator.php' => 2, | |
'example.composer.php' => 2, | |
'codegen.json' => 2, | |
'meter.php' => 2, | |
'gayaphpbbencoderbundle.php' => 2, | |
'timthumb.php' => 2, | |
'evercookie.php' => 2, | |
'piwik.php' => 2, | |
'klogger.php' => 2, | |
'contextmanager.php' => 2, | |
'madmimi.class.php' => 2, | |
'spyc.class.php' => 2, | |
'solder' => 2, | |
'docgen' => 2, | |
'phpunit.hhvm.xml.dist' => 2, | |
'dbconnect.php' => 2, | |
'koharness' => 2, | |
'tbs_plugin_opentbs.php' => 2, | |
'config.ini.sample' => 2, | |
'.env.dev' => 2, | |
'tbs_class.php' => 2, | |
'thorfile' => 2, | |
'berksfile' => 2, | |
'slide.php' => 2, | |
'ftputils.php' => 2, | |
'removeaction.php' => 2, | |
'objectstorage.php' => 2, | |
'funstafftikabundle.php' => 2, | |
'adodb-error.inc.php' => 2, | |
'adodb-errorhandler.inc.php' => 2, | |
'name.php' => 2, | |
'adodb-errorpear.inc.php' => 2, | |
'adodb-exceptions.inc.php' => 2, | |
'adodb-iterator.inc.php' => 2, | |
'adodb-lib.inc.php' => 2, | |
'directoryinterface.php' => 2, | |
'adodb-memcache.lib.inc.php' => 2, | |
'adodb-pager.inc.php' => 2, | |
'adodb-pear.inc.php' => 2, | |
'adodb-perf.inc.php' => 2, | |
'adodb-php4.inc.php' => 2, | |
'adodb-time.inc.php' => 2, | |
'adodb-xmlschema.inc.php' => 2, | |
'ftpparser.php' => 2, | |
'tohtml.inc.php' => 2, | |
'ftpfile.php' => 2, | |
'ftpcomponent.php' => 2, | |
'cpfvalidator.php' => 2, | |
'xmlschema03.dtd' => 2, | |
'xmlschema.dtd' => 2, | |
'cnpjvalidator.php' => 2, | |
'frameworkbundle.php' => 2, | |
'helloworld' => 2, | |
'toexport.inc.php' => 2, | |
'rsfilter.inc.php' => 2, | |
'pivottable.inc.php' => 2, | |
'adodb.inc.php' => 2, | |
'license~' => 2, | |
'adodb-xmlschema03.inc.php' => 2, | |
'todo.php' => 2, | |
'builder.sh' => 2, | |
'bigfootcontextbundle.php' => 2, | |
'iterator.php' => 2, | |
'phpunit.xml~' => 2, | |
'inlinewidgetsbehavior.php' => 2, | |
'favorites.php' => 2, | |
'glob.php' => 2, | |
'403.html' => 2, | |
'example-config.json' => 2, | |
'ajaxsubmitbutton.php' => 2, | |
'viewserviceprovider.php' => 2, | |
'guzzleserviceprovider.php' => 2, | |
'txt.todo' => 2, | |
'filesessionhandler.php' => 2, | |
'changelog.rnd' => 2, | |
'markdown_extended.php' => 2, | |
'atlassian-ide-plugin.xml' => 2, | |
'.coveragerc' => 2, | |
'registry.hh' => 2, | |
'git_hooks' => 2, | |
'umeditorasset.php' => 2, | |
'querystring.php' => 2, | |
'umeditoraction.php' => 2, | |
'workflowbundle.php' => 2, | |
'umeditor.php' => 2, | |
'tox.ini' => 2, | |
'layerasset.php' => 2, | |
'query' => 2, | |
'.phpmetrics.yml.dist' => 2, | |
'example.codeception.yml' => 2, | |
'example.codeception.dist.yml' => 2, | |
'drone.yml' => 2, | |
'themeserviceprovider.php' => 2, | |
'simplenode.php' => 2, | |
'databasesessionhandler.php' => 2, | |
'minnelli.php' => 2, | |
'm.php' => 2, | |
'batch.php' => 2, | |
'manual-init.php' => 2, | |
'readme-fr' => 2, | |
'screenshot2.png' => 2, | |
'readme-header.jpg' => 2, | |
'mathpublisher.php' => 2, | |
'install_ext.sh' => 2, | |
'extplorer.php' => 2, | |
'.local.vimrc' => 2, | |
'phpunit-unit.xml' => 2, | |
'mark.php' => 2, | |
'memoize.php' => 2, | |
'openskyldapbundle.php' => 2, | |
'setup.json' => 2, | |
'elmo' => 2, | |
'reader.hh' => 2, | |
'ladder.php' => 2, | |
'edituser.php' => 2, | |
'ez_sql_help.htm' => 2, | |
'csrftoken.php' => 2, | |
'ez_sql_with_smarty.html' => 2, | |
'shibbolethbundle.php' => 2, | |
'smsgateway.php' => 2, | |
'shorten.php' => 2, | |
'lists.php' => 2, | |
'500.php' => 2, | |
'responder.php' => 2, | |
'createqueryhelper.php' => 2, | |
'cookiesessionhandler.php' => 2, | |
'ipv4.php' => 2, | |
'guild.php' => 2, | |
'.scruntizer.yml' => 2, | |
'filesystemexception.php' => 2, | |
'raw.php' => 2, | |
'build.user.xml' => 2, | |
'build.simpletest.xml' => 2, | |
'vfconfig.default.php' => 2, | |
'build.registry.xml' => 2, | |
'config.default.ini' => 2, | |
'build.install.xml' => 2, | |
'shared.php' => 2, | |
'build.files.xml' => 2, | |
'zoo.php' => 2, | |
'kachkaevassetsversionbundle.php' => 2, | |
'build.features.xml' => 2, | |
'.build-readme' => 2, | |
'oembedfacade.php' => 2, | |
'build.database.xml' => 2, | |
'callqueuedhandler.php' => 2, | |
'assetsversionmanager.php' => 2, | |
'location.php' => 2, | |
'.exclude' => 2, | |
'abstractmessage.php' => 2, | |
'temporary.php' => 2, | |
'gergelypolonkaismssenderbundle.php' => 2, | |
'domutils.php' => 2, | |
'material.php' => 2, | |
'vars.php' => 2, | |
'eventserviceprovider.php' => 2, | |
'accesstoken.php' => 2, | |
'console.bat' => 2, | |
'typeextensioninterface.php' => 2, | |
'build.cron.xml' => 2, | |
'abstractapi.php' => 2, | |
'icbasemailbundle.php' => 2, | |
'example.csv' => 2, | |
'dict.php' => 2, | |
'avalertifybundle.php' => 2, | |
'dbobject.php' => 2, | |
'ticker.php' => 2, | |
'mapiterator.php' => 2, | |
'parsercsv.php' => 2, | |
'net.php' => 2, | |
'namespace.php' => 2, | |
'discount.php' => 2, | |
'files.php' => 2, | |
'town.php' => 2, | |
'helloworld.xml' => 2, | |
'symlinker.php' => 2, | |
'pkg_content.xml' => 2, | |
'scurvy.php' => 2, | |
'pkg_finder.xml' => 2, | |
'artist.php' => 2, | |
'testdox' => 2, | |
'undefined.php' => 2, | |
'example.aliases.drushrc.php' => 2, | |
'stylesheet.css' => 2, | |
'mockplugin.php' => 2, | |
'messagebuilder.php' => 2, | |
'attribute.php' => 2, | |
'installer' => 2, | |
'facebookbundle.php' => 2, | |
'readme_confirm' => 2, | |
'streaminterface.php' => 2, | |
'box.phar' => 2, | |
'index.twig' => 2, | |
'requires.php' => 2, | |
'admin.tpl' => 2, | |
'pkg_media.xml' => 2, | |
'registrybundle.php' => 2, | |
'paginationbundle.php' => 2, | |
'icontainer.php' => 2, | |
'forgotpassword.php' => 2, | |
'pdowrapper.php' => 2, | |
'span.php' => 2, | |
'subdirective.php' => 2, | |
'httpkernel_example.php' => 2, | |
'datetimepickerwidget.php' => 2, | |
'multiimageasset.php' => 2, | |
'tex2png.php' => 2, | |
'repositoryinitializer.php' => 2, | |
'test_index.php' => 2, | |
'repositoryinitializerinterface.php' => 2, | |
'repositorymanager.php' => 2, | |
'dot.htaccess' => 2, | |
'_heystack_subsystem' => 2, | |
'arrays.php' => 2, | |
'objectwrapper.php' => 2, | |
'translit.php' => 2, | |
'unit.bat' => 2, | |
'sensiyamlguibundle.php' => 2, | |
'.thinframerc' => 2, | |
'composer.bat' => 2, | |
'venomfile' => 2, | |
'imagex.php' => 2, | |
'default.png' => 2, | |
'mopabootstrapbundle.php' => 2, | |
'bisonlabnoormbundle.php' => 2, | |
'xsolvebootstrapcrudbundle.php' => 2, | |
'log.class.php' => 2, | |
'bisonlabsugarcrmbundle.php' => 2, | |
'build.cache.xml' => 2, | |
'jsoneditor.php' => 2, | |
'multiimage.php' => 2, | |
'metas.php' => 2, | |
'hook' => 2, | |
'travis.setup.php' => 2, | |
'optiontrait.php' => 2, | |
'pivotrecord.php' => 2, | |
'errcode.php' => 2, | |
'mmsortable.php' => 2, | |
'galleryasset.php' => 2, | |
'optionable.php' => 2, | |
'querybuilderasset.php' => 2, | |
'smser.php' => 2, | |
'querybuilderform.php' => 2, | |
'captchabuilder.php' => 2, | |
'csrf.php' => 2, | |
'captchabuilderinterface.php' => 2, | |
'quickstart' => 2, | |
'imagefilehandler.php' => 2, | |
'phrasebuilder.php' => 2, | |
'errormanager.php' => 2, | |
'messagetakecontrol.php' => 2, | |
'markdownasset.php' => 2, | |
'phpunit.xml.default' => 2, | |
'yii2fullcalendar.php' => 2, | |
'imagehandler.php' => 2, | |
'bootstrapclass.php' => 2, | |
'gregwarimagebundle.php' => 2, | |
'gregwarformbundle.php' => 2, | |
'phrasebuilderinterface.php' => 2, | |
'postindicator.php' => 2, | |
'parserexception.php' => 2, | |
'parserdata.php' => 2, | |
'restresponse.php' => 2, | |
'formidable.php' => 2, | |
'dataform.php' => 2, | |
'jsoneditorasset.php' => 2, | |
'sidenavasset.php' => 2, | |
'controllerexception.php' => 2, | |
'settings_example.php' => 2, | |
'driverexception.php' => 2, | |
'ares.php' => 2, | |
'contenttype.php' => 2, | |
'facetquery.php' => 2, | |
'eselect2.php' => 2, | |
'phpconfig.php' => 2, | |
'testhelper.php' => 2, | |
'bootstrapswitch.php' => 2, | |
'_toolkit_loader.php' => 2, | |
'filecache.php' => 2, | |
'reference' => 2, | |
'swagger-spec.json' => 2, | |
'advanced_settings_example.php' => 2, | |
'parallel.php' => 2, | |
'functions.inc.php' => 2, | |
'git-deploy' => 2, | |
'default' => 2, | |
'kitpagescmsbundle.php' => 2, | |
'cloudfiles_http.php' => 2, | |
'kitpagescmsevents.php' => 2, | |
'amppdfcrowdbundle.php' => 2, | |
'cloudfiles_exceptions.php' => 2, | |
'cloudfiles.php' => 2, | |
'basket.php' => 2, | |
'opentbsbundle.php' => 2, | |
'upgrade2.0' => 2, | |
'ip2location.php' => 2, | |
'mediawiki.php' => 2, | |
'phpcs.phar' => 2, | |
'test.csv' => 2, | |
'phpqa' => 2, | |
'parsedown.php' => 2, | |
'treewidget.php' => 2, | |
'abstractvalidator.php' => 2, | |
'bcrypthasher.php' => 2, | |
'galleryassets.php' => 2, | |
'integration.phpunit.xml' => 2, | |
'translate.sh' => 2, | |
'vardumper.php' => 2, | |
'pushover.php' => 2, | |
'migrate.bat' => 2, | |
'forbiddenexception.php' => 2, | |
'html2pdf.class.php' => 2, | |
'drivernotinstalledexception.php' => 2, | |
'ntlmsoapclient.php' => 2, | |
'exchangewebservices.php' => 2, | |
'ossexample.php' => 2, | |
'anonym' => 2, | |
'timehelper.php' => 2, | |
'phpmetrics.yml.dist' => 2, | |
'ewstype.php' => 2, | |
'searchinterface.php' => 2, | |
'ipdata.php' => 2, | |
'paymentrequest.php' => 2, | |
'xmlresponse.php' => 2, | |
'streamedresponse.php' => 2, | |
'ewsautodiscover.php' => 2, | |
'filehelper.php' => 2, | |
'eventexception.php' => 2, | |
'hellowidget.php' => 2, | |
'dynamicrouter.php' => 2, | |
'ews_exception.php' => 2, | |
'htmlpurifier.php' => 2, | |
'all_tests.php' => 2, | |
'pinyin.php' => 2, | |
'formasset.php' => 2, | |
'ftpprotocol.php' => 2, | |
'localtest.sh' => 2, | |
'egmapbounds.php' => 2, | |
'instantiatable.php' => 2, | |
'validateinterface.php' => 2, | |
'excerpt.php' => 2, | |
'500.html' => 2, | |
'strengthvalidatorasset.php' => 2, | |
'presets.php' => 2, | |
'egmapbase.php' => 2, | |
'configurationmanager.php' => 2, | |
'sanitizeinterface.php' => 2, | |
'footer.html' => 2, | |
'example_base_ruleset.xml' => 2, | |
'configure.ac' => 2, | |
'webhook.php' => 2, | |
'typeaheadbasic.php' => 2, | |
'crudcontroller.php' => 2, | |
'tinymcelanguageasset.php' => 2, | |
'swiftmailercomponent.php' => 2, | |
'eventmanagerinterface.php' => 2, | |
'phptemplate.php' => 2, | |
'keywords.php' => 2, | |
'debugbundle.php' => 2, | |
'extend.php' => 2, | |
'dashboard.html' => 2, | |
'github.png' => 2, | |
'egmapapikeylist.php' => 2, | |
'passwordinput.php' => 2, | |
'.bashrc' => 2, | |
'abstractstorage.php' => 2, | |
'documentup.json' => 2, | |
'init.php.example' => 2, | |
'passwordinputasset.php' => 2, | |
'.scrutinizer' => 2, | |
'class.jbdump.php' => 2, | |
'_template.php' => 2, | |
'performance' => 2, | |
'example_drupal7_ruleset.xml' => 2, | |
'bazingajqueryuibundle.php' => 2, | |
'weixinauth.php' => 2, | |
'browscapbundle.php' => 2, | |
'strengthvalidator.php' => 2, | |
'weiboauth.php' => 2, | |
'jjsgeonamesbundle.php' => 2, | |
'testinit.sh' => 2, | |
'renrenauth.php' => 2, | |
'go.sh' => 2, | |
'escapeinterface.php' => 2, | |
'cartbundle.php' => 2, | |
'imperaviredactorwidget.php' => 2, | |
'lang.inc.php' => 2, | |
'moufla.php' => 2, | |
'bootstrap.min.js' => 2, | |
'queryengine' => 2, | |
'data.inc.php' => 2, | |
'routedependencyresolvertrait.php' => 2, | |
'generatorsserviceprovider.php' => 2, | |
'filealreadyexistsexception.php' => 2, | |
'switchinput.php' => 2, | |
'objectcollection.php' => 2, | |
'template1.tpl' => 2, | |
'controllergenerator.php' => 2, | |
'spinnerasset.php' => 2, | |
'ornicarapcbundle.php' => 2, | |
'qqauth.php' => 2, | |
'konsole' => 2, | |
'chameleon.php' => 2, | |
'egmappoint.php' => 2, | |
'invoice.html' => 2, | |
'pdfdocument.php' => 2, | |
'template.tpl' => 2, | |
'template2.tpl' => 2, | |
'egmapsize.php' => 2, | |
'zf2-license' => 2, | |
'dbconnection.php' => 2, | |
'viewgenerator.php' => 2, | |
'seedgenerator.php' => 2, | |
'egmaprectangle.php' => 2, | |
'negotiator.php' => 2, | |
'scaffoldgenerator.php' => 2, | |
'config.php.default' => 2, | |
'egmapcircle.php' => 2, | |
'requestgenerator.php' => 2, | |
'pivotgenerator.php' => 2, | |
'mailerservicecompilerpass.php' => 2, | |
'splash.png' => 2, | |
'renderercompilerpass.php' => 2, | |
'egmappolylineencoder.php' => 2, | |
'autocompleteajax.php' => 2, | |
'egmappolygon.php' => 2, | |
'wikibasequeryengine.mw.php' => 2, | |
'template3.tpl' => 2, | |
'wikibasequeryengine.php' => 2, | |
'modelgenerator.php' => 2, | |
'responsefactory.php' => 2, | |
'phpda.yml.dist' => 2, | |
'installerplugin.php' => 2, | |
'cssparse.css' => 2, | |
'locatorinterface.php' => 2, | |
'nospam_ajax.php' => 2, | |
'renderinterface.php' => 2, | |
'tokeninterface.php' => 2, | |
'webservicecontext.php' => 2, | |
'wp-cli.sample.yml' => 2, | |
'flags.php' => 2, | |
'wp-cli-ssh.php' => 2, | |
'groupgridview.php' => 2, | |
'languageinterface.php' => 2, | |
'mapinterface.php' => 2, | |
'databaseinterface.php' => 2, | |
'laelapsgearmanbundle.php' => 2, | |
'fields.php' => 2, | |
'readme-ptbr' => 2, | |
'cleanup.php' => 2, | |
'phpthumb.unsharp.php' => 2, | |
'arrayloader.php' => 2, | |
'phpthumb.ico.php' => 2, | |
'phpthumb.gif.php' => 2, | |
'schemeinterface.php' => 2, | |
'editablecolumnasset.php' => 2, | |
'relations.php' => 2, | |
'cacheiteminterface.php' => 2, | |
'conditionoperator.php' => 2, | |
'registryinterface.php' => 2, | |
'php_errors.log' => 2, | |
'create.sql' => 2, | |
'changes 5.7.4' => 2, | |
'feed.xml' => 2, | |
'_config.yml' => 2, | |
'packagemanager.php' => 2, | |
'baserelation.php' => 2, | |
'messageinterface.php' => 2, | |
'lightasset.php' => 2, | |
'kindeditorassets.php' => 2, | |
'index.htm' => 2, | |
'fullpageasset.php' => 2, | |
'twig-gettext-extractor' => 2, | |
'pdfresponse.php' => 2, | |
'filterhelper.php' => 2, | |
'configmanager.php' => 2, | |
'viewstash.php' => 2, | |
'readme.tpl' => 2, | |
'widgettrait.php' => 2, | |
'phpthumb.functions.php' => 2, | |
'badmethodcallexception.php' => 2, | |
'slick.php' => 2, | |
'changelog.json' => 2, | |
'templateinterface.php' => 2, | |
'maintainer.php' => 2, | |
'adcomponentbundle.php' => 2, | |
'avrotranslatorbundle.php' => 2, | |
'cleantalk.custom.php' => 2, | |
'htmlformfield.php' => 2, | |
'soap-wsse.php' => 2, | |
'jdareclankbundle.php' => 2, | |
'readme-es' => 2, | |
'id_rsa.enc' => 2, | |
'mailerinterface.php' => 2, | |
'braintreeasset.php' => 2, | |
'messages.html' => 2, | |
'browscap.php' => 2, | |
'new-package.php' => 2, | |
'styles.less' => 2, | |
'pickadateasset.php' => 2, | |
'p.php' => 2, | |
'egmap.php' => 2, | |
'ubiquitous-language' => 2, | |
'shutdown.php' => 2, | |
'versioninfo' => 2, | |
'phpthumb.filters.php' => 2, | |
'avrosupportbundle.php' => 2, | |
'phpthumb.class.php' => 2, | |
'.coveralls' => 2, | |
'phpthumb.bmp.php' => 2, | |
'taveopolishextensionsbundle.php' => 2, | |
'phpthumb.php' => 2, | |
'besimplesoapbundle.php' => 2, | |
'thelia_inet.fmt' => 2, | |
'cacheplugin.php' => 2, | |
'resourceinterface.php' => 2, | |
'rbacasset.php' => 2, | |
'themeview.php' => 2, | |
'rscandir.php' => 2, | |
'schematic.php' => 2, | |
'gruntconfig.js' => 2, | |
'xupload.php' => 2, | |
'jqueryfiletree.css' => 2, | |
'jqueryfiletree.js' => 2, | |
'stack.php' => 2, | |
'braintreeform.php' => 2, | |
'wa72jsonrpcbundle.php' => 2, | |
'downloads.php' => 2, | |
'switcher.php' => 2, | |
'consolegenerator.php' => 2, | |
'standardlist.php' => 2, | |
'properties' => 2, | |
'egmapinfobox.php' => 2, | |
'resolveresponse.php' => 2, | |
'runtimeexception.php' => 2, | |
'yamlfileloader.php' => 2, | |
'c3.php' => 2, | |
'egmapinfowindow.php' => 2, | |
'propertyaccess.php' => 2, | |
'symfony1.php' => 2, | |
'slack.php' => 2, | |
'sdk.php' => 2, | |
'egmapgeocodedaddress.php' => 2, | |
'dbal.php' => 2, | |
'commandinterface.php' => 2, | |
'resolvequery.php' => 2, | |
'development.config.php.dist' => 2, | |
'.pre-commit-config.yaml' => 2, | |
'launcher.php' => 2, | |
'contentmodule.php' => 2, | |
'readresponse.php' => 2, | |
'multiresponse.php' => 2, | |
'schemaresponse.php' => 2, | |
'craft' => 2, | |
'egmapkmlservice.php' => 2, | |
'app.log' => 2, | |
'usermodel.php' => 2, | |
'contextmenuasset.php' => 2, | |
'linkedin.php' => 2, | |
'filelogger.php' => 2, | |
'mrpstripewebhookbundle.php' => 2, | |
'starratingasset.php' => 2, | |
'save.php' => 2, | |
'travis_php.ini' => 2, | |
'.lvimrc' => 2, | |
'rangeinput.php' => 2, | |
'egmapmarkerimage.php' => 2, | |
'unittest.xml' => 2, | |
'pnotifyasset.php' => 2, | |
'wepay.php' => 2, | |
'canvasblobasset.php' => 2, | |
'egmapevent.php' => 2, | |
'egmapgeocodetool.php' => 2, | |
'symfony-shim.php' => 2, | |
'envelope.png' => 2, | |
'issues' => 2, | |
'fpntagbundle.php' => 2, | |
'developmentmodecontroller.php' => 2, | |
'edit.php' => 2, | |
'phpmd_ruleset.xml' => 2, | |
'shell' => 2, | |
'affix.php' => 2, | |
'array2xml.php' => 2, | |
'factualfilter.php' => 2, | |
'factualcolumnschema.php' => 2, | |
'newscoopfacebooknewscoopbundle.php' => 2, | |
'iconasset.php' => 2, | |
'compilerpass.php' => 2, | |
'egmapmarker.php' => 2, | |
'ruianuploadifybundle.php' => 2, | |
'factualplace.php' => 2, | |
'factualcircle.php' => 2, | |
'gradlew' => 2, | |
'gradlew.bat' => 2, | |
'bigfootcontentbundle.php' => 2, | |
'lexikfixturesmapperbundle.php' => 2, | |
'factualapiexception.php' => 2, | |
'resolverinterface.php' => 2, | |
'egmaplatloncontrol.php' => 2, | |
'dataproviderinterface.php' => 2, | |
'tokens.php' => 2, | |
'innovaangularuibootstrapbundle.php' => 2, | |
'geocoderwrapper.php' => 2, | |
'contentprovider.php' => 2, | |
'engine.php' => 2, | |
'httpcache.php' => 2, | |
'fosmessagebundle.php' => 2, | |
'depdrop.php' => 2, | |
'filtergroup.php' => 2, | |
'fieldfilter.php' => 2, | |
'ant' => 2, | |
'example.phpspec.yml' => 2, | |
'dataset.php' => 2, | |
'egmapmarkerclusterer.php' => 2, | |
'urlroute.php' => 2, | |
'factualtest.php' => 2, | |
'egmapkeydragzoom.php' => 2, | |
'riak.proto' => 2, | |
'factualresponse.php' => 2, | |
'fosrestbundle.php' => 2, | |
'fostwitterbundle.php' => 2, | |
'relaynode.php' => 2, | |
'colorinput.php' => 2, | |
'factualquery.php' => 2, | |
'alertblock.php' => 2, | |
'datecontrol.php' => 2, | |
'loglevel.php' => 2, | |
'flush.php' => 2, | |
'moduleevent.php' => 2, | |
'composer-update.sh' => 2, | |
'egmapcontrolposition.php' => 2, | |
'fileinfo.php' => 2, | |
'glial' => 2, | |
'class.csstidy_print.php' => 2, | |
'zeroemcurlbundle.php' => 2, | |
'egmapmarkerwithlabel.php' => 2, | |
'redirectexception.php' => 2, | |
'marionette.php' => 2, | |
'urlparser.php' => 2, | |
'test2' => 2, | |
'class.csstidy_optimise.php' => 2, | |
'class.csstidy.php' => 2, | |
'semanticresultformats.parser.php' => 2, | |
'services.json' => 2, | |
'marionettecollection.php' => 2, | |
'marionettemodel.php' => 2, | |
'sample_bootstrap.php' => 2, | |
'overview.php' => 2, | |
'resque-scheduler.php' => 2, | |
'upgradeassets.sh' => 2, | |
'iconpickerasset.php' => 2, | |
'semanticresultformats.php' => 2, | |
'egmapcoord.php' => 2, | |
'descriptionlist.php' => 2, | |
'chameleon.i18n.php' => 2, | |
'smoothscroll.php' => 2, | |
'doubanauth.php' => 2, | |
'semanticresultformats.utils.php' => 2, | |
'scrollablebox.php' => 2, | |
'scrollspy.php' => 2, | |
'overlay.php' => 2, | |
'overflowbox.php' => 2, | |
'moufla.xml' => 2, | |
'offcanvas.php' => 2, | |
'build-release.sh' => 2, | |
'egmapclient.php' => 2, | |
'ibrowsnewsletterbundle.php' => 2, | |
'touchspinasset.php' => 2, | |
'close.php' => 2, | |
'addressinterface.php' => 2, | |
'perl-image-exiftool.spec' => 2, | |
'css_optimiser.php' => 2, | |
'maintenancecontroller.php' => 2, | |
'blockprovidercompilerpass.php' => 2, | |
'semanticresultformats.settings.php' => 2, | |
'exiftool' => 2, | |
'active_record.info' => 2, | |
'videoconverter.php' => 2, | |
'gnu-lgpl' => 2, | |
'report.xml' => 2, | |
'egmapdirection.php' => 2, | |
'requestlistener.php' => 2, | |
'egmapdirectionrenderer.php' => 2, | |
'login_script_db.sql' => 2, | |
'sxgeocitymax.dat' => 2, | |
'egmapdirectionwaypoint.php' => 2, | |
'egmapelevationinfo.php' => 2, | |
'pedroteixeiragridbundle.php' => 2, | |
'migrationinterface.php' => 2, | |
'oneupuploaderbundle.php' => 2, | |
'icache.php' => 2, | |
'active_record.install' => 2, | |
'active_record.module' => 2, | |
'fixtures.yaml' => 2, | |
'demo2.php' => 2, | |
'.gitchange' => 2, | |
'dateformatterasset.php' => 2, | |
'translator' => 2, | |
'datecontrolasset.php' => 2, | |
'semanticresultformats.hooks.php' => 2, | |
'themekrajeeasset.php' => 2, | |
'semanticresultformats.i18n.magic.php' => 2, | |
'jnsxhprofbundle.php' => 2, | |
'rules.php' => 2, | |
'callout.php' => 2, | |
'semanticresultformats.i18n.php' => 2, | |
'rulefactory.php' => 2, | |
'phploc.xml' => 2, | |
'build.json' => 2, | |
'mrcore.php' => 1, | |
'mqmassetbundle.php' => 1, | |
'readme.devel' => 1, | |
'phpmig' => 1, | |
'streams' => 1, | |
'upf.php' => 1, | |
'wikihtml.php' => 1, | |
'readme_examples' => 1, | |
'just-backup-btrfs' => 1, | |
'composer.json.orig' => 1, | |
'error-0011-in.jsonld' => 1, | |
'bootstrappresenter.php' => 1, | |
'micromvc.php' => 1, | |
'readme_details' => 1, | |
'caribou.sh' => 1, | |
'expand-0055-out.jsonld' => 1, | |
'magento_sales.zip' => 1, | |
'providers' => 1, | |
'zfc.php' => 1, | |
'phpunit.full-urls.xml' => 1, | |
'phonegapbuildapi.php' => 1, | |
'classes-generator.php' => 1, | |
'bbceditorbundle.php' => 1, | |
'caribou.php' => 1, | |
'nbbcbundle.php' => 1, | |
'changelog.sh' => 1, | |
'error-0009-in.jsonld' => 1, | |
'error-0012-in.jsonld' => 1, | |
'ez-jwt.php' => 1, | |
'error-0010-in.jsonld' => 1, | |
'mqmpaginationbundle.php' => 1, | |
'tpmpaymentslimcdbundle.php' => 1, | |
'mqmsortbundle.php' => 1, | |
'sqlnet.log' => 1, | |
'expand-0011-in.jsonld' => 1, | |
'expand-0056-in.jsonld' => 1, | |
'expand-0071-out.jsonld' => 1, | |
'expand-0074-out.jsonld' => 1, | |
'expand-0074-in.jsonld' => 1, | |
'expand-0073-out.jsonld' => 1, | |
'expand-0073-in.jsonld' => 1, | |
'proxy-start.sh.erb' => 1, | |
'expand-0072-out.jsonld' => 1, | |
'generated_sample' => 1, | |
'mtmpersiandatebundle.php' => 1, | |
'jobby.php' => 1, | |
'proxy-config.sh.erb' => 1, | |
'provision.sh.erb' => 1, | |
'docker-container-ssh.sh.erb' => 1, | |
'remove' => 1, | |
'expand-0072-in.jsonld' => 1, | |
'vagrantfile.erb' => 1, | |
'migrationbundle.php' => 1, | |
'expand-0071-in.jsonld' => 1, | |
'phpunit.composer.xml' => 1, | |
'.local-dev-vm-env.dist' => 1, | |
'fixturehelpercommand.php' => 1, | |
'po2json.php' => 1, | |
'contentmodelmetadatagenerator.php' => 1, | |
'fixturehelperdbfixturemanager.php' => 1, | |
'ownerbehavior.php' => 1, | |
'benefits' => 1, | |
'expand-0070-out.jsonld' => 1, | |
'compact-0072-in.jsonld' => 1, | |
'zephyradmincorebundle.php' => 1, | |
'expand-0070-in.jsonld' => 1, | |
'expand-0069-out.jsonld' => 1, | |
'migrationsprovider.php' => 1, | |
'expand-0075-in.jsonld' => 1, | |
'expand-0068-out.jsonld' => 1, | |
'casciiart.php' => 1, | |
'flatten-0007-in.jsonld' => 1, | |
'flatten-0006-out.jsonld' => 1, | |
'flatten-0006-in.jsonld' => 1, | |
'flatten-0005-out.jsonld' => 1, | |
'flatten-0005-in.jsonld' => 1, | |
'compact-0071-in.jsonld' => 1, | |
'flatten-0004-out.jsonld' => 1, | |
'flatten-0004-in.jsonld' => 1, | |
'flatten-0003-out.jsonld' => 1, | |
'flatten-0003-in.jsonld' => 1, | |
'flatten-0002-out.jsonld' => 1, | |
'flatten-0002-in.jsonld' => 1, | |
'flatten-0001-out.jsonld' => 1, | |
'compact-0071-out.jsonld' => 1, | |
'ccache.php' => 1, | |
'expand-0075-out.jsonld' => 1, | |
'chttpget.php' => 1, | |
'flatten-0001-in.jsonld' => 1, | |
'expand-manifest.jsonld' => 1, | |
'compact-0072-context.jsonld' => 1, | |
'expand-0078-out.jsonld' => 1, | |
'expand-0078-in.jsonld' => 1, | |
'expand-0077-out.jsonld' => 1, | |
'expand-0077-in.jsonld' => 1, | |
'expand-0077-context.jsonld' => 1, | |
'expand-0076-out.jsonld' => 1, | |
'cimage.php' => 1, | |
'cremoteimage.php' => 1, | |
'cwhitelist.php' => 1, | |
'expand-0076-in.jsonld' => 1, | |
'expand-0069-in.jsonld' => 1, | |
'expand-0068-in.jsonld' => 1, | |
'expand-0056-out.jsonld' => 1, | |
'expand-0060-in.jsonld' => 1, | |
'containerawareruleprovider.php' => 1, | |
'error-0005-in.jsonld' => 1, | |
'nucleusbusinessruleenginebundle.php' => 1, | |
'expand-0063-in.jsonld' => 1, | |
'expand-0062-out.jsonld' => 1, | |
'expand-0062-in.jsonld' => 1, | |
'error-0006-in.jsonld' => 1, | |
'expand-0061-out.jsonld' => 1, | |
'drawdrawbundle.php' => 1, | |
'expand-0061-in.jsonld' => 1, | |
'drawtesthelperbundle.php' => 1, | |
'error-0007-in.jsonld' => 1, | |
'expand-0060-out.jsonld' => 1, | |
'nucleuscorebundle.php' => 1, | |
'error-0008-in.jsonld' => 1, | |
'error-0004-in.jsonld' => 1, | |
'mplt.php' => 1, | |
'nucleusconsolebundle.php' => 1, | |
'oxymeltest.php' => 1, | |
'nucleusmigrationbundle.php' => 1, | |
'drawswaggerbundle.php' => 1, | |
'oxymel.php' => 1, | |
'run-unit-tests.php' => 1, | |
'expand-0059-out.jsonld' => 1, | |
'expand-0059-in.jsonld' => 1, | |
'expand-0058-out.jsonld' => 1, | |
'expand-0058-in.jsonld' => 1, | |
'expand-0057-out.jsonld' => 1, | |
'expand-0057-in.jsonld' => 1, | |
'jmsserializerlistener.php' => 1, | |
'nucleusbinderbundle.php' => 1, | |
'checksums' => 1, | |
'expand-0067-out.jsonld' => 1, | |
'twitterwidgetbundle.php' => 1, | |
'pagebundle.php' => 1, | |
'unity.php' => 1, | |
'tiimber' => 1, | |
'publish-gh-pages.rb' => 1, | |
'compact-0072-out.jsonld' => 1, | |
'compact-manifest.jsonld' => 1, | |
'error-0001-in.jsonld' => 1, | |
'simpletreeview.php' => 1, | |
'expand-0067-in.jsonld' => 1, | |
'ncelephantiobundle.php' => 1, | |
'expand-0066-out.jsonld' => 1, | |
'awl.yml' => 1, | |
'fixntest' => 1, | |
'metrics' => 1, | |
'expand-0066-in.jsonld' => 1, | |
'error-0003-in.jsonld' => 1, | |
'expand-0065-out.jsonld' => 1, | |
'expand-0065-in.jsonld' => 1, | |
'wikiphp.php' => 1, | |
'jeandejeanapiparisbundle.php' => 1, | |
'berksfile.lock' => 1, | |
'error-0002-in.jsonld' => 1, | |
'consoleapp.php' => 1, | |
'parse_loop_example.php' => 1, | |
'error-0003-ctx.jsonld' => 1, | |
'parse_serialize_example.php' => 1, | |
'expand-0064-out.jsonld' => 1, | |
'expand-0064-in.jsonld' => 1, | |
'phpspec-code_coverage.yml' => 1, | |
'expand-0063-out.jsonld' => 1, | |
'expand-0055-in.jsonld' => 1, | |
'expand-0040-out.jsonld' => 1, | |
'error-0013-in.jsonld' => 1, | |
'stringgeneratorbundle.php' => 1, | |
'nahoyimportbundle.php' => 1, | |
'kashflow.php' => 1, | |
'expand-0020-out.jsonld' => 1, | |
'license_mit' => 1, | |
'error-0039-in.jsonld' => 1, | |
'dbpatcherbundle.php' => 1, | |
'testutilitybundle.php' => 1, | |
'error-0041-in.jsonld' => 1, | |
'namshiutilitybundle.php' => 1, | |
'error-0038-in.jsonld' => 1, | |
'namshivoyeurbundle.php' => 1, | |
'example_validator.php' => 1, | |
'assetloader.php' => 1, | |
'expand-0021-in.jsonld' => 1, | |
'error-0037-in.jsonld' => 1, | |
'error-0040-in.jsonld' => 1, | |
'expand-0020-in.jsonld' => 1, | |
'error-0036-in.jsonld' => 1, | |
'expand-0018-in.jsonld' => 1, | |
'expand-0016-out.jsonld' => 1, | |
'expand-0017-in.jsonld' => 1, | |
'mvrhovdoctrineextensionsbundle.php' => 1, | |
'datadotgovadminapi_sdk.php' => 1, | |
'plugin_template.php' => 1, | |
'readme.cakephp' => 1, | |
'expand-0017-out.jsonld' => 1, | |
'phpmd-tests.xml' => 1, | |
'hezarfendenetmenbundle.php' => 1, | |
'error-0042-context.jsonld' => 1, | |
'expand-0018-out.jsonld' => 1, | |
'expand-0019-in.jsonld' => 1, | |
'quebolu.sql' => 1, | |
'expand-0019-out.jsonld' => 1, | |
'qb.php' => 1, | |
'social-counter-class.php' => 1, | |
'expand-0021-out.jsonld' => 1, | |
'expand-0022-in.jsonld' => 1, | |
'uml.xmi' => 1, | |
'treeimage.php' => 1, | |
'expand-0026-out.jsonld' => 1, | |
'expand-0027-in.jsonld' => 1, | |
'adoptableroutinginterface.php' => 1, | |
'routeentity.php' => 1, | |
'expand-0027-out.jsonld' => 1, | |
'routefield.php' => 1, | |
'sonataadminbundle.php' => 1, | |
'instagramstrategy.php' => 1, | |
'expand-0026-in.jsonld' => 1, | |
'webicon.ico' => 1, | |
'routinginterface.php' => 1, | |
'mpcatalogbundle.php' => 1, | |
'error-0035-in.jsonld' => 1, | |
'segment.php' => 1, | |
'expand-0028-in.jsonld' => 1, | |
'expand-0028-out.jsonld' => 1, | |
'phycachebundle.php' => 1, | |
'githook.php' => 1, | |
'expand-0022-out.jsonld' => 1, | |
'expand-0025-in.jsonld' => 1, | |
'credentials.inc.php' => 1, | |
'pwstrengthasset.php' => 1, | |
'expand-0023-in.jsonld' => 1, | |
'expand-0023-out.jsonld' => 1, | |
'expand-0024-in.jsonld' => 1, | |
'nano.rocks' => 1, | |
'expand-0024-out.jsonld' => 1, | |
'messenger.php' => 1, | |
'index-cancel.php' => 1, | |
'elfindervolumeflysystemext.php' => 1, | |
'pwstrength.php' => 1, | |
'expand-0025-out.jsonld' => 1, | |
'naonedoaipmhserverbundle.php' => 1, | |
'pkr.php' => 1, | |
'index-sendpayment.php' => 1, | |
'index-query.php' => 1, | |
'mvrhovresourcebundle.php' => 1, | |
'nzedbbase.php' => 1, | |
'customerio.php' => 1, | |
'jqueryfileuploadbundle.php' => 1, | |
'expand-0009-in.jsonld' => 1, | |
'expand-0008-out.jsonld' => 1, | |
'expand-0008-in.jsonld' => 1, | |
'17monipdb.dat' => 1, | |
'expand-0007-out.jsonld' => 1, | |
'expand-0014-out.jsonld' => 1, | |
'expand-0015-in.jsonld' => 1, | |
'expand-0009-out.jsonld' => 1, | |
'expand-0007-in.jsonld' => 1, | |
'client.class.php' => 1, | |
'api.class.php' => 1, | |
'version.xml' => 1, | |
'expand-0006-out.jsonld' => 1, | |
'expand-0006-in.jsonld' => 1, | |
'menuhelper.php' => 1, | |
'travis_init.sh' => 1, | |
'expand-0014-in.jsonld' => 1, | |
'expand-0005-out.jsonld' => 1, | |
'commitlog' => 1, | |
'expand-0012-in.jsonld' => 1, | |
'ssdbsession.php' => 1, | |
'expand-0012-out.jsonld' => 1, | |
'rock.php' => 1, | |
'expand-0010-out.jsonld' => 1, | |
'plugin_manager.php' => 1, | |
'config.new.php' => 1, | |
'expand-0010-in.jsonld' => 1, | |
'expand-0013-out.jsonld' => 1, | |
'function_mock.php' => 1, | |
'pdfmerger.php' => 1, | |
'hamark.com' => 1, | |
'myxaxafilesearchbundle.php' => 1, | |
'run-demo' => 1, | |
'dropdownlte.php' => 1, | |
'expand-0013-in.jsonld' => 1, | |
'wkhtmltopdf' => 1, | |
'expand-0005-in.jsonld' => 1, | |
'upcommand.php' => 1, | |
'n1c0officialtextbundle.php' => 1, | |
'expand-0001-in.jsonld' => 1, | |
'error-manifest.jsonld' => 1, | |
'mwtagadminbundle.php' => 1, | |
'passwordgenerator.inc.php' => 1, | |
'yahoo_business_browser.php' => 1, | |
'n1c0dissertationbundle.php' => 1, | |
'n1c0lessonbundle.php' => 1, | |
'expand-0015-out.jsonld' => 1, | |
'semanticbundle.php' => 1, | |
'n1c0quotebundle.php' => 1, | |
'mwshortcodebundle.php' => 1, | |
'expand-0016-in.jsonld' => 1, | |
'yajit.php' => 1, | |
'error-0043-in.jsonld' => 1, | |
'error-0042-in.jsonld' => 1, | |
'up.php' => 1, | |
'uagent.php' => 1, | |
'conductor' => 1, | |
'expand-0004-out.jsonld' => 1, | |
'mybuildercronosbundle.php' => 1, | |
'expand-0004-in.jsonld' => 1, | |
'expand-0003-out.jsonld' => 1, | |
'navlte.php' => 1, | |
'abstractsoapclient.php' => 1, | |
'wkhtmltoimage' => 1, | |
'domainstatus.php' => 1, | |
'expand-0003-in.jsonld' => 1, | |
'soapclientinterface.php' => 1, | |
'nscontactbundle.php' => 1, | |
'expand-0002-out.jsonld' => 1, | |
'usernamestatus.php' => 1, | |
'expand-0002-in.jsonld' => 1, | |
'c' => 1, | |
'conductor-logo.png' => 1, | |
't' => 1, | |
'expand-0001-out.jsonld' => 1, | |
'narogasearchbundle.php' => 1, | |
'expand-0029-in.jsonld' => 1, | |
'expand-0054-out.jsonld' => 1, | |
'recipexport.php' => 1, | |
'expand-0043-in.jsonld' => 1, | |
'expand-0043-out.jsonld' => 1, | |
'expand-0044-in.jsonld' => 1, | |
'expand-0044-out.jsonld' => 1, | |
'error-0016-in.jsonld' => 1, | |
'phpunit-shutdown.php' => 1, | |
'authdatasample.ini' => 1, | |
'error-0018-in.jsonld' => 1, | |
'error-0015-in.jsonld' => 1, | |
'expand-0045-in.jsonld' => 1, | |
'expand-0045-out.jsonld' => 1, | |
'user.properties' => 1, | |
'expand-0046-in.jsonld' => 1, | |
'mrt.sh' => 1, | |
'expand-0046-out.jsonld' => 1, | |
'error-0017-in.jsonld' => 1, | |
'error-0019-in.jsonld' => 1, | |
'expand-0047-out.jsonld' => 1, | |
'expand-0040-in.jsonld' => 1, | |
'error-0024-in.jsonld' => 1, | |
'globalstatedb.php' => 1, | |
'dbbatch.php' => 1, | |
'expand-0038-out.jsonld' => 1, | |
'error-0023-in.jsonld' => 1, | |
'expand-0039-in.jsonld' => 1, | |
'expand-0039-out.jsonld' => 1, | |
'expand-0011-out.jsonld' => 1, | |
'error-0020-in.jsonld' => 1, | |
'expand-0041-in.jsonld' => 1, | |
'expand-0041-out.jsonld' => 1, | |
'expand-0042-in.jsonld' => 1, | |
'expand-0042-out.jsonld' => 1, | |
'cwr.bat' => 1, | |
'error-0022-in.jsonld' => 1, | |
'error-0021-in.jsonld' => 1, | |
'expand-0047-in.jsonld' => 1, | |
'db-sync.phar' => 1, | |
'globalstateform.php' => 1, | |
'mremiurlshortenerbundle.php' => 1, | |
'keystone.php' => 1, | |
'expand-0052-out.jsonld' => 1, | |
'httpconnection.php' => 1, | |
'mssql.php' => 1, | |
'dbalinterface.php' => 1, | |
'expand-0053-in.jsonld' => 1, | |
'apiinterface.php' => 1, | |
'expand-0053-out.jsonld' => 1, | |
'nativeconnection.php' => 1, | |
'mremitemplatingextrabundle.php' => 1, | |
'mremidolistbundle.php' => 1, | |
'mremibootstrapbundle.php' => 1, | |
'csvtabletest.php' => 1, | |
'csvtable.php' => 1, | |
'graph.gif' => 1, | |
'expand-0054-in.jsonld' => 1, | |
'keystoneinterface.php' => 1, | |
'guest.php' => 1, | |
'autobahn.json' => 1, | |
'expand-0050-out.jsonld' => 1, | |
'error-0014-in.jsonld' => 1, | |
'expand-0048-in.jsonld' => 1, | |
'expand-0048-out.jsonld' => 1, | |
'mssqlstore.php' => 1, | |
'expand-0049-in.jsonld' => 1, | |
'expand-0049-out.jsonld' => 1, | |
'expand-0050-in.jsonld' => 1, | |
'expand-0051-in.jsonld' => 1, | |
'loginterface.php' => 1, | |
'mongostore.php' => 1, | |
'reqs' => 1, | |
'phrets.php' => 1, | |
'expand-0051-out.jsonld' => 1, | |
'apigen.config' => 1, | |
'dbstore.php' => 1, | |
'other.php' => 1, | |
'globalstatefile.php' => 1, | |
'gridbundle.php' => 1, | |
'error-0034-in.jsonld' => 1, | |
'auntyentity.php' => 1, | |
'mongojson.php' => 1, | |
'imdb_charts.class.php' => 1, | |
'element.json' => 1, | |
'expand-0032-out.jsonld' => 1, | |
'error-0032-in.jsonld' => 1, | |
'newscred.php' => 1, | |
'expand-0033-in.jsonld' => 1, | |
'imdb_movielist.class.php' => 1, | |
'expand-0031-out.jsonld' => 1, | |
'imdb_nowplaying.class.php' => 1, | |
'yiiaws.php' => 1, | |
'less.js' => 1, | |
'error-0031-in.jsonld' => 1, | |
'error-0030-in.jsonld' => 1, | |
'imdb_person.class.php' => 1, | |
'error-0029-in.jsonld' => 1, | |
'expand-0032-in.jsonld' => 1, | |
'expand-0031-in.jsonld' => 1, | |
'bootstrapper.min.less' => 1, | |
'expand-0029-out.jsonld' => 1, | |
'nass600cosmbundle.php' => 1, | |
'nass600lyricsbundle.php' => 1, | |
'ucnode.inc.php' => 1, | |
'sysconfig.inc.php' => 1, | |
'supports' => 1, | |
'nass600mediainfobundle.php' => 1, | |
'license.commercial' => 1, | |
'oai.php' => 1, | |
'error-0033-in.jsonld' => 1, | |
'expand-0030-in.jsonld' => 1, | |
'browseremulator.class.php' => 1, | |
'imdbxml.php' => 1, | |
'imdb_budget.class.php' => 1, | |
'chatserver.php' => 1, | |
'expand-0030-out.jsonld' => 1, | |
'muchomasfacilformbyemailbundle.php' => 1, | |
'imdb_trailers.class.php' => 1, | |
'bootstrapper.html' => 1, | |
'expand-0037-out.jsonld' => 1, | |
'sitemapinterface.php' => 1, | |
's3streamwrapper.php' => 1, | |
'pouyasoftdatebundle.php' => 1, | |
'expand-0035-out.jsonld' => 1, | |
'test_config.dist.json' => 1, | |
'openexchangeratesbundle.php' => 1, | |
'expand-0036-in.jsonld' => 1, | |
'pilot.class.php' => 1, | |
'expand-0036-out.jsonld' => 1, | |
'expand-0035-in.jsonld' => 1, | |
'pilot_person.class.php' => 1, | |
'mdashfilter.php' => 1, | |
'pilotsearch.class.php' => 1, | |
'mdash.php' => 1, | |
'cwr' => 1, | |
'globalstateinterface.php' => 1, | |
'expand-0037-in.jsonld' => 1, | |
'abstractgenerator.php' => 1, | |
'expand-0034-out.jsonld' => 1, | |
'imdbsearch.class.php' => 1, | |
'movie.php' => 1, | |
'mdb_base.class.php' => 1, | |
'mdb_config.class.php' => 1, | |
'error-0028-in.jsonld' => 1, | |
'error-0027-in.jsonld' => 1, | |
'mdb_request.class.php' => 1, | |
'error-0026-in.jsonld' => 1, | |
'msulistijophpseclibbundle.php' => 1, | |
'gulpfile.babel.js' => 1, | |
'resourcebag.php' => 1, | |
'movie_base.class.php' => 1, | |
'error-0025-in.jsonld' => 1, | |
'movieposterdb.class.php' => 1, | |
'person_base.class.php' => 1, | |
'expand-0033-out.jsonld' => 1, | |
'expand-0034-in.jsonld' => 1, | |
'google-api' => 1, | |
'expand-0052-in.jsonld' => 1, | |
'metatag.module' => 1, | |
'license_gplv3' => 1, | |
'reinstall_e.sh' => 1, | |
'json-patch-tests' => 1, | |
'normalize-0033-in.jsonld' => 1, | |
'normalize-0033-out.nq' => 1, | |
'normalize-0034-in.jsonld' => 1, | |
'normalize-0034-out.nq' => 1, | |
'.rock.yml' => 1, | |
'normalize-0035-in.jsonld' => 1, | |
'masterbaker.gemspec' => 1, | |
'syncdocs.sh' => 1, | |
'repackage.sh' => 1, | |
'package.xml.base' => 1, | |
'run_tests.php' => 1, | |
'build.xml.new' => 1, | |
'php_compiler.class.php' => 1, | |
'normalize-0035-out.nq' => 1, | |
'update-all' => 1, | |
'apidocvim' => 1, | |
'xreturnable.php' => 1, | |
'normalize-0036-in.jsonld' => 1, | |
'normalize-0036-out.nq' => 1, | |
'xcrudcontroller.php' => 1, | |
'normalize-0037-in.jsonld' => 1, | |
'normalize-0037-out.nq' => 1, | |
'local_tests.json' => 1, | |
'normalize-0032-out.nq' => 1, | |
'normalize-0038-in.jsonld' => 1, | |
'normalize-0028-in.jsonld' => 1, | |
'google_tag.libraries.yml' => 1, | |
'google_tag.install' => 1, | |
'google_tag.info.yml' => 1, | |
'normalize-0026-in.jsonld' => 1, | |
'sendemail.php' => 1, | |
'dateintervalvalidator.php' => 1, | |
'headerparamauth.php' => 1, | |
'normalize-0026-out.nq' => 1, | |
'normalize-0027-in.jsonld' => 1, | |
'normalize-0027-out.nq' => 1, | |
'normalize-0028-out.nq' => 1, | |
'normalize-0032-in.jsonld' => 1, | |
'x11-license' => 1, | |
'efullcalendar.php' => 1, | |
'mikemeierphpnodebridgebundle.php' => 1, | |
'mikemeiereasyauthbundle.php' => 1, | |
'simplexml_tests.json' => 1, | |
'normalize-0029-in.jsonld' => 1, | |
'normalize-0029-out.nq' => 1, | |
'normalize-0030-in.jsonld' => 1, | |
'normalize-0030-out.nq' => 1, | |
'normalize-0031-in.jsonld' => 1, | |
'normalize-0031-out.nq' => 1, | |
'translatable.php' => 1, | |
'normalize-0038-out.nq' => 1, | |
'google_tag.module' => 1, | |
'mzmailchimpbundle.php' => 1, | |
'msserializerbundle.php' => 1, | |
'sereal_spec.pod' => 1, | |
'readme.pod' => 1, | |
'rpcexception.php' => 1, | |
'msrpcbundle.php' => 1, | |
'msdoctrinetypesbundle.php' => 1, | |
'namespacing.php' => 1, | |
'mscachebundle.php' => 1, | |
'odin' => 1, | |
'mzpostmarkbundle.php' => 1, | |
'doctrinefixturesautonumberresetbundle.php' => 1, | |
'documenthash.php' => 1, | |
'std.include.php' => 1, | |
'normalize-0043-out.nq' => 1, | |
'travis_trigger' => 1, | |
'rdfmapper.php' => 1, | |
'normalize-0044-in.jsonld' => 1, | |
'normalize-0044-out.nq' => 1, | |
'normalize-0045-in.jsonld' => 1, | |
'normalize-0045-out.nq' => 1, | |
'normalize-0046-in.jsonld' => 1, | |
'normalize-0046-out.nq' => 1, | |
'normalize-0047-in.jsonld' => 1, | |
'mstestbundle.php' => 1, | |
'readabillity.php' => 1, | |
'wkhtmltopdf.php' => 1, | |
'normalize-0040-in.jsonld' => 1, | |
'pdfable.php' => 1, | |
'pdffile.php' => 1, | |
'packagescommand.php' => 1, | |
'packagecompressor.php' => 1, | |
'normalize-0039-in.jsonld' => 1, | |
'flushabledependency.php' => 1, | |
'attributedefaultspersister.php' => 1, | |
'rsa.php' => 1, | |
'noddy' => 1, | |
'normalize-0039-out.nq' => 1, | |
'normalize-0040-out.nq' => 1, | |
'mapgoogleasset.php' => 1, | |
'normalize-0041-in.jsonld' => 1, | |
'g2s' => 1, | |
'third-party' => 1, | |
'normalize-0041-out.nq' => 1, | |
'config-example.json' => 1, | |
'sshv' => 1, | |
'.scruitnizer.yml' => 1, | |
'normalize-0042-in.jsonld' => 1, | |
'normalize-0042-out.nq' => 1, | |
'mapyandexasset.php' => 1, | |
'normalize-0043-in.jsonld' => 1, | |
'google_tag.links.menu.yml' => 1, | |
'google_tag.permissions.yml' => 1, | |
'normalize-0048-in.jsonld' => 1, | |
'vsymfopaymentegopaybundle.php' => 1, | |
'xdebugtraceextension.php' => 1, | |
'xdebugtrace.php' => 1, | |
'normalize-0009-out.nq' => 1, | |
'typeconverter.php' => 1, | |
'normalize-0010-in.jsonld' => 1, | |
'normalize-0010-out.nq' => 1, | |
'vsymfopaymentperfectmoneybundle.php' => 1, | |
'normalize-0011-in.jsonld' => 1, | |
'vsymfopaymentpayeerbundle.php' => 1, | |
'vsymfopaymentokpaybundle.php' => 1, | |
'vsymfopaymentblockchainbundle.php' => 1, | |
'normalize-0009-in.jsonld' => 1, | |
'normalize-0011-out.nq' => 1, | |
'rapidsitemap.xml' => 1, | |
'normalize-0012-in.jsonld' => 1, | |
'normalize-0012-out.nq' => 1, | |
'normalize-0013-in.jsonld' => 1, | |
'rapidimage.xml' => 1, | |
'normalize-0013-out.nq' => 1, | |
'rapidimage.php' => 1, | |
'nginx.conf.default' => 1, | |
'normalize-0014-in.jsonld' => 1, | |
'token.tokens.inc' => 1, | |
'content.latte' => 1, | |
'error.latte' => 1, | |
'normalize-0014-out.nq' => 1, | |
'mg-events.php' => 1, | |
'normalize-0006-in.jsonld' => 1, | |
'firephp.php' => 1, | |
'blogwidget.php' => 1, | |
'normalize-0006-out.nq' => 1, | |
'unbox-logo.png' => 1, | |
'normalize-0007-in.jsonld' => 1, | |
'composer_path.func.php' => 1, | |
'integrated.json' => 1, | |
'normalize-0007-out.nq' => 1, | |
'style-guide' => 1, | |
'mgeventsrequirements.php' => 1, | |
'normalize-0008-out.nq' => 1, | |
'mg-cache.php' => 1, | |
'mgcacherouting.php' => 1, | |
'mgcacherequirements.php' => 1, | |
'convert-os.php' => 1, | |
'convert-engine.php' => 1, | |
'convert-devices.php' => 1, | |
'convert-browser.php' => 1, | |
'normalize-0008-in.jsonld' => 1, | |
'manual.en' => 1, | |
'manual.cs' => 1, | |
'aliasexpander.php' => 1, | |
'token.services.yml' => 1, | |
'normalize-0015-in.jsonld' => 1, | |
'google_tag.routing.yml' => 1, | |
'.travis-after-before-script.sh' => 1, | |
'redirect.info.yml' => 1, | |
'redirect.generate.inc' => 1, | |
'normalize-0021-in.jsonld' => 1, | |
'normalize-0021-out.nq' => 1, | |
'normalize-0022-in.jsonld' => 1, | |
'normalize-0022-out.nq' => 1, | |
'normalize-0023-in.jsonld' => 1, | |
'normalize-0023-out.nq' => 1, | |
'redirect.drush.inc' => 1, | |
'redirect.api.php' => 1, | |
'metatag.services.yml' => 1, | |
'redirect.install' => 1, | |
'metatag.routing.yml' => 1, | |
'metatag.permissions.yml' => 1, | |
'normalize-0024-in.jsonld' => 1, | |
'normalize-0024-out.nq' => 1, | |
'metatag.links.menu.yml' => 1, | |
'metatag.links.action.yml' => 1, | |
'normalize-0025-in.jsonld' => 1, | |
'metatag.install' => 1, | |
'normalize-0025-out.nq' => 1, | |
'metatag.info.yml' => 1, | |
'google_tag.services.yml' => 1, | |
'normalize-0020-out.nq' => 1, | |
'redirect.links.action.yml' => 1, | |
'normalize-0015-out.nq' => 1, | |
'token.libraries.yml' => 1, | |
'normalize-0016-in.jsonld' => 1, | |
'normalize-0016-out.nq' => 1, | |
'normalize-0017-in.jsonld' => 1, | |
'normalize-0017-out.nq' => 1, | |
'token.routing.yml' => 1, | |
'token.pages.inc' => 1, | |
'normalize-0018-in.jsonld' => 1, | |
'normalize-0018-out.nq' => 1, | |
'normalize-0019-in.jsonld' => 1, | |
'token.module' => 1, | |
'token.links.task.yml' => 1, | |
'token.install' => 1, | |
'normalize-0020-in.jsonld' => 1, | |
'token.info.yml' => 1, | |
'token.drush.inc' => 1, | |
'arrow-right.png' => 1, | |
'arrow-down.png' => 1, | |
'redirect.services.yml' => 1, | |
'redirect.routing.yml' => 1, | |
'redirect.permissions.yml' => 1, | |
'redirect.module' => 1, | |
'normalize-0019-out.nq' => 1, | |
'redirect.links.task.yml' => 1, | |
'redirect.links.menu.yml' => 1, | |
'normalize-0047-out.nq' => 1, | |
'normalize-0048-out.nq' => 1, | |
'normalize-0005-out.nq' => 1, | |
'deep_json_decode.php' => 1, | |
'tordf-0010-out.nq' => 1, | |
'search_json_index.php' => 1, | |
'tordf-0011-in.jsonld' => 1, | |
'rrmdir.php' => 1, | |
'read_file_lines.php' => 1, | |
'goto_dir.php' => 1, | |
'get_modified_files_since.php' => 1, | |
'get_json_index.php' => 1, | |
'get_json.php' => 1, | |
'get_directory_last_modified.php' => 1, | |
'tordf-0011-out.nq' => 1, | |
'set_json_index.php' => 1, | |
'tordf-0012-in.jsonld' => 1, | |
'copy_dir.php' => 1, | |
'tordf-0012-out.nq' => 1, | |
'tordf-0013-in.jsonld' => 1, | |
'tordf-0013-out.nq' => 1, | |
'tordf-0014-in.jsonld' => 1, | |
'tordf-0014-out.nq' => 1, | |
'tordf-0015-in.jsonld' => 1, | |
'platform-docker' => 1, | |
'drupalorg' => 1, | |
'tordf-0015-out.nq' => 1, | |
'set_json.php' => 1, | |
'sfile_get_contents.php' => 1, | |
'tordf-0016-out.nq' => 1, | |
'tordf-0007-in.jsonld' => 1, | |
'mseventdatabundle.php' => 1, | |
'phpunit-generator.php' => 1, | |
'tordf-0004-out.nq' => 1, | |
'geodb.sqlite' => 1, | |
'update.py' => 1, | |
'tordf-0005-in.jsonld' => 1, | |
'tordf-0005-out.nq' => 1, | |
'tordf-0006-in.jsonld' => 1, | |
'checker.py' => 1, | |
'tordf-0006-out.nq' => 1, | |
'tordf-0007-out.nq' => 1, | |
'sfile_put_contents.php' => 1, | |
'mhujerfioapibundle.php' => 1, | |
'tordf-0008-in.jsonld' => 1, | |
'mhormediainfobundle.php' => 1, | |
'tordf-0008-out.nq' => 1, | |
'diacriticsremover.php' => 1, | |
'secret_envs.sh.enc' => 1, | |
'tordf-0009-in.jsonld' => 1, | |
'composers.json' => 1, | |
'tordf-0009-out.nq' => 1, | |
'tordf-0010-in.jsonld' => 1, | |
'unzip.php' => 1, | |
'tordf-0016-in.jsonld' => 1, | |
'pushnotificationmanager.php' => 1, | |
'edible.yaml' => 1, | |
'tordf-0025-out.nq' => 1, | |
'tordf-0024-out.nq' => 1, | |
'castnumbertostringvalidator.php' => 1, | |
'jqueryserializeobjectasset.php' => 1, | |
'tordf-0025-in.jsonld' => 1, | |
'intllocaleasset.php' => 1, | |
'intlasset.php' => 1, | |
'disablecsrfvalidationfilter.php' => 1, | |
'httpexecute.php' => 1, | |
'run-single-test.sh' => 1, | |
'wrecker.yml' => 1, | |
'scratchpad' => 1, | |
'tordf-0024-in.jsonld' => 1, | |
'tordf-0026-in.jsonld' => 1, | |
'mzzbundle.php' => 1, | |
'jtimepickerasset.php' => 1, | |
'proto.php' => 1, | |
'tordf-0026-out.nq' => 1, | |
'e2e-test.bats' => 1, | |
'metrobundle.php' => 1, | |
'tordf-0027-in.jsonld' => 1, | |
'commandintegrator.php' => 1, | |
'tordf-0027-out.nq' => 1, | |
'tordf-0028-in.jsonld' => 1, | |
'euvatnumbervalidator.php' => 1, | |
'ibanvalidator.php' => 1, | |
'tordf-0017-in.jsonld' => 1, | |
'tordf-0019-in.jsonld' => 1, | |
'manticorapushnotificationbundle.php' => 1, | |
'manticorarestextrabundle.php' => 1, | |
'tordf-0017-out.nq' => 1, | |
'manticoraoauthbundle.php' => 1, | |
'manticoragooglefederatedloginbundle.php' => 1, | |
'tordf-0018-in.jsonld' => 1, | |
'tordf-0018-out.nq' => 1, | |
'manticoracmsbundle.php' => 1, | |
'mgiclassifiedsbundle.php' => 1, | |
'mgiblogbundle.php' => 1, | |
'lyraadminbundle.php' => 1, | |
'tordf-0023-out.nq' => 1, | |
'tordf-0019-out.nq' => 1, | |
'mgdebugbundle.php' => 1, | |
'mgblockbundle.php' => 1, | |
'tordf-0020-in.jsonld' => 1, | |
'jqgrid.png' => 1, | |
'tordf-0020-out.nq' => 1, | |
'mgpesmodelbundle.php' => 1, | |
'tordf-0022-in.jsonld' => 1, | |
'tordf-0022-out.nq' => 1, | |
'sfmducksboardbundle.php' => 1, | |
'tordf-0023-in.jsonld' => 1, | |
'msfrontcontrollersecuritybundle.php' => 1, | |
'tordf-0004-in.jsonld' => 1, | |
'normalize-0049-in.jsonld' => 1, | |
'normalize-0057-out.nq' => 1, | |
'normalize-0055-out.nq' => 1, | |
'normalize-0056-in.jsonld' => 1, | |
'dasliderasset.php' => 1, | |
'normalize-0056-out.nq' => 1, | |
'deletemultipleaction.php' => 1, | |
'actionbarasset.php' => 1, | |
'amwhoopsbundle.php' => 1, | |
'mickadoobasedatabundle.php' => 1, | |
'mickadooyamlapidocannotationbundle.php' => 1, | |
'normalize-0057-in.jsonld' => 1, | |
'normalize-manifest.jsonld' => 1, | |
'prowlclient.php' => 1, | |
'weedstorage.php' => 1, | |
'remote-doc-0001-in.jsonld' => 1, | |
'remote-doc-0001-out.jsonld' => 1, | |
'weedmanager.php' => 1, | |
'micjohnsonweedphpbundle.php' => 1, | |
'rbaccontroller.php' => 1, | |
'rbacconsolebootstrap.php' => 1, | |
'dutyconsole.php' => 1, | |
'remote-doc-0002-in.json' => 1, | |
'dutybootstrap.php' => 1, | |
'qr.php' => 1, | |
'micronaxprowlbundle.php' => 1, | |
'checkout.php' => 1, | |
'qrbundle.php' => 1, | |
'phpcs.php' => 1, | |
'mgdschema.php' => 1, | |
'normalize-0049-out.nq' => 1, | |
'application.yml' => 1, | |
'normalize-0050-in.jsonld' => 1, | |
'normalize-0050-out.nq' => 1, | |
'normalize-0051-in.jsonld' => 1, | |
'normalize-0051-out.nq' => 1, | |
'normalize-0052-in.jsonld' => 1, | |
'normalize-0052-out.nq' => 1, | |
'normalize-0053-in.jsonld' => 1, | |
'normalize-0053-out.nq' => 1, | |
'clean.php' => 1, | |
'text_page.php' => 1, | |
'template_settings.php' => 1, | |
'normalize-0054-in.jsonld' => 1, | |
'template_settings.css' => 1, | |
'mw_sql_restore.sql' => 1, | |
'normalize-0054-out.nq' => 1, | |
'mw_default_content.zip' => 1, | |
'inner.php' => 1, | |
'normalize-0055-in.jsonld' => 1, | |
'header_options.php' => 1, | |
'contacts.php' => 1, | |
'remote-doc-0002-out.jsonld' => 1, | |
'commerce_profile.profile' => 1, | |
'cmap' => 1, | |
'tordf-0001-out.nq' => 1, | |
'remote-doc-0011-out.jsonld' => 1, | |
'remote-doc-0012-context1.jsonld' => 1, | |
'remote-doc-0012-context2.jsonld' => 1, | |
'remote-doc-0012-in.json' => 1, | |
'forumnode.php' => 1, | |
'catnode.php' => 1, | |
'cathierarchy.php' => 1, | |
'remote-doc-manifest.jsonld' => 1, | |
'tordf-0001-in.jsonld' => 1, | |
'blacklist' => 1, | |
'tordf-0002-in.jsonld' => 1, | |
'remote-doc-0011-context.jsonld' => 1, | |
'phpunit.cov.xml' => 1, | |
'xmlrepeater.php' => 1, | |
'tordf-0002-out.nq' => 1, | |
'xmldecoratorinterface.php' => 1, | |
'documentation_guideline' => 1, | |
'tordf-0003-in.jsonld' => 1, | |
'tordf-0003-out.nq' => 1, | |
'admin-page-framework-loader.php' => 1, | |
'aretusaflashbundle.php' => 1, | |
'.remarkrc' => 1, | |
'cmap.php' => 1, | |
'remote-doc-0011-in.jldt' => 1, | |
'hierarchynode.php' => 1, | |
'commerce_profile.links.menu.yml' => 1, | |
'bccmyrrixbundle.php' => 1, | |
'commerce_profile.install' => 1, | |
'remote-doc-0003-in.jldt' => 1, | |
'remote-doc-0003-out.jsonld' => 1, | |
'remote-doc-0004-in.jldte' => 1, | |
'commerce_profile.info.yml' => 1, | |
'remote-doc-0009-context.jsonld' => 1, | |
'michelvdoctrinecachesweeperbundle.php' => 1, | |
'cachesweeper.php' => 1, | |
'cachesweepableinterface.php' => 1, | |
'remote-doc-0009-in.jsonld' => 1, | |
'myrrix.jar' => 1, | |
'bccextratoolsbundle.php' => 1, | |
'ihierarchynode.php' => 1, | |
'remote-doc-0009-out.jsonld' => 1, | |
'remote-doc-0010-context.jsonld' => 1, | |
'remote-doc-0010-in.json' => 1, | |
'remote-doc-0010-out.jsonld' => 1, | |
'bccautomapperbundle.php' => 1, | |
'epsjqgridbundle.php' => 1, | |
'betterdd_example.png' => 1, | |
'teamcity-clover.php' => 1, | |
'teamcity-clover' => 1, | |
'oauth2servermongodbbundle.php' => 1, | |
'git.aws-push.php' => 1, | |
'symfonycommands.php' => 1, | |
'normalize-0005-in.jsonld' => 1, | |
'cform.php' => 1, | |
'frame-0001-in.jsonld' => 1, | |
'flatten-0044-context.jsonld' => 1, | |
'flatten-0044-in.jsonld' => 1, | |
'flatten-0044-out.jsonld' => 1, | |
'flatten-0045-in.jsonld' => 1, | |
'flatten-0045-out.jsonld' => 1, | |
'flatten-0046-in.jsonld' => 1, | |
'flatten-0046-out.jsonld' => 1, | |
'flatten-manifest.jsonld' => 1, | |
'frame-0001-frame.jsonld' => 1, | |
'spring.jpg' => 1, | |
'pdatepicker.js' => 1, | |
'summer.jpg' => 1, | |
'frame-0001-out.jsonld' => 1, | |
'frame-0002-frame.jsonld' => 1, | |
'frame-0002-in.jsonld' => 1, | |
'frame-0002-out.jsonld' => 1, | |
'frame-0003-frame.jsonld' => 1, | |
'frame-0003-in.jsonld' => 1, | |
'frame-0003-out.jsonld' => 1, | |
'frame-0004-frame.jsonld' => 1, | |
'frame-0004-in.jsonld' => 1, | |
'frame-0004-out.jsonld' => 1, | |
'pdatepicker.css' => 1, | |
'flatten-0043-out.jsonld' => 1, | |
'winter.jpg' => 1, | |
'frame-0005-frame.jsonld' => 1, | |
'flatten-0040-in.jsonld' => 1, | |
'flatten-0038-out.jsonld' => 1, | |
'dssmarty.php' => 1, | |
'smarty_compiler.class.php' => 1, | |
'config_file.class.php' => 1, | |
'test-json.php' => 1, | |
'harbour' => 1, | |
'phake.zsh-completion' => 1, | |
'flatten-0039-in.jsonld' => 1, | |
'flatten-0039-out.jsonld' => 1, | |
'phake' => 1, | |
'basgeneratorbundle.php' => 1, | |
'tst' => 1, | |
'fixturesgeneratorbundle.php' => 1, | |
'flatten-0040-out.jsonld' => 1, | |
'flatten-0041-in.jsonld' => 1, | |
'flatten-0041-out.jsonld' => 1, | |
'flatten-0042-in.jsonld' => 1, | |
'flatten-0042-out.jsonld' => 1, | |
'mohebifardatetimebundle.php' => 1, | |
'mohebifarcalendarbundle.php' => 1, | |
'meisaratingbundle.php' => 1, | |
'flatten-0043-in.jsonld' => 1, | |
'meisamenubundle.php' => 1, | |
'autumn.jpg' => 1, | |
'jqueryticker.js' => 1, | |
'xmlfeed.php' => 1, | |
'moderaconfigbundle.php' => 1, | |
'moderalanguagesbundle.php' => 1, | |
'moderafoundationbundle.php' => 1, | |
'moderafileuploaderbundle.php' => 1, | |
'moderafilerepositorybundle.php' => 1, | |
'moderadynamicallyconfigurablemjrbundle.php' => 1, | |
'frame-0007-frame.jsonld' => 1, | |
'moderadynamicallyconfigurableappbundle.php' => 1, | |
'frame-0007-in.jsonld' => 1, | |
'kernelconfig.php' => 1, | |
'moderadirectbundle.php' => 1, | |
'moderabackendtranslationstoolbundle.php' => 1, | |
'moderamjrsecurityintegrationbundle.php' => 1, | |
'moderabackendtoolssettingsbundle.php' => 1, | |
'frame-0007-out.jsonld' => 1, | |
'frame-0008-frame.jsonld' => 1, | |
'frame-0008-in.jsonld' => 1, | |
'frame-0008-out.jsonld' => 1, | |
'moderabackendtoolsbundle.php' => 1, | |
'moderabackendtoolsactivitylogbundle.php' => 1, | |
'moderabackendsecuritybundle.php' => 1, | |
'moderabackendonsteroidsbundle.php' => 1, | |
'moderabackendmodulebundle.php' => 1, | |
'frame-0009-frame.jsonld' => 1, | |
'moderamjrcacheawareclassloaderbundle.php' => 1, | |
'moderamjrthemeintegrationbundle.php' => 1, | |
'specshapercalendarbundle.php' => 1, | |
'circleci.modx.config.xml' => 1, | |
'necktie-v0.4-alpha.jpg' => 1, | |
'frame-0005-in.jsonld' => 1, | |
'frame-0005-out.jsonld' => 1, | |
'widgetsbundle.php' => 1, | |
'passthroughnamingstrategy.php' => 1, | |
'frame-0006-frame.jsonld' => 1, | |
'trinitynotificationbundle.php' => 1, | |
'frame-0006-in.jsonld' => 1, | |
'frame-0006-out.jsonld' => 1, | |
'loggerbundle.php' => 1, | |
'modernfactoryresourcesbundle.php' => 1, | |
'moderamjrintegrationbundle.php' => 1, | |
'mcloud.yml' => 1, | |
'mf-upgrade-3.0' => 1, | |
'.mcignore' => 1, | |
'versions.json' => 1, | |
'moderaupgradebundle.php' => 1, | |
'moderatranslationsbundle.php' => 1, | |
'moderaservercrudbundle.php' => 1, | |
'moderasecuritybundle.php' => 1, | |
'moderaroutingbundle.php' => 1, | |
'moderanotificationbundle.php' => 1, | |
'moderamodulebundle.php' => 1, | |
'basexmlpipe.php' => 1, | |
'mongrate' => 1, | |
'moderabackendlanguagesbundle.php' => 1, | |
'flatten-0019-out.jsonld' => 1, | |
'class.ooyalaapiconfig.php' => 1, | |
'flatten-0016-in.jsonld' => 1, | |
'flatten-0016-out.jsonld' => 1, | |
'disqus.yml' => 1, | |
'flatten-0017-in.jsonld' => 1, | |
'morbicerconverterbundle.php' => 1, | |
'flatten-0017-out.jsonld' => 1, | |
'flatten-0018-in.jsonld' => 1, | |
'flatten-0018-out.jsonld' => 1, | |
'flatten-0019-in.jsonld' => 1, | |
'flatten-0020-in.jsonld' => 1, | |
'class.ooyaladownloader.php' => 1, | |
'flatten-0020-out.jsonld' => 1, | |
'flatten-0021-in.jsonld' => 1, | |
'flatten-0021-out.jsonld' => 1, | |
'flatten-0022-in.jsonld' => 1, | |
'flatten-0022-out.jsonld' => 1, | |
'skybot.php' => 1, | |
'flatten-0023-in.jsonld' => 1, | |
'flatten-0023-out.jsonld' => 1, | |
'config.yml.sample' => 1, | |
'flatten-0024-in.jsonld' => 1, | |
'flatten-0024-out.jsonld' => 1, | |
'flatten-0015-out.jsonld' => 1, | |
'sdk' => 1, | |
'flatten-0025-out.jsonld' => 1, | |
'flatten-0012-in.jsonld' => 1, | |
'morusacceticbundle.php' => 1, | |
'flatten-0007-out.jsonld' => 1, | |
'flatten-0008-in.jsonld' => 1, | |
'flatten-0008-out.jsonld' => 1, | |
'flatten-0009-in.jsonld' => 1, | |
'flatten-0009-out.jsonld' => 1, | |
'flatten-0010-in.jsonld' => 1, | |
'flatten-0010-out.jsonld' => 1, | |
'flatten-0011-in.jsonld' => 1, | |
'flatten-0011-out.jsonld' => 1, | |
'bootstrap.php.example' => 1, | |
'morkibouncebundle.php' => 1, | |
'flatten-0012-out.jsonld' => 1, | |
'example.build.properties' => 1, | |
'flatten-0013-in.jsonld' => 1, | |
'flatten-0013-out.jsonld' => 1, | |
'build.base.properties' => 1, | |
'flatten-0014-in.jsonld' => 1, | |
'genericselect.php' => 1, | |
'genericlibevent.php' => 1, | |
'flatten-0014-out.jsonld' => 1, | |
'mttdoctrinetoemberbundle.php' => 1, | |
'flatten-0015-in.jsonld' => 1, | |
'flatten-0025-in.jsonld' => 1, | |
'async.php' => 1, | |
'advanced_html_dom.php' => 1, | |
'monstrumsymfonycropboxbundle.php' => 1, | |
'flatten-0032-out.jsonld' => 1, | |
'flatten-0033-in.jsonld' => 1, | |
'flatten-0033-out.jsonld' => 1, | |
'.travis.dist.yml' => 1, | |
'bvtestbundle.php' => 1, | |
'flatten-0034-in.jsonld' => 1, | |
'flatten-0034-out.jsonld' => 1, | |
'monstrumsymfonyjcropbundle.php' => 1, | |
'monstrumsymfonydropzonebundle.php' => 1, | |
'flatten-0035-in.jsonld' => 1, | |
'flatten-0035-out.jsonld' => 1, | |
'autogrow.php' => 1, | |
'flatten-0036-in.jsonld' => 1, | |
'mechantsimplemailerbundle.php' => 1, | |
'flatten-0036-out.jsonld' => 1, | |
'flatten-0037-in.jsonld' => 1, | |
'envy.json' => 1, | |
'gentry' => 1, | |
'sinyamazonproductadvertisingapibundle.php' => 1, | |
'flatten-0037-out.jsonld' => 1, | |
'phpuri.php' => 1, | |
'pgbrowser.php' => 1, | |
'flatten-0038-in.jsonld' => 1, | |
'flatten-0032-in.jsonld' => 1, | |
'autogrowinput.php' => 1, | |
'amtelcomusersbundle.php' => 1, | |
'mops1kapibundle.php' => 1, | |
'flatten-0026-in.jsonld' => 1, | |
'flatten-0026-out.jsonld' => 1, | |
'flatten-0027-in.jsonld' => 1, | |
'mops1ktwbsbundle.php' => 1, | |
'flatten-0027-out.jsonld' => 1, | |
'jmdsettingsbundle.php' => 1, | |
'flatten-0028-in.jsonld' => 1, | |
'flatten-0028-out.jsonld' => 1, | |
'security.yml.dist' => 1, | |
'amtelcomloginbundle.php' => 1, | |
'flatten-0029-in.jsonld' => 1, | |
'flatten-0029-out.jsonld' => 1, | |
'flatten-0031-out.jsonld' => 1, | |
'apiservice.yml.dist' => 1, | |
'compact-0043-context.jsonld' => 1, | |
'flatten-0030-out.jsonld' => 1, | |
'jmdrestbundle.php' => 1, | |
'optimisticlockvalidator.php' => 1, | |
'flatten-0031-in.jsonld' => 1, | |
'slughelper.php' => 1, | |
'typeaheadplugin.php' => 1, | |
'datepickerplugin.php' => 1, | |
'basepicker.php' => 1, | |
'autogrowplugin.php' => 1, | |
'frame-0009-in.jsonld' => 1, | |
'frame-0009-out.jsonld' => 1, | |
'normalize-0004-out.nq' => 1, | |
'.phpmd-ruleset.xml' => 1, | |
'multibehavior.php' => 1, | |
'multiasset.php' => 1, | |
'addrowaction.php' => 1, | |
'pinba.png' => 1, | |
'ko-package' => 1, | |
'ko' => 1, | |
'misteiocloudinarybundle.php' => 1, | |
'fromrdf-0008-out.jsonld' => 1, | |
'fromrdf-0009-in.nq' => 1, | |
'fromrdf-0009-out.jsonld' => 1, | |
'bootstrap.netteforms.js' => 1, | |
'fromrdf-0008-in.nq' => 1, | |
'fromrdf-0010-in.nq' => 1, | |
'stylemanager.php' => 1, | |
'scriptmanager.php' => 1, | |
'fromrdf-0010-out.jsonld' => 1, | |
'fromrdf-0011-in.nq' => 1, | |
'istylemanager.php' => 1, | |
'iscriptmanager.php' => 1, | |
'@styles.latte' => 1, | |
'@scripts.latte' => 1, | |
'sheet.php' => 1, | |
'iextractor.php' => 1, | |
'jpark.komodoproject' => 1, | |
'amchart.php' => 1, | |
'fromrdf-0011-out.jsonld' => 1, | |
'example-cli-formats.php' => 1, | |
'fromrdf-0005-out.jsonld' => 1, | |
'fromrdf-0006-in.nq' => 1, | |
'alipaywapconfig.php' => 1, | |
'alipaywap.php' => 1, | |
'xlsxwriter.class.php' => 1, | |
'fromrdf-0006-out.jsonld' => 1, | |
'fromrdf-0007-in.nq' => 1, | |
'example-cli.php' => 1, | |
'example-cli-merge-cells.php' => 1, | |
'example-cli-load.php' => 1, | |
'filenamer.php' => 1, | |
'ammap.php' => 1, | |
'config_file_breadcrumbs.php' => 1, | |
'codesniffer_git_install.sh' => 1, | |
'loggerawaretrait.php' => 1, | |
'loggerawarebundle.php' => 1, | |
'hotfix.php' => 1, | |
'polymer.php' => 1, | |
'basepolymer.php' => 1, | |
'regionasset.php' => 1, | |
'leancloud.php' => 1, | |
'fromrdf-0007-out.jsonld' => 1, | |
'ammapasset.php' => 1, | |
'grouper.php' => 1, | |
'fromrdf-0012-in.nq' => 1, | |
'kdtclient.php' => 1, | |
'sg_ical.php' => 1, | |
'fromrdf-0020-in.nq' => 1, | |
'fromrdf-0020-out.jsonld' => 1, | |
'fromrdf-0021-in.nq' => 1, | |
'fromrdf-0021-out.jsonld' => 1, | |
'fromrdf-0022-in.nq' => 1, | |
'fromrdf-0022-out.jsonld' => 1, | |
'metaactiverecord.php' => 1, | |
'fromrdf-manifest.jsonld' => 1, | |
'doctrine_inflector.php' => 1, | |
'smartthink.php' => 1, | |
'normalize-0001-in.jsonld' => 1, | |
'fromrdf-0019-in.nq' => 1, | |
'normalize-0001-out.nq' => 1, | |
'normalize-0002-in.jsonld' => 1, | |
'normalize-0002-out.nq' => 1, | |
'phpjasperxmlsubreport.inc.php' => 1, | |
'phpjasperxml.inc.php' => 1, | |
'potter-orm.iml' => 1, | |
'minima-php.iml' => 1, | |
'normalize-0003-in.jsonld' => 1, | |
'normalize-0003-out.nq' => 1, | |
'normalize-0004-in.jsonld' => 1, | |
'recaptcha.png' => 1, | |
'fromrdf-0019-out.jsonld' => 1, | |
'fromrdf-0018-out.jsonld' => 1, | |
'misdravenbundle.php' => 1, | |
'md.sh' => 1, | |
'projectlightbundle.php' => 1, | |
'misdphonenumberbundle.php' => 1, | |
'fromrdf-0012-out.jsonld' => 1, | |
'fromrdf-0013-in.nq' => 1, | |
'misdmockravenservicebundle.php' => 1, | |
'misdlinkifybundle.php' => 1, | |
'fromrdf-0013-out.jsonld' => 1, | |
'misdhighchartsbundle.php' => 1, | |
'phpunit.vagrant.sh' => 1, | |
'autoloadtest.php' => 1, | |
'permissions' => 1, | |
'fromrdf-0018-in.nq' => 1, | |
'fromrdf-0014-in.nq' => 1, | |
'fromrdf-0014-out.jsonld' => 1, | |
'my.php' => 1, | |
'mmigration.php' => 1, | |
'threadunit' => 1, | |
'fromrdf-0015-in.nq' => 1, | |
'fromrdf-0015-out.jsonld' => 1, | |
'fromrdf-0016-in.nq' => 1, | |
'fromrdf-0016-out.jsonld' => 1, | |
'fromrdf-0017-in.nq' => 1, | |
'fromrdf-0017-out.jsonld' => 1, | |
'jsapi.php' => 1, | |
'fromrdf-0005-in.nq' => 1, | |
'frame-0010-frame.jsonld' => 1, | |
'mjmkrumobundle.php' => 1, | |
'frame-0014-out.jsonld' => 1, | |
'paging-demo.php' => 1, | |
'screen.gif' => 1, | |
'srfdatadogstatsdbundle.php' => 1, | |
'srfezlegacydebugbundle.php' => 1, | |
'srfcloudstackclientbundle.php' => 1, | |
'mysqlpdohelper.php' => 1, | |
'logginghelper.php' => 1, | |
'frame-0015-frame.jsonld' => 1, | |
'frame-0015-in.jsonld' => 1, | |
'dtcgridbundle.php' => 1, | |
'frame-0014-frame.jsonld' => 1, | |
'dependentbundleinterface.php' => 1, | |
'cachedbundledependenciesresolver.php' => 1, | |
'bundlestacknotcacheableexception.php' => 1, | |
'bundledependenciesresolver.php' => 1, | |
'httpheadersbundle.php' => 1, | |
'spotifyapibundle.php' => 1, | |
'rsqueueevents.php' => 1, | |
'rsqueuebundle.php' => 1, | |
'upgrade-3' => 1, | |
'formfillerbundle.php' => 1, | |
'frame-0015-out.jsonld' => 1, | |
'frame-0014-in.jsonld' => 1, | |
'frame-0013-out.jsonld' => 1, | |
'cacheflushevents.php' => 1, | |
'file-created-after-1.0.0-tagged-already' => 1, | |
'moderabackendgoogleanalyticsconfigbundle.php' => 1, | |
'frame-0010-in.jsonld' => 1, | |
'moderabackendgoogleanalyticsbundle.php' => 1, | |
'frame-0010-out.jsonld' => 1, | |
'moderabackenddashboardbundle.php' => 1, | |
'frame-0011-frame.jsonld' => 1, | |
'frame-0011-in.jsonld' => 1, | |
'moderabackendconfigutilsbundle.php' => 1, | |
'moderaactivityloggerbundle.php' => 1, | |
'frame-0011-out.jsonld' => 1, | |
'persistentpest.php' => 1, | |
'frame-0013-in.jsonld' => 1, | |
'frame-0012-frame.jsonld' => 1, | |
'example_form.html' => 1, | |
'example_balance.php' => 1, | |
'frame-0012-in.jsonld' => 1, | |
'mobilecarthwioauthbundle.php' => 1, | |
'frame-0012-out.jsonld' => 1, | |
'mobilecartelasticsearch17bundle.php' => 1, | |
'mobilecartcorebundle.php' => 1, | |
'frame-0013-frame.jsonld' => 1, | |
'mobilecartdummypaymentbundle.php' => 1, | |
'moactionjsonrpcbundle.php' => 1, | |
'controllerextrabundle.php' => 1, | |
'frame-0016-frame.jsonld' => 1, | |
'fromrdf-0004-out.jsonld' => 1, | |
'frame-0021-in.jsonld' => 1, | |
'frame-0019-out.jsonld' => 1, | |
'frame-0020-frame.jsonld' => 1, | |
'readme_pt-br' => 1, | |
'palantyr.php.zip' => 1, | |
'frame-0020-in.jsonld' => 1, | |
'completer.php' => 1, | |
'sc-bootstrap.php' => 1, | |
'frame-0020-out.jsonld' => 1, | |
'colorsystems.php' => 1, | |
'frame-0021-frame.jsonld' => 1, | |
'frame-0021-out.jsonld' => 1, | |
'analyze.xml' => 1, | |
'frame-manifest.jsonld' => 1, | |
'fromrdf-0001-in.nq' => 1, | |
'fromrdf-0001-out.jsonld' => 1, | |
'fromrdf-0002-in.nq' => 1, | |
'fromrdf-0002-out.jsonld' => 1, | |
'dataurlhandler.php' => 1, | |
'fromrdf-0003-in.nq' => 1, | |
'fromrdf-0003-out.jsonld' => 1, | |
'fromrdf-0004-in.nq' => 1, | |
'phplinq.php' => 1, | |
'missing_types.hhi' => 1, | |
'crane' => 1, | |
'composer-mini.xml' => 1, | |
'cacheflushbundle.php' => 1, | |
'mmanos-laravel' => 1, | |
'shim.php' => 1, | |
'screenshots' => 1, | |
'frame-0016-in.jsonld' => 1, | |
'licencia' => 1, | |
'textareatokensasset.php' => 1, | |
'textareatokens.php' => 1, | |
'frame-0016-out.jsonld' => 1, | |
'frame-0017-frame.jsonld' => 1, | |
'smartimagefieldasset.php' => 1, | |
'smartimagefield.php' => 1, | |
'imageuploadaction.php' => 1, | |
'ip-lib.php' => 1, | |
'frame-0019-in.jsonld' => 1, | |
'frame-0017-in.jsonld' => 1, | |
'frame-0017-out.jsonld' => 1, | |
'mloconsolebundle.php' => 1, | |
'frame-0018-frame.jsonld' => 1, | |
'validate-commit' => 1, | |
'frame-0018-in.jsonld' => 1, | |
'validate.xml' => 1, | |
'frame-0018-out.jsonld' => 1, | |
'frame-0019-frame.jsonld' => 1, | |
'symfony.xml' => 1, | |
'phpant.xml' => 1, | |
'expand-0038-in.jsonld' => 1, | |
'remainingcharacters.php' => 1, | |
'compact-0071-context.jsonld' => 1, | |
'adminbundle.php' => 1, | |
'build.sample.xml' => 1, | |
'floicon.php' => 1, | |
'jimicon.php' => 1, | |
'build_extensions.php' => 1, | |
'blob.php' => 1, | |
'baseconfighelper.php' => 1, | |
'config_sample.php' => 1, | |
'accountbundle.php' => 1, | |
'oidnuswalletbundle.php' => 1, | |
'oidnusadminthemebundle.php' => 1, | |
'ol.js' => 1, | |
'phpunit-test-checker.json' => 1, | |
'ol.css' => 1, | |
'bundlecontainer.php' => 1, | |
'ol-debug.js' => 1, | |
'.htmlhintrc' => 1, | |
'.html-minifier.conf' => 1, | |
'sample_print.png' => 1, | |
'dbawareinterface.php' => 1, | |
'dbawaretrait.php' => 1, | |
'filesystemawareinterface.php' => 1, | |
'filesystemawaretrait.php' => 1, | |
'phpunit-test-checker.php' => 1, | |
'homesteader' => 1, | |
'phonehelper.php' => 1, | |
'menuwidget.php' => 1, | |
'juliusrefererbundle.php' => 1, | |
'ocs_init.php' => 1, | |
'bootstrap.inc' => 1, | |
'migraine.yml.dist' => 1, | |
'fs.inc' => 1, | |
'alicephpmodule.php' => 1, | |
'frontendcontentbundle.php' => 1, | |
'sliderwidget.php' => 1, | |
'testconfig.php' => 1, | |
'callback-queue-example.php' => 1, | |
'levelwidget.php' => 1, | |
'cron.yaml' => 1, | |
'axismodule.php' => 1, | |
'clip' => 1, | |
'example.di.php' => 1, | |
'example.silex.php' => 1, | |
'okapondoctrinesettypebundle.php' => 1, | |
'sniff.sh' => 1, | |
'timeago.inc.php' => 1, | |
'openjournalsoftwarebibtexbundle.php' => 1, | |
'westsworld.datetime.class.php' => 1, | |
'queue.yaml' => 1, | |
'requestawareinterface.php' => 1, | |
'clear-cache-for-timber.php' => 1, | |
'juliusboilerplatebundle.php' => 1, | |
'cat.tpl' => 1, | |
'position.php' => 1, | |
'menu.json' => 1, | |
'run.php.default' => 1, | |
'xlsxreader.php' => 1, | |
'mark.tpl' => 1, | |
'find.tpl' => 1, | |
'filters.tpl' => 1, | |
'filters.layer.json' => 1, | |
'extend.tpl' => 1, | |
'catalog.layer.json' => 1, | |
'test_intset.php' => 1, | |
'position.tpl' => 1, | |
'schema.mysql.sql' => 1, | |
'ripcord_server.php' => 1, | |
'ripcord_client.php' => 1, | |
'ripcord.php' => 1, | |
'test_map_string_int.php' => 1, | |
'test_map_timeuuid_boolean.php' => 1, | |
'test_map_uuid_string.php' => 1, | |
'rabbit' => 1, | |
'odiseoprojectbundle.php' => 1, | |
'odiseobackendbundle.php' => 1, | |
'sample-nginx.conf' => 1, | |
'sample-apache.htaccess' => 1, | |
'ogiencodpwdcommandbundle.php' => 1, | |
'search.tpl' => 1, | |
'requestawaretrait.php' => 1, | |
'gshoppingcontent.php' => 1, | |
'deckard.yml.dist' => 1, | |
'routeawareinterface.php' => 1, | |
'routeawaretrait.php' => 1, | |
'deckard' => 1, | |
'httpapplication.php' => 1, | |
'objectmanagerawareinterface.php' => 1, | |
'stat.tpl' => 1, | |
'seo.json' => 1, | |
'rubrics.tpl' => 1, | |
'nousite.sh' => 1, | |
'objectmanagerawaretrait.php' => 1, | |
'rubrics.php' => 1, | |
'restfulbundle.php' => 1, | |
'producers.tpl' => 1, | |
'producers.schema.json' => 1, | |
'jit.php' => 1, | |
'jjanviercrowdinbundle.php' => 1, | |
'routes_cached.php' => 1, | |
'producers.php' => 1, | |
'ext.slow_page_logger.php' => 1, | |
'exemple.conf' => 1, | |
'juliusframeworkextrabundle.php' => 1, | |
'nokogiri.php' => 1, | |
'.nikki.yml' => 1, | |
'hybridauth.readme' => 1, | |
'treedropdownlist.php' => 1, | |
'drupalbase.routing.yml' => 1, | |
'treearrayhelper.php' => 1, | |
'listgroupwidget.php' => 1, | |
'drupalbase.services.yml' => 1, | |
'drupalbase.themehook.yml' => 1, | |
'listgroupasset.php' => 1, | |
'drupalbase.themesuggestions.yml' => 1, | |
'screenshotmachine.class.php' => 1, | |
'calculate' => 1, | |
'list_files.php' => 1, | |
'drupalbase.module' => 1, | |
'onceitraygunbundle.php' => 1, | |
'yz.php' => 1, | |
'vagrant.yaml.dist' => 1, | |
'admintinymceasset.php' => 1, | |
'skiprowexception.php' => 1, | |
'interruptimportexception.php' => 1, | |
'importform.php' => 1, | |
'phpstorm_reference_card.pdf' => 1, | |
'batchimportaction.php' => 1, | |
'validationform.php' => 1, | |
'treenamecolumn.php' => 1, | |
'drupalbase.info.yml' => 1, | |
'phpstorm_workshop.pptx' => 1, | |
'askme-compose.json' => 1, | |
'jessedevcartcomponentbundle.php' => 1, | |
'scheduler.sh.example' => 1, | |
'magicutils.php' => 1, | |
'magicutilstraits.php' => 1, | |
'ongair.php' => 1, | |
'manual.php' => 1, | |
'logrotate.sh' => 1, | |
'activator.php' => 1, | |
'.env.template' => 1, | |
'maigcutilstest.php' => 1, | |
'adiboxcachebundle.php' => 1, | |
'php_compat.php' => 1, | |
'classyfile' => 1, | |
'bencode.php' => 1, | |
'baseapibundle.php' => 1, | |
'servable.php' => 1, | |
'bencodetest.php' => 1, | |
'valiantasset.php' => 1, | |
'phonewidget.php' => 1, | |
'treeorderwidgetasset.php' => 1, | |
'jsontest.php' => 1, | |
'treeorderwidget.php' => 1, | |
'treeordermodeltrait.php' => 1, | |
'phpstorm_workshop.pdf' => 1, | |
'geobehavior.php' => 1, | |
'olarabbitmqadmintoolkitbundle.php' => 1, | |
'yona-cms.sql' => 1, | |
'ohcolorpickertypebundle.php' => 1, | |
'olix21calendarbundle.php' => 1, | |
'o80-i18n.iml' => 1, | |
'guerriatmetricsbundle.php' => 1, | |
'gmapbundle.php' => 1, | |
'headers-json.php' => 1, | |
'git-submodule.sh' => 1, | |
'm150929_122401_settings.php' => 1, | |
'settingscomponent.php' => 1, | |
'proplogic.class.php' => 1, | |
'thanks.php' => 1, | |
'ohemojibundle.php' => 1, | |
'proudfieldfacebookbundle.php' => 1, | |
'sample_loca.php' => 1, | |
'ostsensiobuzzprofilerbundle.php' => 1, | |
'osterrorbundle.php' => 1, | |
'report-sample.php' => 1, | |
'vhosthandler.php' => 1, | |
'permutation.sublime-project' => 1, | |
'permutation.sublime-workspace' => 1, | |
'jiabinholterbundle.php' => 1, | |
'vhostconfiguration.php' => 1, | |
'ohdateextravalidatorbundle.php' => 1, | |
'ohgooglemapformtypebundle.php' => 1, | |
'stam.yml' => 1, | |
'patterneventsprovider.php' => 1, | |
'jfdlformbundle.php' => 1, | |
'schedulecontroller.php' => 1, | |
'callbackevent.php' => 1, | |
'phonenumbervalidator.php' => 1, | |
'phonenumberbehavior.php' => 1, | |
'momentlanguageasset.php' => 1, | |
'manymanyrelationbehavior.php' => 1, | |
'filetrait.php' => 1, | |
'gmap.php' => 1, | |
'prefixmethodfinder.php' => 1, | |
'daterangepickerbootstrap3asset.php' => 1, | |
'berttimezonebundle.php' => 1, | |
'daterangepickerbootstrap2asset.php' => 1, | |
'icons.php' => 1, | |
'phpunit_travis.xml' => 1, | |
'create_test_reports.sh' => 1, | |
'tpuserbundle.php' => 1, | |
'taosistemasajaxgridbundle.php' => 1, | |
'gizmo.phar' => 1, | |
'gizmo' => 1, | |
'.jsbeautifyrc' => 1, | |
'faker' => 1, | |
'license-3rd-party' => 1, | |
'phpunit-notifications.sh' => 1, | |
'test_stringset.php' => 1, | |
'ongrconnectionsbundle.php' => 1, | |
'gearman_test_client.php' => 1, | |
'routing.json' => 1, | |
'amukanaplvalidatorbundle.php' => 1, | |
'nyrodevutilitybundle.php' => 1, | |
'ventureoaklabsfavicongeneratorbundle.php' => 1, | |
'nyrodevnyrocmsbundle.php' => 1, | |
'ventureoaklabswsdl2phpgeneratorclibundle.php' => 1, | |
'simplecache-htaccess' => 1, | |
'frontend-cache.php' => 1, | |
'caches.conf.sample.php' => 1, | |
'cache-main-auth.php' => 1, | |
'gearman_runner.php' => 1, | |
'minifyplugin.php' => 1, | |
'careerjet_api.php' => 1, | |
'datagridvector.php' => 1, | |
'crowdtilt.php' => 1, | |
'nvboosterphpcrassetsbundle.php' => 1, | |
'update_ruckusing_database.php' => 1, | |
'swiftmessageutils.php' => 1, | |
'banister.php' => 1, | |
'memcachedtool' => 1, | |
'heatmap.php' => 1, | |
'nuxiamailstoragebundle.php' => 1, | |
'docker-compose.env.dist' => 1, | |
'seomaticplugin.php' => 1, | |
'morgenstillevisualheatmapbundle.php' => 1, | |
'abstractparser.php' => 1, | |
'ivanvolkovsearchfilesbycontentbundle.php' => 1, | |
'jlmawsbundle.php' => 1, | |
'jlmserializerexpressionbundle.php' => 1, | |
'projectlint.yml' => 1, | |
'commandprocess.php' => 1, | |
'commandformatter.php' => 1, | |
'.package.tag' => 1, | |
'.package.split' => 1, | |
'soko.yml' => 1, | |
'httppersister.php' => 1, | |
'jmikolaautologinbundle.php' => 1, | |
'scaffolder' => 1, | |
'cqlclient.php' => 1, | |
'literals.php' => 1, | |
'cqlpersister.php' => 1, | |
'persister.php' => 1, | |
'jmikolainsecureroutesbundle.php' => 1, | |
'criteriaparser.php' => 1, | |
'jmikolajsassetshelperbundle.php' => 1, | |
'jmikolawildcardeventdispatcherbundle.php' => 1, | |
'mojosonatauibundle.php' => 1, | |
'doctrineormpersister.php' => 1, | |
'osmeasyrestbundle.php' => 1, | |
'parameterbaginterface.php' => 1, | |
'abstractcli.sublime-project' => 1, | |
'tpboot.php' => 1, | |
'embedgithub.php' => 1, | |
'factorysequence.php' => 1, | |
'factorygirl.php' => 1, | |
'extended-template-parts.php' => 1, | |
'photoswipe.css' => 1, | |
'extended-widgets.php' => 1, | |
'query-monitor.php' => 1, | |
'user-switching.php' => 1, | |
'mycal.ics' => 1, | |
'class.icalreader.php' => 1, | |
'captcha-login.php' => 1, | |
'talandewebb.php' => 1, | |
'extended-cpts.php' => 1, | |
'icons@2x.png' => 1, | |
'kml.class.php' => 1, | |
'icons.png' => 1, | |
'error.gif' => 1, | |
'kmlcircle.php' => 1, | |
'code.photoswipe.jquery-3.0.5.min.js' => 1, | |
'kmlcsv.jar' => 1, | |
'redbox-scan.php' => 1, | |
'help-me-help-you.php' => 1, | |
'hmhy.js' => 1, | |
'extended-taxos.php' => 1, | |
'googlenews.php' => 1, | |
'jogaramreactphpbundle.php' => 1, | |
'jsmysqlndbundle.php' => 1, | |
'push.php' => 1, | |
'nurolophersummernotebundle.php' => 1, | |
'nurikabestarratingbundle.php' => 1, | |
'twitterapiinterface.php' => 1, | |
'scytaledatabaseconfigurationbundle.php' => 1, | |
'autoloader.php~' => 1, | |
'memory::' => 1, | |
'arkoqueuemanagerbundle.php' => 1, | |
'queuemanagerinterface.php' => 1, | |
'test.html~' => 1, | |
'phpunit_travis_mysql.xml' => 1, | |
'android.class.php' => 1, | |
'wf.php' => 1, | |
'run_poste.sh' => 1, | |
'track.sh' => 1, | |
'test-one-file.sh' => 1, | |
'codeoasiscurlbundle.php' => 1, | |
'jbzfetchbundle.php' => 1, | |
'robots.php' => 1, | |
'x.bat' => 1, | |
'notification.class.php' => 1, | |
'ios.class.php' => 1, | |
'jbzimapbundle.php' => 1, | |
'l.php' => 1, | |
'yiidbhttptokensession.php' => 1, | |
'dbcon.php' => 1, | |
'cronqueue.php' => 1, | |
'jlbsadminbundle.php' => 1, | |
'jlbsadminfosuserbundle.php' => 1, | |
'tusk.json' => 1, | |
'mobiledemo.php' => 1, | |
'seleniumrcdemo.php' => 1, | |
'webdriverdemo.php' => 1, | |
'webdriverdemoshootout.php' => 1, | |
'webdriverfileuploaddemo.php' => 1, | |
'webdrivernologinlinkdemo.php' => 1, | |
'kirk.jpg' => 1, | |
'cronjob.php' => 1, | |
'jaitecclickbundle.php' => 1, | |
'cronconnector.php' => 1, | |
'sauce_api_test.php' => 1, | |
'jlmaskbundle.php' => 1, | |
'jlmbootstrapbundle.php' => 1, | |
'jlmcommercebundle.php' => 1, | |
'jlmcommerceevents.php' => 1, | |
'jlmcondominiumbundle.php' => 1, | |
'jlmcontactbundle.php' => 1, | |
'jlmcontractbundle.php' => 1, | |
'walkerinterface.php' => 1, | |
'jlasozimbrasoapapibundle.php' => 1, | |
'translationsapibundle.php' => 1, | |
'octavabranchingbundle.php' => 1, | |
'mpdfextended.php' => 1, | |
'odeskphystrixbundle.php' => 1, | |
'designbundle.php' => 1, | |
'qrreaderasset.php' => 1, | |
'comoempezar.pdf' => 1, | |
'qrreader.php' => 1, | |
'prueba.sql' => 1, | |
'dockerremote.php' => 1, | |
'profilinginstructions' => 1, | |
'measurement.ods' => 1, | |
'bracket.php' => 1, | |
'jlasojsoneditorbundle.php' => 1, | |
'sample.csv' => 1, | |
'jlasoapidocbundle.php' => 1, | |
'consoleargs.php' => 1, | |
'memorycache.php' => 1, | |
'halcyonserviceprovider.php' => 1, | |
'php-tools.php' => 1, | |
'sessionstoragebundle.php' => 1, | |
'jlasositemapbundle.php' => 1, | |
'commands.ini.dist' => 1, | |
'servers.ini.dist' => 1, | |
'config.ini.dis' => 1, | |
'csv2po.php' => 1, | |
'geggs.yml' => 1, | |
'jlmcontractevents.php' => 1, | |
'remainingcharactersasset.php' => 1, | |
'installtaotask.php' => 1, | |
'jlmmodelbundle.php' => 1, | |
'jlmmodelevents.php' => 1, | |
'jlmofficebundle.php' => 1, | |
'getfile.php' => 1, | |
'tools.xml' => 1, | |
'compilejscss.xml' => 1, | |
'taodbconfig.php' => 1, | |
'jlmproductbundle.php' => 1, | |
'taoconfig.php' => 1, | |
'restoredbtask.php' => 1, | |
'gitdifftask.php' => 1, | |
'composer.json_' => 1, | |
'generisconfig.php' => 1, | |
'createdbtask.php' => 1, | |
'jlmproductevents.php' => 1, | |
'backupdbtask.php' => 1, | |
'fdl-1.3' => 1, | |
'test2.json' => 1, | |
'jlmstatebundle.php' => 1, | |
'silk.log' => 1, | |
'jlmtransmitterbundle.php' => 1, | |
'jlmuserbundle.php' => 1, | |
'protobuf.php' => 1, | |
'composer.json__' => 1, | |
'octanteupsapibundle.php' => 1, | |
'httpauth-recipe.rb' => 1, | |
'jlmcorebundle.php' => 1, | |
'jlmdailybundle.php' => 1, | |
'octantenatsbundle.php' => 1, | |
'octantemarvelapibundle.php' => 1, | |
'jlmdailyevents.php' => 1, | |
'dockercomposebundle.php' => 1, | |
'parameters.dist.yml' => 1, | |
'opcache-recipe.rb' => 1, | |
'modman-recipe.rb' => 1, | |
'magento-recipe.rb' => 1, | |
'jlmdefaultbundle.php' => 1, | |
'logtailminutes.php' => 1, | |
'croogo-recipe.rb' => 1, | |
'composer-recipe.rb' => 1, | |
'cakephp2x-recipe.rb' => 1, | |
'cakephp1x-recipe.rb' => 1, | |
'backupdatabase-recipe.rb' => 1, | |
'apc-recipe.rb' => 1, | |
'obtaohtml2pdfbundle.php' => 1, | |
'jlmfeebundle.php' => 1, | |
'obtaoamazonwebservicesbundle.php' => 1, | |
'jlmfollowbundle.php' => 1, | |
'jlminstallationbundle.php' => 1, | |
'service.template' => 1, | |
'ongrcontentbundle.php' => 1, | |
'vandelay.php' => 1, | |
'mysql_wrapper.class.php' => 1, | |
'setflash.iml' => 1, | |
'crowi.php' => 1, | |
'puffer.sublime-project' => 1, | |
'puffer-logo.png' => 1, | |
'tests-api-token.txt.sample' => 1, | |
'osimek1articlesbundle.php' => 1, | |
'php.log' => 1, | |
'lastfmbundle.php' => 1, | |
'osbekrocommentsbundle.php' => 1, | |
'middlewares.php' => 1, | |
'upgrade-1.8.3' => 1, | |
'outlandishrestbundle.php' => 1, | |
'upgrade-1.10' => 1, | |
'ororequirejsbundle.php' => 1, | |
'orocrmmagentocontactusbundle.php' => 1, | |
'orokernel.php' => 1, | |
'orodistributionbundle.php' => 1, | |
'oroconfigbundle.php' => 1, | |
'cumulativeresourcemanager.php' => 1, | |
'cumulativeresourceinfo.php' => 1, | |
'cumulativeresource.php' => 1, | |
'ornjmarkdownbundle.php' => 1, | |
'example-report.php' => 1, | |
'outlandishroutemasterbundle.php' => 1, | |
'ornicarmessagebundle.php' => 1, | |
'evalnametoken.php' => 1, | |
'spellchecker' => 1, | |
'simple-ru' => 1, | |
'minimum-requirements.php' => 1, | |
'rat_exclude' => 1, | |
'overblogwsclientbundle.php' => 1, | |
'overblogthriftbundle.php' => 1, | |
'leafsimple.php' => 1, | |
'leafpre.php' => 1, | |
'jcrollfoursquareapibundle.php' => 1, | |
'leafparagraph.php' => 1, | |
'leafheading.php' => 1, | |
'overblogactivemqbundle.php' => 1, | |
'branchlistunordered.php' => 1, | |
'branchlistordered.php' => 1, | |
'itoken.php' => 1, | |
'branchlistitem.php' => 1, | |
'branchlist.php' => 1, | |
'nametoken.php' => 1, | |
'templategenerator.php' => 1, | |
'templatemanager.php' => 1, | |
'branch.php' => 1, | |
'overbloggraphqlbundle.php' => 1, | |
'overblogembedlybundle.php' => 1, | |
'ornjarchivebundle.php' => 1, | |
'orkestrawebservicebundle.php' => 1, | |
'simple-contact-forms.php' => 1, | |
'jdecoolmonologextrabundle.php' => 1, | |
'subvert.php' => 1, | |
'cachedecorator.php' => 1, | |
'jdecoolexceptionhelpbundle.php' => 1, | |
'cachablequeryserviceprovider.php' => 1, | |
'policy.php' => 1, | |
'authorizationserviceprovider.php' => 1, | |
'resourcemirrorfactory.php' => 1, | |
'resourcemirror.php' => 1, | |
'imageworkshopbundle.php' => 1, | |
'orbtstylemirrorbundle.php' => 1, | |
'orbtresourcemirrorbundle.php' => 1, | |
'hashidserviceprovider.php' => 1, | |
'covers-validator' => 1, | |
'jdecooltwigconstantaccessorbundle.php' => 1, | |
'opwocoforecastbundle.php' => 1, | |
'opwocoxeditablebundle.php' => 1, | |
'opwocobootstrapbundle.php' => 1, | |
'reactasset.php' => 1, | |
'jsxtransformerasset.php' => 1, | |
'jdecosterroutingextrabundle.php' => 1, | |
'shortify.php' => 1, | |
'cert.pem' => 1, | |
'formrequest.php' => 1, | |
'replacementmanager2.php' => 1, | |
'orkestratransactorbundle.php' => 1, | |
'abstractreport.php' => 1, | |
'reportinterface.php' => 1, | |
'reportfactory.php' => 1, | |
'presenterinterface.php' => 1, | |
'tokendef.php' => 1, | |
'tokentype.php' => 1, | |
'basecodehandler.php' => 1, | |
'basiccodepattern.php' => 1, | |
'codeformatter.php' => 1, | |
'presentation.php' => 1, | |
'orkestrareportbundle.php' => 1, | |
'codepattern.php' => 1, | |
'commandserviceprovider.php' => 1, | |
'orkestrapdfbundle.php' => 1, | |
'guzzle.php' => 1, | |
'orkestraapplicationbundle.php' => 1, | |
'bootils.php' => 1, | |
'delimitedcodepattern.php' => 1, | |
'replacementmanager.php' => 1, | |
'origammiblocksbundle.php' => 1, | |
'blockscontainer.php' => 1, | |
'fullcasset.php' => 1, | |
'fullcall.php' => 1, | |
'middlewareserviceprovider.php' => 1, | |
'validity.php' => 1, | |
'acf-page-builder.php' => 1, | |
'oauth2clientbundle.php' => 1, | |
'pagarme.php' => 1, | |
'jbsearchbundle.php' => 1, | |
'jbtagcloudbundle.php' => 1, | |
'corsslim.php' => 1, | |
'jbsimplepagebundle.php' => 1, | |
'send' => 1, | |
'response' => 1, | |
'civicrm.php' => 1, | |
'request' => 1, | |
'consoletarget.php' => 1, | |
'paggyboletobundle.php' => 1, | |
'gpgalleryasset.php' => 1, | |
'slimnocache.php' => 1, | |
'bigtype.html' => 1, | |
'gpgallery.php' => 1, | |
'bluesatellite.html' => 1, | |
'bootstrapped.html' => 1, | |
'elefant' => 1, | |
'abstractplace.php' => 1, | |
'workbench' => 1, | |
'inflicted.html' => 1, | |
'inflicted.png' => 1, | |
'refactor.php' => 1, | |
'jbdatenavigationbundle.php' => 1, | |
'angular' => 1, | |
'optionbag.php' => 1, | |
'pdo-debug.sql' => 1, | |
'cli_facebook.php' => 1, | |
'.gdbinit' => 1, | |
'edifactbundle.php' => 1, | |
'linksextractor.php' => 1, | |
'language' => 1, | |
'adapters' => 1, | |
'dynamicobject.php' => 1, | |
'dynamicobject' => 1, | |
'chequer.php' => 1, | |
'mydbvc.yaml' => 1, | |
'pdo-debug.php' => 1, | |
'angular.zip' => 1, | |
'jbfileuploaderbundle.php' => 1, | |
'startserver' => 1, | |
'gear.php' => 1, | |
'loaderexception.php' => 1, | |
'auto.php' => 1, | |
'jbphumborbundle.php' => 1, | |
'datenavigationgenerator.php' => 1, | |
'sqlinterface.php' => 1, | |
'datenavigationprovider.php' => 1, | |
'sqlabstract.php' => 1, | |
'cachedi.php' => 1, | |
'pablodipmodulebundle.php' => 1, | |
'pablodipadminmodulebundle.php' => 1, | |
'wufoohtmlwrapper.php' => 1, | |
'yepsuacommonsbundle.php' => 1, | |
'siteparser.php' => 1, | |
'sitelinks.php' => 1, | |
'check_minecraft.php' => 1, | |
'phpunit-travis.xml.dist' => 1, | |
'yepsuathemebundle.php' => 1, | |
'yepsuasmartwigbundle.php' => 1, | |
'unit_tests.xml' => 1, | |
'yepsuaradbundle.php' => 1, | |
'yepsuamenubundle.php' => 1, | |
'yepsuageneratorbundle.php' => 1, | |
'tutorial4' => 1, | |
'p1r0generatorbundle.php' => 1, | |
'tutorial3' => 1, | |
'tutorial2' => 1, | |
'savvycontactbundle.php' => 1, | |
'kengai.png' => 1, | |
'mediafactory.php' => 1, | |
'smiletrainingbundle.php' => 1, | |
'pre-commit.phpeach' => 1, | |
'phpeach.conf.dist' => 1, | |
'phpeach' => 1, | |
'build.ini.dist' => 1, | |
'integration_tests.xml' => 1, | |
'previewtheme.php' => 1, | |
'literati.html' => 1, | |
'phkapa.readme' => 1, | |
'elefant_icon.png' => 1, | |
'adminsession.php' => 1, | |
'montreal.html' => 1, | |
'quick-user-guide-phkondo-pt' => 1, | |
'quick-user-guide-phkondo-en' => 1, | |
'raleway.html' => 1, | |
'saasy.html' => 1, | |
'simplement.html' => 1, | |
'bright_squares.png' => 1, | |
'subtlesquared.html' => 1, | |
'urlify.php' => 1, | |
'isgdhelpers.php' => 1, | |
'installation_instructions' => 1, | |
'init.ph7' => 1, | |
'ph7.license' => 1, | |
'ph7.copyright' => 1, | |
'help_us' => 1, | |
'subdivx' => 1, | |
'washi.html' => 1, | |
'washi.png' => 1, | |
'changelog-0.2' => 1, | |
'uuidhelpers.php' => 1, | |
'readme ramsey uuid' => 1, | |
'ivalidator.php' => 1, | |
'userroles.php' => 1, | |
'ongrmagentoconnectorbundle.php' => 1, | |
'jseimagecropbundle.php' => 1, | |
'ui-multiselect-transfer.html' => 1, | |
'ui-multiselect-transfer.js' => 1, | |
'jerivecontainerexplorerbundle.php' => 1, | |
'security-exchanges.json' => 1, | |
'exchanges.json' => 1, | |
'algorithms.json' => 1, | |
'jerivefileprocessingbundle.php' => 1, | |
'jeriveworkflowbundle.php' => 1, | |
'jseamfbundle.php' => 1, | |
'jseemgeneratorbundle.php' => 1, | |
'kloutapibundle.php' => 1, | |
'demo.js' => 1, | |
'jseblockgeneratorbundle.php' => 1, | |
'todo.textile' => 1, | |
'as3-signals.as3proj' => 1, | |
'package-descriptions.xml' => 1, | |
'sdk.properties' => 1, | |
'openpay.php' => 1, | |
'sculpingistembedbundle.php' => 1, | |
'jeroendeslooveregeolocationbundle.php' => 1, | |
'jeroendeslooverevcardbundle.php' => 1, | |
'jvdhasseticcachebustingbundle.php' => 1, | |
'ticket_create_example.php' => 1, | |
'udf_query_example.php' => 1, | |
'twitterstrategy.php' => 1, | |
'openrootcronjobbundle.php' => 1, | |
'opensoftdoctrineadditionsbundle.php' => 1, | |
'log4php.dist.xml' => 1, | |
'add-site.php' => 1, | |
'openskyruntimeconfigbundle.php' => 1, | |
'crawl' => 1, | |
'asf-license-2.0' => 1, | |
'openroothttpcontextbundle.php' => 1, | |
'apache_license_v2' => 1, | |
'pdepend.xml' => 1, | |
'schedulermodule.php' => 1, | |
'openrootclientcontextbundle.php' => 1, | |
'exclude' => 1, | |
'jmabbundle.php' => 1, | |
'jmbalancedpaymentbundle.php' => 1, | |
'jmcrmbundle.php' => 1, | |
'demo.css' => 1, | |
'calculator.php' => 1, | |
'lss_version.php' => 1, | |
'openifyproductbundle.php' => 1, | |
'openifyjqgridbundle.php' => 1, | |
'openifycustomerbundle.php' => 1, | |
'openifyconfigurationbundle.php' => 1, | |
'openifyaws2bundle.php' => 1, | |
'sculpincontentgeneratorbundle.php' => 1, | |
'identifier_request.html' => 1, | |
'freeagentworkflowbundle.php' => 1, | |
'ongrrouterbundle.php' => 1, | |
'imagickext.php' => 1, | |
'onmotionasset.php' => 1, | |
'sendmail-wrapper.php' => 1, | |
'larareposerviceprovider.php' => 1, | |
'sendmail-throttle.php' => 1, | |
'prepend.php' => 1, | |
'onlimeexceptionreportbundle.php' => 1, | |
'quality.sh' => 1, | |
'ongrtranslationsbundle.php' => 1, | |
'ongrsettingsbundle.php' => 1, | |
'ongrmonitoringbundle.php' => 1, | |
'oodlekrumobundle.php' => 1, | |
'serializableinterface.php' => 1, | |
'ongrfiltermanagerbundle.php' => 1, | |
'ongrelasticsearchbundle.php' => 1, | |
'ongrcurrencyexchangebundle.php' => 1, | |
'ongrcookiesbundle.php' => 1, | |
'ongrapibundle.php' => 1, | |
'ongrtestingbundle.php' => 1, | |
'ongrtaskmessengerbundle.php' => 1, | |
'ongrpagerbundle.php' => 1, | |
'ongroxidconnectorbundle.php' => 1, | |
'onpubapi.php' => 1, | |
'canaltpscrumboarditbundle.php' => 1, | |
'cachebustingworker.php' => 1, | |
'baseexporter.php' => 1, | |
'serializedtype.php' => 1, | |
'unserializer.php' => 1, | |
'unserializerinterface.php' => 1, | |
'openidstrategy.php' => 1, | |
'livestrategy.php' => 1, | |
'jvdhtwigrelativecachekeybundle.php' => 1, | |
'linkedinstrategy.php' => 1, | |
'githubstrategy.php' => 1, | |
'debugserviceprovider.php' => 1, | |
'travis-ci.xml' => 1, | |
'wordpress-nav-menus-improved.php' => 1, | |
'jsonexporter.php' => 1, | |
'sharedcount.php' => 1, | |
'excelexporter.php' => 1, | |
'wp-svn.pl' => 1, | |
'oomph-plugin-notes.php' => 1, | |
'oomph-plugin-notes.js' => 1, | |
'google-places.php' => 1, | |
'google_oauth.routing.yml' => 1, | |
'google_oauth.links.menu.yml' => 1, | |
'google_oauth.info.yml' => 1, | |
'wp-forms-api.php' => 1, | |
'finally.jpg' => 1, | |
'opensofteplbundle.php' => 1, | |
'godaddy_wildwestdomainsapi.php' => 1, | |
'iuser.php' => 1, | |
'memcachedbridge.php' => 1, | |
'et_client.php' => 1, | |
'ievent.php' => 1, | |
'jdphpprojectanalyzerbundle.php' => 1, | |
'istatement.php' => 1, | |
'ppaindex.png' => 1, | |
'idriver.php' => 1, | |
'iconnection.php' => 1, | |
'statuscodes.php' => 1, | |
'codecoverage.php' => 1, | |
'redisbridge.php' => 1, | |
'wechatbundle.php' => 1, | |
'avrogeneratorbundle.php' => 1, | |
'icachebridge.php' => 1, | |
'coordinatesdistancebundle.php' => 1, | |
'filebridge.php' => 1, | |
'arraybridge.php' => 1, | |
'ilazybootstrapper.php' => 1, | |
'ibootstrapperregistry.php' => 1, | |
'openfirebundle.php' => 1, | |
'bootstrapperregistry.php' => 1, | |
'config.module.config.php' => 1, | |
'jira.dist.yml' => 1, | |
'token.json' => 1, | |
'invalidcsrftokenexception.php' => 1, | |
'iauthenticationcontext.php' => 1, | |
'invalidqueryexception.php' => 1, | |
'guestuser.php' => 1, | |
'avroblogbundle.php' => 1, | |
'avrocasebundle.php' => 1, | |
'isession.php' => 1, | |
'routeexception.php' => 1, | |
'avrocsvbundle.php' => 1, | |
'updatequery.php' => 1, | |
'avroimagebundle.php' => 1, | |
'avrolocationbundle.php' => 1, | |
'selectquery.php' => 1, | |
'insertquery.php' => 1, | |
'iocexception.php' => 1, | |
'avroratingbundle.php' => 1, | |
'avrostripebundle.php' => 1, | |
'deletequery.php' => 1, | |
'conditionalquerybuilder.php' => 1, | |
'augmentingquerybuilder.php' => 1, | |
'ipipeline.php' => 1, | |
'iunitofwork.php' => 1, | |
'ientityregistry.php' => 1, | |
'ientity.php' => 1, | |
'entitystates.php' => 1, | |
'entityregistry.php' => 1, | |
'applicationbinder.php' => 1, | |
'readme-php' => 1, | |
'apc.ini' => 1, | |
'ligneinstance.php' => 1, | |
'project.xml' => 1, | |
'todo_release' => 1, | |
'upgrade-to-2.0' => 1, | |
'doc-en' => 1, | |
'de_ch.csv' => 1, | |
'doc-fr' => 1, | |
'mindfireexpiryfieldbundle.php' => 1, | |
'thirdparty' => 1, | |
'cnx.php' => 1, | |
'dbrm.php' => 1, | |
'vue.php' => 1, | |
'developing' => 1, | |
'datas.php' => 1, | |
'groupe.php' => 1, | |
'jsonrpcclient.php' => 1, | |
'jsonrpcexception.php' => 1, | |
'minify-options.php.dist' => 1, | |
'opensoftsimpleserializerbundle.php' => 1, | |
'opensoftrolloutbundle.php' => 1, | |
'jsonrpcserver.php' => 1, | |
'optimus' => 1, | |
'custompoststatus.php' => 1, | |
'application.init.php' => 1, | |
'dzangocartbundle.php' => 1, | |
'autogen.sh' => 1, | |
'travis-ci.enc' => 1, | |
'entitytypes.php' => 1, | |
'1.travis.yml' => 1, | |
'jekaimagebundle.php' => 1, | |
'authenticationstatustypes.php' => 1, | |
'authenticationcontext.php' => 1, | |
'email_reader.php' => 1, | |
'email_parser.php' => 1, | |
'jekaqiwibundle.php' => 1, | |
'.jelix-scripts.ini' => 1, | |
'optilolapibundle.php' => 1, | |
'payment.sql' => 1, | |
'dzangocartsubscriptionbundle.php' => 1, | |
'inc_setup_form.php' => 1, | |
'inc_sample.php' => 1, | |
'inc_index.php' => 1, | |
'inc_add_form.php' => 1, | |
'inc_add_conf.php' => 1, | |
'colibri' => 1, | |
'test_services.json.dist' => 1, | |
'uamamazonsearchbundle.php' => 1, | |
'uamdatatablesbundle.php' => 1, | |
'uamawsecsbundle.php' => 1, | |
'uamawsbundle.php' => 1, | |
'verily.php' => 1, | |
'code.photoswipe.jquery-3.0.5.js' => 1, | |
'compact-0070-out.jsonld' => 1, | |
'mergerfactory.php' => 1, | |
'compact-0023-out.jsonld' => 1, | |
'ocipdolobstreamwrapper.php' => 1, | |
'ocipdoadapter.php' => 1, | |
'compact-0024-context.jsonld' => 1, | |
'compact-0024-in.jsonld' => 1, | |
'ocidbconnection.php' => 1, | |
'compact-0024-out.jsonld' => 1, | |
'transformerinterface.php' => 1, | |
'compact-0025-context.jsonld' => 1, | |
'compact-0025-in.jsonld' => 1, | |
'merger.php' => 1, | |
'ocipdostatementadapter.php' => 1, | |
'compact-0025-out.jsonld' => 1, | |
'compact-0026-context.jsonld' => 1, | |
'compact-0026-in.jsonld' => 1, | |
'compact-0026-out.jsonld' => 1, | |
'compact-0027-context.jsonld' => 1, | |
'compact-0027-in.jsonld' => 1, | |
'compact-0027-out.jsonld' => 1, | |
'compact-0028-context.jsonld' => 1, | |
'compact-0028-in.jsonld' => 1, | |
'compact-0028-out.jsonld' => 1, | |
'compact-0023-in.jsonld' => 1, | |
'string2stream.php' => 1, | |
'compact-0029-in.jsonld' => 1, | |
'correiosshipping.php' => 1, | |
'compact-0021-context.jsonld' => 1, | |
'compact-0021-in.jsonld' => 1, | |
'newscoopgoogleeventspluginbundle.php' => 1, | |
'nsmtwigextensionsbundle.php' => 1, | |
'compact-0021-out.jsonld' => 1, | |
'nsmemojibundle.php' => 1, | |
'compact-0022-context.jsonld' => 1, | |
'nsmdatetimebundle.php' => 1, | |
'jcrop.php' => 1, | |
'compact-0022-in.jsonld' => 1, | |
'compact-0022-out.jsonld' => 1, | |
'neutroncomponentbundle.php' => 1, | |
'd' => 1, | |
'phpunit.travis.xml.dist' => 1, | |
'compact-0023-context.jsonld' => 1, | |
'phpunit-hhvm.xml' => 1, | |
'hhvm.properties' => 1, | |
'coverage.db' => 1, | |
'webkitcontentblocker.php' => 1, | |
'easylistparser.php' => 1, | |
'.travis-generate-docs.sh' => 1, | |
'reademe.md' => 1, | |
'compact-0029-context.jsonld' => 1, | |
'compact-0029-out.jsonld' => 1, | |
'compact-0020-in.jsonld' => 1, | |
'compact-0037-in.jsonld' => 1, | |
'compact-0036-in.jsonld' => 1, | |
'selenium-server-standalone-2.46.0.jar' => 1, | |
'generate-api-docs.php' => 1, | |
'netvliesformbundle.php' => 1, | |
'netvliesbolopenapibundle.php' => 1, | |
'netvliesbasecampbundle.php' => 1, | |
'compact-0036-out.jsonld' => 1, | |
'compact-0037-context.jsonld' => 1, | |
'netvliesdoctrinebridgebundle.php' => 1, | |
'nettobrdwbundle.php' => 1, | |
'rsslib.php' => 1, | |
'compact-0035-out.jsonld' => 1, | |
'compact-0037-out.jsonld' => 1, | |
'compact-0038-context.jsonld' => 1, | |
'compact-0038-in.jsonld' => 1, | |
'compact-0038-out.jsonld' => 1, | |
'compact-0039-context.jsonld' => 1, | |
'compact-0039-in.jsonld' => 1, | |
'compact-0039-out.jsonld' => 1, | |
'compact-0040-context.jsonld' => 1, | |
'compact-0040-in.jsonld' => 1, | |
'compact-0040-out.jsonld' => 1, | |
'compact-0036-context.jsonld' => 1, | |
'selenium-server-standalone.jar' => 1, | |
'compact-0030-context.jsonld' => 1, | |
'js.jar' => 1, | |
'compact-0030-in.jsonld' => 1, | |
'compact-0030-out.jsonld' => 1, | |
'compact-0031-context.jsonld' => 1, | |
'compact-0031-in.jsonld' => 1, | |
'compact-0031-out.jsonld' => 1, | |
'compact-0032-context.jsonld' => 1, | |
'compact-0032-in.jsonld' => 1, | |
'fieldregistry.php' => 1, | |
'zepto.min.js' => 1, | |
'zepto.js' => 1, | |
'compact-0032-out.jsonld' => 1, | |
'compact-0035-in.jsonld' => 1, | |
'compact-0033-context.jsonld' => 1, | |
'compact-0033-in.jsonld' => 1, | |
'mysql-connector-java-5.1.26-bin.jar' => 1, | |
'compact-0033-out.jsonld' => 1, | |
'jslint.js' => 1, | |
'compact-0034-context.jsonld' => 1, | |
'compact-0034-in.jsonld' => 1, | |
'compact-0034-out.jsonld' => 1, | |
'compact-0035-context.jsonld' => 1, | |
'netzmacht.main.xml' => 1, | |
'simplexmlrpc.php' => 1, | |
'compact-0020-out.jsonld' => 1, | |
'newscoopinstagrampluginbundle.php' => 1, | |
'compact-0041-in.jsonld' => 1, | |
'compact-0012-in.jsonld' => 1, | |
'mongosession.php' => 1, | |
'resume.xml' => 1, | |
'custom-style.css' => 1, | |
'nickprocdnbundle.php' => 1, | |
'bootstrap.json' => 1, | |
'start-server.bat' => 1, | |
'start-server-visible.bat' => 1, | |
'propel.xml.dist' => 1, | |
'compact-0011-out.jsonld' => 1, | |
'compact-0012-context.jsonld' => 1, | |
'propel.xml' => 1, | |
'compact-0011-in.jsonld' => 1, | |
'propel-config.php' => 1, | |
'compact-0012-out.jsonld' => 1, | |
'compact-0013-context.jsonld' => 1, | |
'appbox' => 1, | |
'compact-0013-in.jsonld' => 1, | |
'compact-0013-out.jsonld' => 1, | |
'pinboard-archive' => 1, | |
'compact-0014-context.jsonld' => 1, | |
'compact-0014-in.jsonld' => 1, | |
'compact-0014-out.jsonld' => 1, | |
'nicokaagqueueingbundle.php' => 1, | |
'compact-0011-context.jsonld' => 1, | |
'compact-0015-in.jsonld' => 1, | |
'header_no_display.php' => 1, | |
'ndewezwebhomeauthapibundle.php' => 1, | |
'compact-0006-out.jsonld' => 1, | |
'compact-0007-context.jsonld' => 1, | |
'xh_types.php' => 1, | |
'xh_formalertemail.php' => 1, | |
'compact-0007-in.jsonld' => 1, | |
'compact-0007-out.jsonld' => 1, | |
'compact-0008-context.jsonld' => 1, | |
'compact-0008-in.jsonld' => 1, | |
'compact-0008-out.jsonld' => 1, | |
'footer_no_display.php' => 1, | |
'compact-0010-out.jsonld' => 1, | |
'bootup.shim.php' => 1, | |
'compact-0009-context.jsonld' => 1, | |
'postfix_log_bounces.sql' => 1, | |
'bootup.logger.php' => 1, | |
'form_helper.php' => 1, | |
'nbprestacmsthemestarterbundle.php' => 1, | |
'compact-0009-in.jsonld' => 1, | |
'compact-0009-out.jsonld' => 1, | |
'nbprestacmslinkbundle.php' => 1, | |
'compact-0010-context.jsonld' => 1, | |
'compact-0010-in.jsonld' => 1, | |
'compact-0015-context.jsonld' => 1, | |
'kellersoundexfrbundle.php' => 1, | |
'compact-0020-context.jsonld' => 1, | |
'newscooppaywallbundle.php' => 1, | |
'readme.md.ready' => 1, | |
'silkworm.php' => 1, | |
'readme[zh]' => 1, | |
'readme[jp]' => 1, | |
'newup' => 1, | |
'newup.php' => 1, | |
'newscoopprintissuemanagerbundle.php' => 1, | |
'newscoopsendfeedbackbundle.php' => 1, | |
'compact-0018-out.jsonld' => 1, | |
'newscooppublishingplatformspluginbundle.php' => 1, | |
'newscoopnewsletterpluginbundle.php' => 1, | |
'example_dns01.php' => 1, | |
'newscoopexamplepluginbundle.php' => 1, | |
'newscoopcommentlistsbundle.php' => 1, | |
'compact-0019-context.jsonld' => 1, | |
'newscoopcitizenreporterpluginbundle.php' => 1, | |
'compact-0019-in.jsonld' => 1, | |
'compact-0019-out.jsonld' => 1, | |
'newscooparticlescalendarbundle.php' => 1, | |
'newscooparticlerecommendationbundle.php' => 1, | |
'pluginsinstaller.php' => 1, | |
'newscoop-instagram-plugin-bundle-0.0.1.zip' => 1, | |
'compact-0018-in.jsonld' => 1, | |
'example_http01.php' => 1, | |
'convertrangemessage.php' => 1, | |
'lyst.php' => 1, | |
'salvapdfjsbundle.php' => 1, | |
'compact-0015-out.jsonld' => 1, | |
'pdfjs license' => 1, | |
'salvajshrinkbundle.php' => 1, | |
'serverip.php' => 1, | |
'compact-0016-context.jsonld' => 1, | |
'jssdk.php' => 1, | |
'compact-0016-in.jsonld' => 1, | |
'altoroutertest.php' => 1, | |
'lystinterface.php' => 1, | |
'immutablelyst.php' => 1, | |
'compact-0018-context.jsonld' => 1, | |
'entityproviderinterface.php' => 1, | |
'actor.php' => 1, | |
'compact-0016-out.jsonld' => 1, | |
'db-migrate.phar' => 1, | |
'compact-0017-context.jsonld' => 1, | |
'readmecomplete' => 1, | |
'minifw' => 1, | |
'compact-0017-in.jsonld' => 1, | |
'tritoqshippingbundle.php' => 1, | |
'tritoqmanagerboletobundle.php' => 1, | |
'compact-0017-out.jsonld' => 1, | |
'compact-0041-context.jsonld' => 1, | |
'compact-0041-out.jsonld' => 1, | |
'compact-0006-context.jsonld' => 1, | |
'compact-0062-out.jsonld' => 1, | |
'dbus.c' => 1, | |
'neogen.yml' => 1, | |
'neogen.cypher' => 1, | |
'graphenedb_info.yml' => 1, | |
'coding_rules.xml' => 1, | |
'phpunit.xml.dist ' => 1, | |
'cayetanosorianokarmacracybundle.php' => 1, | |
'cayetanosorianohashidsbundle.php' => 1, | |
'compact-0062-in.jsonld' => 1, | |
'cakefile' => 1, | |
'releasehelpers.sh' => 1, | |
'print.jpg' => 1, | |
'filterstabilityflags.php' => 1, | |
'composermanifestmerger.php' => 1, | |
'ioniconsbundle.php' => 1, | |
'docker-compose-local.yml' => 1, | |
'readme.es' => 1, | |
'compact-0063-context.jsonld' => 1, | |
'compact-0063-in.jsonld' => 1, | |
'compact-0063-out.jsonld' => 1, | |
'physalis.bat' => 1, | |
'install-sendtoafriend' => 1, | |
'introspect.c' => 1, | |
'introspect.h' => 1, | |
'eicaptcha.php' => 1, | |
'compact-0059-out.jsonld' => 1, | |
'compact-0057-out.jsonld' => 1, | |
'loghelperplugin.php' => 1, | |
'customlogviewerplugin.php' => 1, | |
'ner0ticfoursquarebundle.php' => 1, | |
'landmarxbundle.php' => 1, | |
'compact-0058-context.jsonld' => 1, | |
'compact-0058-in.jsonld' => 1, | |
'compact-0058-out.jsonld' => 1, | |
'compact-0059-context.jsonld' => 1, | |
'compact-0059-in.jsonld' => 1, | |
'ner0ticjqueryplusbundle.php' => 1, | |
'compact-0062-context.jsonld' => 1, | |
'ddnetfoursquarebundle.php' => 1, | |
'compact-0060-context.jsonld' => 1, | |
'compact-0060-in.jsonld' => 1, | |
'compact-0060-out.jsonld' => 1, | |
'compact-0061-context.jsonld' => 1, | |
'compact-0061-in.jsonld' => 1, | |
'filemessageimporter.php' => 1, | |
'compact-0061-out.jsonld' => 1, | |
'dbmessageimporter.php' => 1, | |
'basis.php' => 1, | |
'php_dbus.h' => 1, | |
'install-productcomments' => 1, | |
'compact-0064-context.jsonld' => 1, | |
'compact-0057-in.jsonld' => 1, | |
'nejotwigextensionsbundle.php' => 1, | |
'compact-0068-out.jsonld' => 1, | |
'compact-0069-context.jsonld' => 1, | |
'ismscprovider.php' => 1, | |
'esmscprovider.php' => 1, | |
'esmscexception.php' => 1, | |
'compact-0069-in.jsonld' => 1, | |
'compact-0069-out.jsonld' => 1, | |
'compact-0070-context.jsonld' => 1, | |
'esmsc.php' => 1, | |
'econsolecommand.php' => 1, | |
'.coach.log' => 1, | |
'compact-0068-context.jsonld' => 1, | |
'.coach.dist.json' => 1, | |
'phraseappdescription.json' => 1, | |
'phraseappbundle.php' => 1, | |
'nuditydetector.php' => 1, | |
'compact-0070-in.jsonld' => 1, | |
'codeception.yml.erb' => 1, | |
'_set-codeception-group-args.sh' => 1, | |
'_before-test.sh' => 1, | |
'web-start.sh.erb' => 1, | |
'web-config.sh.erb' => 1, | |
'compact-0068-in.jsonld' => 1, | |
'compact-0067-out.jsonld' => 1, | |
'compact-0064-in.jsonld' => 1, | |
'logs.php' => 1, | |
'compact-0064-out.jsonld' => 1, | |
'eicaptcha-ajax.php' => 1, | |
'compact-0065-context.jsonld' => 1, | |
'twitter-essentials.php.dist' => 1, | |
'select2jsbundle.php' => 1, | |
'compact-0065-in.jsonld' => 1, | |
'foundationbundle.php' => 1, | |
'fontawesomebundle.php' => 1, | |
'compact-0065-out.jsonld' => 1, | |
'd3jsbundle.php' => 1, | |
'compact-0066-context.jsonld' => 1, | |
'nelmiocorsbundle.php' => 1, | |
'compact-0066-in.jsonld' => 1, | |
'activities.php' => 1, | |
'votes.php' => 1, | |
'fetch.php' => 1, | |
'apigen.yml.obsolete' => 1, | |
'reactserversiderendererbundle.php' => 1, | |
'compact-0066-out.jsonld' => 1, | |
'compact-0067-context.jsonld' => 1, | |
'compact-0067-in.jsonld' => 1, | |
'nelmiojsloggerbundle.php' => 1, | |
'nelmioesidebugbundle.php' => 1, | |
'schematic_amnavplugin.php' => 1, | |
'bild' => 1, | |
'imageedit.php' => 1, | |
'onescript.json' => 1, | |
'netinfluencesecuredisplaybundle.php' => 1, | |
'netinfluenceuploadbundle.php' => 1, | |
'compact-0046-context.jsonld' => 1, | |
'compact-0046-in.jsonld' => 1, | |
'compact-0046-out.jsonld' => 1, | |
'compact-0047-context.jsonld' => 1, | |
'compact-0047-in.jsonld' => 1, | |
'compact-0047-out.jsonld' => 1, | |
'compact-0048-context.jsonld' => 1, | |
'compact-0048-in.jsonld' => 1, | |
'netgustoparametertouchbundle.php' => 1, | |
'authorizerbehavior.php' => 1, | |
'netgustohmvcbundle.php' => 1, | |
'netgustodynamicsubdomainbundle.php' => 1, | |
'netgustodistributionbundle.php' => 1, | |
'netgustodeviationbundle.php' => 1, | |
'compact-0048-out.jsonld' => 1, | |
'netgustodevserverbundle.php' => 1, | |
'netgustobootcampbundle.php' => 1, | |
'netgustoautoroutebundle.php' => 1, | |
'compact-0049-context.jsonld' => 1, | |
'baikalwellknownbundle.php' => 1, | |
'authmanagertrait.php' => 1, | |
'authorizerquerybehavior.php' => 1, | |
'baikalmodelbundle.php' => 1, | |
'compact-0044-context.jsonld' => 1, | |
'imageclass.php' => 1, | |
'compact-0042-context.jsonld' => 1, | |
'imageadd_form.php' => 1, | |
'compact-0042-in.jsonld' => 1, | |
'compact-0042-out.jsonld' => 1, | |
'tordf-0028-out.nq' => 1, | |
'compact-0043-in.jsonld' => 1, | |
'compact-0043-out.jsonld' => 1, | |
'imageadd.php' => 1, | |
'comment_form.php' => 1, | |
'nmnmultiuserbundle.php' => 1, | |
'compact-0045-out.jsonld' => 1, | |
'compact-0044-in.jsonld' => 1, | |
'compact-0044-out.jsonld' => 1, | |
'netlabssmsgatewaybundle.php' => 1, | |
'netlabsadminextensionsbundle.php' => 1, | |
'safenet.php' => 1, | |
'safenet.c' => 1, | |
'php_safenet.h' => 1, | |
'compact-0045-context.jsonld' => 1, | |
'compact-0045-in.jsonld' => 1, | |
'traceableauthmanager.php' => 1, | |
'relationsrule.php' => 1, | |
'compact-0049-in.jsonld' => 1, | |
'compact-0049-out.jsonld' => 1, | |
'compact-0057-context.jsonld' => 1, | |
'compact-0053-in.jsonld' => 1, | |
'apiregistercontroller.php' => 1, | |
'sidebar' => 1, | |
'maisum' => 1, | |
'compact-0052-out.jsonld' => 1, | |
'johann' => 1, | |
'netdudesjstreebundle.php' => 1, | |
'netdudesdatasourcerybundle.php' => 1, | |
'compact-0053-context.jsonld' => 1, | |
'netboxdashboardbundle.php' => 1, | |
'app.groovy' => 1, | |
'compact-0053-out.jsonld' => 1, | |
'exceptionattributes.php' => 1, | |
'compact-0054-context.jsonld' => 1, | |
'compact-0054-in.jsonld' => 1, | |
'compact-0054-out.jsonld' => 1, | |
'compact-0055-context.jsonld' => 1, | |
'compact-0055-in.jsonld' => 1, | |
'compact-0055-out.jsonld' => 1, | |
'namecheap' => 1, | |
'compact-0056-context.jsonld' => 1, | |
'compact-0056-in.jsonld' => 1, | |
'compact-0056-out.jsonld' => 1, | |
'ioserviceprovider.php' => 1, | |
'compact-0052-in.jsonld' => 1, | |
'baikalkernelbundle.php' => 1, | |
'tagsserviceawaretrait.php' => 1, | |
'compact-0050-context.jsonld' => 1, | |
'compact-0050-in.jsonld' => 1, | |
'compact-0050-out.jsonld' => 1, | |
'compact-0051-context.jsonld' => 1, | |
'compact-0051-in.jsonld' => 1, | |
'compact-0051-out.jsonld' => 1, | |
'baikaldavservicesbundle.php' => 1, | |
'netgensearchandfilterbundle.php' => 1, | |
'ezpublish_readme' => 1, | |
'ezpublish_install' => 1, | |
'tagsserviceawareinterface.php' => 1, | |
'num.php' => 1, | |
'netgentagsbundle.php' => 1, | |
'netgenopengraphbundle.php' => 1, | |
'netgenezsyliusbundle.php' => 1, | |
'netgenezformsbundle.php' => 1, | |
'netgenenhancedselectionbundle.php' => 1, | |
'netgencontenttypelistbundle.php' => 1, | |
'netgenbirthdaybundle.php' => 1, | |
'compact-0052-context.jsonld' => 1, | |
'netgenhybridapproachbundle.php' => 1, | |
'netgenhtmlpdfapibundle.php' => 1, | |
'htmlpdfapi.php' => 1, | |
'compact-0006-in.jsonld' => 1, | |
'compact-0005-out.jsonld' => 1, | |
'wp-fos-export.php' => 1, | |
'job' => 1, | |
'packager.xml' => 1, | |
'docman.php' => 1, | |
'form_validator_props.php' => 1, | |
'form_admin.css' => 1, | |
'fileman_admin.css' => 1, | |
'fileman.php' => 1, | |
'docman.xml' => 1, | |
'install.script.php' => 1, | |
'web' => 1, | |
'bitapp.yml.dist' => 1, | |
'peclcmd.php' => 1, | |
'legacy.xml.dist' => 1, | |
'pkg_catcher.xml' => 1, | |
'pkg_categories.xml' => 1, | |
'pearcmd.php' => 1, | |
'mdb2.php' => 1, | |
'nomayasocialbundle.php' => 1, | |
'nosectionsconfigparserinterface.php' => 1, | |
'nosectionsconfigparser.php' => 1, | |
'configparserinterface.php' => 1, | |
'configparser.php' => 1, | |
'baseconfigparser.php' => 1, | |
'packager.test.xml' => 1, | |
'iblock.php' => 1, | |
'noiselabscountrybundle.php' => 1, | |
'server_off.html' => 1, | |
'vote_tools.php' => 1, | |
'vote_admin.css' => 1, | |
'keepvoting.php' => 1, | |
'translate_tools.php' => 1, | |
'herokutarget.php' => 1, | |
'.env.enc' => 1, | |
'jonlilckfinderbundle.php' => 1, | |
'.scss-lint.yml' => 1, | |
'translate_admin.css' => 1, | |
'options_user_settings_1.php' => 1, | |
'spread.php' => 1, | |
'wp-sane-setup.php' => 1, | |
'save_colors.php' => 1, | |
'option_triggers.php' => 1, | |
'jscore.php' => 1, | |
'filter_tools.php' => 1, | |
'coding_guidelines' => 1, | |
'test-requirements' => 1, | |
'checklist_structure.php' => 1, | |
'bx_root.php' => 1, | |
'ajax_tools.php' => 1, | |
'.director.yml' => 1, | |
'director' => 1, | |
'noiselabsnusoapbundle.php' => 1, | |
'countrymanager.php' => 1, | |
'edgarezcdnbundle.php' => 1, | |
'useragentobject.php' => 1, | |
'kunena.php' => 1, | |
'kunena.xml' => 1, | |
'nnmerutilsbundle.php' => 1, | |
'nnmerpushnotificationbundle.php' => 1, | |
'doorman.php' => 1, | |
'rephpd.sh' => 1, | |
'makefile.ini' => 1, | |
'useragentparser.php' => 1, | |
'remository.php' => 1, | |
'remository.xml' => 1, | |
'bootstrappbundle.php' => 1, | |
'sdl' => 1, | |
'default_transcoder.php' => 1, | |
'connstr.php' => 1, | |
'couchbaseviewquery.class.php' => 1, | |
'zoo.xml' => 1, | |
'couchbasen1qlquery.class.php' => 1, | |
'couchbaseclustermanager.class.php' => 1, | |
'jordillonchcrudgeneratorbundle.php' => 1, | |
'jordillonchdeploybundle.php' => 1, | |
'couchbasecluster.class.php' => 1, | |
'couchbasebucketmanager.class.php' => 1, | |
'readme-0.1.x' => 1, | |
'komento.xml' => 1, | |
'readme-pixiv' => 1, | |
'nodrewembedlybundle.php' => 1, | |
'readme-aozora' => 1, | |
'easydiscuss.php' => 1, | |
'easydiscuss.xml' => 1, | |
'bootstrap.phpunit.php' => 1, | |
'noetixtractionbundle.php' => 1, | |
'parameters.ini.dist' => 1, | |
'simpleorm.class.php' => 1, | |
'nodrewexceptionalbundle.php' => 1, | |
'jevents.php' => 1, | |
'jevents.xml' => 1, | |
'marvin' => 1, | |
'wm.api' => 1, | |
'k2.php' => 1, | |
'traits.twig' => 1, | |
'namespaces.twig' => 1, | |
'k2.xml' => 1, | |
'namespace.twig' => 1, | |
'interfaces.twig' => 1, | |
'doc-index.twig' => 1, | |
'classes.twig' => 1, | |
'komento.php' => 1, | |
'class.twig' => 1, | |
'phormat' => 1, | |
'template.json.dist' => 1, | |
'edgarezqrcodebundle.php' => 1, | |
'wtfcartbundle.php' => 1, | |
'noylecorpdoctrineextrasbundle.php' => 1, | |
'travisci-install.sh' => 1, | |
'phpiredis.ini' => 1, | |
'jomi' => 1, | |
'jomi.php' => 1, | |
'googleauthenticatorbundle.php' => 1, | |
'.config.env.sample' => 1, | |
'.config.env' => 1, | |
'php5-image.png' => 1, | |
'ajaxyasset.php' => 1, | |
'ajaxy.php' => 1, | |
'sunrise.php' => 1, | |
'nescartbundle.php' => 1, | |
'novuso-wp-common.php' => 1, | |
'novuscomcmfuserbundle.php' => 1, | |
'numeratormasker.php' => 1, | |
'numerator.php' => 1, | |
'flex_config.php' => 1, | |
'templatetrait.php' => 1, | |
'flexiblegrid.php' => 1, | |
'flexibleform.php' => 1, | |
'collapsablefield.php' => 1, | |
'phpqrcodebundle.php' => 1, | |
'servicesadminbundle.php' => 1, | |
'multiactiverecord.php' => 1, | |
'novawayfilemanagementbundle.php' => 1, | |
'mediaelementasset.php' => 1, | |
'wp-fos-import.php' => 1, | |
'options-admin.php' => 1, | |
'code.photoswipe-3.0.5.min.js' => 1, | |
'code.photoswipe-3.0.5.js' => 1, | |
'intercom.php' => 1, | |
'nutoolboxfoundationbundle.php' => 1, | |
'wyf_bootstrap.php' => 1, | |
'nthrootenhancedimagebundle.php' => 1, | |
'xzjg.xml' => 1, | |
'chartsredactorpluginasset.php' => 1, | |
'options-user.php' => 1, | |
'info.plist' => 1, | |
'shibboleth-mu.php' => 1, | |
'mediaelement.php' => 1, | |
'apachetikabundle.php' => 1, | |
'ntscorecalculatorbundle.php' => 1, | |
'gifexceptionbundle.php' => 1, | |
'jscrollpanewidget.php' => 1, | |
'intllessslugbehavior.php' => 1, | |
'nscpsformbundle.php' => 1, | |
'jolitypobundle.php' => 1, | |
'nscpsbrazilformbundle.php' => 1, | |
'kocart.sql' => 1, | |
'novawayopengraphbundle.php' => 1, | |
'nova' => 1, | |
'logger-example.php' => 1, | |
'jsoner.php' => 1, | |
'construct' => 1, | |
'balloufactory.php' => 1, | |
'project.sublime-workspace' => 1, | |
'jgibillogrambundle.php' => 1, | |
'project.sublime-project' => 1, | |
'sentrytarget.php' => 1, | |
'jgideadmanssnitchbundle.php' => 1, | |
'jgiswedishdatesbundle.php' => 1, | |
'agents-list.png' => 1, | |
'norzechowiczaceeditorbundle.php' => 1, | |
'jsoner.i18n.magic.php' => 1, | |
'campfirefactory.php' => 1, | |
'jsoner.hooks.php' => 1, | |
'noregressiontestbundle.php' => 1, | |
'nsactiverecord.php' => 1, | |
'airplane-mode.php' => 1, | |
'uploadform.php' => 1, | |
'pipes.php' => 1, | |
'pkg_todo.xml' => 1, | |
'basicauth.xml' => 1, | |
'basicauth.php' => 1, | |
'mysqli_etc.php' => 1, | |
'ballougateway.php' => 1, | |
'campfiregateway.php' => 1, | |
'yogateway.php' => 1, | |
'twiliofactory.php' => 1, | |
'registry-bundle.iml' => 1, | |
'tcpdfbundle.php' => 1, | |
'acf_pages_by_template.php' => 1, | |
'acf_pages_by_template_v4.php' => 1, | |
'acf_pages_by_template_v5.php' => 1, | |
'yofactory.php' => 1, | |
'jbibrowscapbundle.php' => 1, | |
'webhookgateway.php' => 1, | |
'webhookfactory.php' => 1, | |
'twiliogateway.php' => 1, | |
'slackgateway.php' => 1, | |
'notifymefactory.php' => 1, | |
'slackfactory.php' => 1, | |
'pushovergateway.php' => 1, | |
'pushoverfactory.php' => 1, | |
'pagerdutygateway.php' => 1, | |
'pagerdutyfactory.php' => 1, | |
'notifymemanager.php' => 1, | |
'gatewaytrait.php' => 1, | |
'hipchatgateway.php' => 1, | |
'hipchatfactory.php' => 1, | |
'gittergateway.php' => 1, | |
'gitterfactory.php' => 1, | |
'hyperion' => 1, | |
'couchbasebucket.class.php' => 1, | |
'compact-0005-in.jsonld' => 1, | |
'admin.settings.load.php' => 1, | |
'constants.inc.php' => 1, | |
'favico.ico' => 1, | |
'duo.load.php' => 1, | |
'apache-default.conf' => 1, | |
'modifiers.inc.php' => 1, | |
'tdnpilotbundle.php' => 1, | |
'admin.settings_duo.php' => 1, | |
'admin.settings_categories.php' => 1, | |
'admin.settings_api.php' => 1, | |
'admin.settings.php' => 1, | |
'csvexport.php' => 1, | |
'jrkdynamicpopupbundle.php' => 1, | |
'php_todo_finder.yml.sample' => 1, | |
'php_forbidden_function.yml.sample' => 1, | |
'php_forbidden_function.yml' => 1, | |
'sphinx.conf' => 1, | |
'mahana.sql' => 1, | |
'movies.sql' => 1, | |
'westest.php' => 1, | |
'mahana_address.php' => 1, | |
'after_build.sh' => 1, | |
'myfile' => 1, | |
'jrklevenshteinbundle.php' => 1, | |
'jrkadminatombundle.php' => 1, | |
'tests_config.sample' => 1, | |
'joypasswd.php' => 1, | |
'transit.php' => 1, | |
'kb.load.php' => 1, | |
'jotform.php' => 1, | |
'status.log' => 1, | |
'amazons3.php' => 1, | |
'items.php' => 1, | |
'items.offline.php' => 1, | |
'items.load.php' => 1, | |
'items.import.php' => 1, | |
'items.export.php' => 1, | |
'home.load.php' => 1, | |
'jrkpaymentsipsbundle.php' => 1, | |
'folders.php' => 1, | |
'mogreet.php' => 1, | |
'exploringfileutilitybundle.php' => 1, | |
'exploringstatusbundle.php' => 1, | |
'jpierrontapibatchbundle.php' => 1, | |
'changelog-0.0.0' => 1, | |
'hclabsmodelmanagerbundle.php' => 1, | |
'folders.load.php' => 1, | |
'jrkeasypaginationbundle.php' => 1, | |
'jrkfoobundle.php' => 1, | |
'find.load.php' => 1, | |
'nazkaaccesstokensecuritybundle.php' => 1, | |
'example.tpl' => 1, | |
'kb.php' => 1, | |
'satisbundle.php' => 1, | |
'install_mecab_php-mecab.sh' => 1, | |
'nighonweixinevents.php' => 1, | |
'nighonweixinbundle.php' => 1, | |
'nietonfirraygunbundle.php' => 1, | |
'compact-0002-in.jsonld' => 1, | |
'compact-0002-out.jsonld' => 1, | |
'compact-0003-context.jsonld' => 1, | |
'nietonfirgooglerecaptchabundle.php' => 1, | |
'googlerecaptcha.sublime-project' => 1, | |
'icebreadcrumbsbundle.php' => 1, | |
'nkuserbundle.php' => 1, | |
'compact-0001-out.jsonld' => 1, | |
'nkadminbundle.php' => 1, | |
'compact-0003-in.jsonld' => 1, | |
'compact-0003-out.jsonld' => 1, | |
'nicotecdoctrineautobundle.php' => 1, | |
'nmureencryptorbundle.php' => 1, | |
'ndewezwebhomecalendarapibundle.php' => 1, | |
'compact-0004-context.jsonld' => 1, | |
'compact-0004-in.jsonld' => 1, | |
'compact-0004-out.jsonld' => 1, | |
'compact-0005-context.jsonld' => 1, | |
'compact-0002-context.jsonld' => 1, | |
'compact-0001-in.jsonld' => 1, | |
'div.php' => 1, | |
'nazkaobjectmanagerbundle.php' => 1, | |
'div.html' => 1, | |
'dissalowed.php' => 1, | |
'dissalowedwomensnameslist_el_gr' => 1, | |
'dissalowedusernameslist' => 1, | |
'dissalowedpornsiteslist' => 1, | |
'dissalowedmannameslist_el_gr' => 1, | |
'nazkaattachmentbundle.php' => 1, | |
'dissalowedbadwordslist_en_us' => 1, | |
'dissalowedbadwordslist_el_gr' => 1, | |
'nazkalocationbundle.php' => 1, | |
'fastroute.hhi' => 1, | |
'compact-0001-context.jsonld' => 1, | |
'nazkapayablebundle.php' => 1, | |
'lazyloader.php' => 1, | |
'o.php' => 1, | |
'.csscomb.json' => 1, | |
'gitlab-ci.yml' => 1, | |
'md-ruleset.xml' => 1, | |
'travis-php-mecab.sh' => 1, | |
'xdebughelper.php' => 1, | |
'xdebug-helper.tab.phtml' => 1, | |
'oocurl.php' => 1, | |
'limelight_console' => 1, | |
'scandb.php' => 1, | |
'otv.php' => 1, | |
'migration.tpl' => 1, | |
'build.watchdog.xml' => 1, | |
'amazonproductlink.php' => 1, | |
'amazonconfig.php' => 1, | |
'dtpspybundle.php' => 1, | |
'colourpicker.png' => 1, | |
'usrmodule.php' => 1, | |
'nfymodule.php' => 1, | |
'build.download.xml' => 1, | |
'exportaction.php' => 1, | |
'eactivefinder.php' => 1, | |
'build.maintenance.xml' => 1, | |
'clay.php' => 1, | |
'iptoamazon.data' => 1, | |
'fhpostcodeapinubundle.php' => 1, | |
'elinkcolumn.php' => 1, | |
'egridcolumn.php' => 1, | |
'eeditablecolumn.php' => 1, | |
'joschi127doctrineentityoverridebundle.php' => 1, | |
'edatatables.php' => 1, | |
'phptimer.php' => 1, | |
'scrapermorefaster.php' => 1, | |
'smf_tester.php' => 1, | |
'edatacolumn.php' => 1, | |
'amazonstatic.php' => 1, | |
'iframeresizer.php' => 1, | |
'edtpagination.php' => 1, | |
'phplint' => 1, | |
'mogilefs.php' => 1, | |
'linkpagesizer.php' => 1, | |
'userinfointerface.php' => 1, | |
'consoleerrorhandler.php' => 1, | |
'localeconverter.php' => 1, | |
'yiiwhoopsinspector.php' => 1, | |
'behat.example.yml' => 1, | |
'dbsteward.php' => 1, | |
'vhost.conf' => 1, | |
'.config.properties' => 1, | |
'phpspecgen.php' => 1, | |
'iframeresizerasset.php' => 1, | |
'doap.php' => 1, | |
'sass.php' => 1, | |
'less.php' => 1, | |
'nixillaapiloggerbundle.php' => 1, | |
'mailrustrategy.php' => 1, | |
'nwlog.php' => 1, | |
'nwfileoperations.php' => 1, | |
'nwdatabase.php' => 1, | |
'nitrathemebundle.php' => 1, | |
'prettyphotoasset.php' => 1, | |
'prettyphoto.php' => 1, | |
'edtsort.php' => 1, | |
'echeckboxcolumn.php' => 1, | |
'createtables.sql' => 1, | |
'minion.example.yml' => 1, | |
'adminserviceprovider.php' => 1, | |
'twbs3serviceprovider.php' => 1, | |
'twbs3jumbonarrowserviceprovider.php' => 1, | |
'seed.csv' => 1, | |
'docs.pdf' => 1, | |
'adminlteserviceprovider.php' => 1, | |
'snapshot.php' => 1, | |
'notifyasset.php' => 1, | |
'bugtracker.php' => 1, | |
'ryzom_extra.php' => 1, | |
'runit.php' => 1, | |
'packagelist.php' => 1, | |
'views_logs.php' => 1, | |
'views_logs.load.php' => 1, | |
'views_database.php' => 1, | |
'views_database.load.php' => 1, | |
'views.load.php' => 1, | |
'users.load.php' => 1, | |
'suggestion.php' => 1, | |
'suggestion.load.php' => 1, | |
'cron' => 1, | |
'roles.load.php' => 1, | |
'dotenvstore.php' => 1, | |
'readme_sample' => 1, | |
'ebuttoncolumn.php' => 1, | |
'logserviceprovider.php' => 1, | |
'diceware.wordlist' => 1, | |
'diceware.pl.wordlist' => 1, | |
'diceware.php' => 1, | |
'jjbformutilsbundle.php' => 1, | |
'qqfileuploader.php' => 1, | |
'uploadsaveaction.php' => 1, | |
'uploaddeleteaction.php' => 1, | |
'eajaxuploadaction.php' => 1, | |
'eajaxupload.php' => 1, | |
'togglecomposer' => 1, | |
'wikiserviceprovider.php' => 1, | |
'codemitteforcetoolkitbundle.php' => 1, | |
'meerkat.php' => 1, | |
'mysqlidb.php' => 1, | |
'simpleboardserviceprovider.php' => 1, | |
'shopserviceprovider.php' => 1, | |
'dbobject' => 1, | |
'qnaserviceprovider.php' => 1, | |
'pageserviceprovider.php' => 1, | |
'productflatchangelogtest.php' => 1, | |
'classrewriter.php' => 1, | |
'pathresolver.php' => 1, | |
'mage-includes.php' => 1, | |
'flatten-0030-in.jsonld' => 1, | |
'abstracteloquentstatisticsprovider.php' => 1, | |
'rabbit-setup' => 1, | |
'select2_locale_cs.js' => 1, | |
'select2_locale_et.js' => 1, | |
'application_form.png' => 1, | |
'select2_locale_es.js' => 1, | |
'select2_locale_en.js.template' => 1, | |
'application_form_add.png' => 1, | |
'application_form_delete.png' => 1, | |
'select2_locale_el.js' => 1, | |
'select2_locale_de.js' => 1, | |
'select2_locale_da.js' => 1, | |
'application_form_edit.png' => 1, | |
'application_form_magnify.png' => 1, | |
'select2_locale_fa.js' => 1, | |
'select2_locale_ca.js' => 1, | |
'select2_locale_bg.js' => 1, | |
'select2_locale_az.js' => 1, | |
'select2_locale_ar.js' => 1, | |
'select2.png' => 1, | |
'select2.min.js' => 1, | |
'select2.js' => 1, | |
'select2.jquery.json' => 1, | |
'select2.css' => 1, | |
'application_get.png' => 1, | |
'select2_locale_eu.js' => 1, | |
'select2_locale_fi.js' => 1, | |
'application_go.png' => 1, | |
'select2_locale_he.js' => 1, | |
'select2_locale_ka.js' => 1, | |
'densa-lang-en.js' => 1, | |
'extensible-lang-en.js' => 1, | |
'select2_locale_ja.js' => 1, | |
'error.js' => 1, | |
'select2_locale_it.js' => 1, | |
'select2_locale_is.js' => 1, | |
'select2_locale_id.js' => 1, | |
'select2_locale_hu.js' => 1, | |
'select2_locale_hr.js' => 1, | |
'select2_locale_gl.js' => 1, | |
'application_error.png' => 1, | |
'ext-lang-en.js' => 1, | |
'pie.htc' => 1, | |
'accept.png' => 1, | |
'anchor.png' => 1, | |
'application.png' => 1, | |
'application_add.png' => 1, | |
'application_cascade.png' => 1, | |
'select2_locale_fr.js' => 1, | |
'application_delete.png' => 1, | |
'application_double.png' => 1, | |
'application_edit.png' => 1, | |
'select2-spinner.gif' => 1, | |
'select2-bootstrap.css' => 1, | |
'select2_locale_lt.js' => 1, | |
'kernelexceptionlistener.php' => 1, | |
'2014-08-01-15.json' => 1, | |
'application_view_list.png' => 1, | |
'example-user-config.yml' => 1, | |
'kwattroneo4jbundle.php' => 1, | |
'application_view_tile.png' => 1, | |
'application_xp.png' => 1, | |
'application_xp_terminal.png' => 1, | |
'arrow_branch.png' => 1, | |
'kutnytracybundle.php' => 1, | |
'arrow_divide.png' => 1, | |
'templateresolver.php' => 1, | |
'routerserviceprovider.php' => 1, | |
'kutnynobundlecontrollersbundle.php' => 1, | |
'arrow_down.png' => 1, | |
'findcontrollerservicescompilerpass.php' => 1, | |
'arrow_in.png' => 1, | |
'arrow_inout.png' => 1, | |
'arrow_join.png' => 1, | |
'kutnyfixturesbundle.php' => 1, | |
'kutnyautowiringbundle.php' => 1, | |
'autowiringcompilerpass.php' => 1, | |
'kustovvitalikmaintenancebundle.php' => 1, | |
'httpserviceprovider.php' => 1, | |
'arc2_testhandler.php' => 1, | |
'application_key.png' => 1, | |
'highmaps.js' => 1, | |
'application_lightning.png' => 1, | |
'application_link.png' => 1, | |
'application_osx.png' => 1, | |
'kwizerpdfbundle.php' => 1, | |
'highstock.src.js' => 1, | |
'highstock.js' => 1, | |
'application_osx_terminal.png' => 1, | |
'application_put.png' => 1, | |
'highstock-all.js' => 1, | |
'highmaps.src.js' => 1, | |
'application_side_boxes.png' => 1, | |
'application_view_icons.png' => 1, | |
'application_side_contract.png' => 1, | |
'application_side_expand.png' => 1, | |
'application_side_list.png' => 1, | |
'application_side_tree.png' => 1, | |
'application_split.png' => 1, | |
'application_tile_horizontal.png' => 1, | |
'todo.mkd' => 1, | |
'application_tile_vertical.png' => 1, | |
'application_view_columns.png' => 1, | |
'application_view_detail.png' => 1, | |
'application_view_gallery.png' => 1, | |
'select2_locale_ko.js' => 1, | |
'select2_locale_lv.js' => 1, | |
'arrow_merge.png' => 1, | |
'rgraphrose.php' => 1, | |
'naturaltime.php' => 1, | |
'logclient.php' => 1, | |
'phpunitawaretrait.php' => 1, | |
'phpunitawareinterface.php' => 1, | |
'phpunitaware.php' => 1, | |
'transmissionbundle.php' => 1, | |
'lifetime.php' => 1, | |
'labzonegitbundle.php' => 1, | |
'rgraphrscatter.php' => 1, | |
'rgraphradar.php' => 1, | |
'rgraphwaterfall.php' => 1, | |
'l10nbundle.php' => 1, | |
'rgraphwidget.php' => 1, | |
'package_builder.php' => 1, | |
'seosacommentbundle.php' => 1, | |
'seosafeedbackbundle.php' => 1, | |
'phpfastimage' => 1, | |
'seosaimaginebundle.php' => 1, | |
'kasonataadminjmstranslationbundle.php' => 1, | |
'doctrineprefixrbundle.php' => 1, | |
'feedreader.php' => 1, | |
'phpsesame.php' => 1, | |
'adobecampaignclientbundle.php' => 1, | |
'rgraphpie.php' => 1, | |
'jquery.jsplumb.min.js' => 1, | |
'rgraphgantt.php' => 1, | |
'wizresquebundle.php' => 1, | |
'constant.php' => 1, | |
'wizpaymentgatewaybundle.php' => 1, | |
'settingslib.php' => 1, | |
'rgraphbar.php' => 1, | |
'block_mhaairs_util.php' => 1, | |
'block_mhaairs_info.php' => 1, | |
'block_mhaairs_action.php' => 1, | |
'block_mhaairs.php' => 1, | |
'robot' => 1, | |
'fr_fr.script.csv' => 1, | |
'lafourchettebreadcrumbsbundle.php' => 1, | |
'rgraphhbar.php' => 1, | |
'fr_fr.missing.csv' => 1, | |
'rgraphhprogress.php' => 1, | |
'rgraphled.php' => 1, | |
'transpile' => 1, | |
'hack_test_bootstrap.php' => 1, | |
'talendclientbundle.php' => 1, | |
'rgraphline.php' => 1, | |
'switchuserstatelessbundle.php' => 1, | |
'pagerdutybundleexception.php' => 1, | |
'lafourchettepagerdutybundle.php' => 1, | |
'limitedtextarea.php' => 1, | |
'jquery.jsplumb.js' => 1, | |
'select2_locale_mk.js' => 1, | |
'select2_locale_ru.js' => 1, | |
'select2_locale_zh-tw.js' => 1, | |
'select2_locale_zh-cn.js' => 1, | |
'select2_locale_vi.js' => 1, | |
'select2_locale_uk.js' => 1, | |
'select2_locale_tr.js' => 1, | |
'select2_locale_th.js' => 1, | |
'compress.bat' => 1, | |
'select2_locale_sv.js' => 1, | |
'dump.bat' => 1, | |
'select2_locale_sk.js' => 1, | |
'select2_locale_rs.js' => 1, | |
'kwnrecognizeimbundle.php' => 1, | |
'select2_locale_ro.js' => 1, | |
'select2_locale_pt-pt.js' => 1, | |
'select2_locale_pt-br.js' => 1, | |
'yamato' => 1, | |
'hlp.xml' => 1, | |
'select2_locale_pl.js' => 1, | |
'field.js' => 1, | |
'select2_locale_no.js' => 1, | |
'select2_locale_nl.js' => 1, | |
'select2_locale_ms.js' => 1, | |
'select2x2.png' => 1, | |
'smssendercomponent.php' => 1, | |
'dom.jsplumb.min.js' => 1, | |
'sbp.php' => 1, | |
'hateoasbundle.php' => 1, | |
'dom.jsplumb.js' => 1, | |
'php-cg' => 1, | |
'slowdb' => 1, | |
'slowdb.jpg' => 1, | |
'markdown-spec.html' => 1, | |
'readme.skel' => 1, | |
'unknownformatexception.php' => 1, | |
'testcases' => 1, | |
'magelink.py' => 1, | |
'sbp' => 1, | |
'phpunit.xml.report' => 1, | |
'backendltebundle.php' => 1, | |
'cmd.bat' => 1, | |
'kcmediabundle.php' => 1, | |
'symfony-console' => 1, | |
'knorthfieldspresssass.php' => 1, | |
'sassminify.php' => 1, | |
'knorthfieldspressslugify.php' => 1, | |
'knoxgurunsbundle.php' => 1, | |
'knpuguardbundle.php' => 1, | |
'knpuoauth2clientbundle.php' => 1, | |
'kmap.php' => 1, | |
'arrow_left.png' => 1, | |
'arrow_out.png' => 1, | |
'jsnapcommander.php' => 1, | |
'building_add.png' => 1, | |
'bug_add.png' => 1, | |
'bug_delete.png' => 1, | |
'bug_edit.png' => 1, | |
'bug_error.png' => 1, | |
'bug_go.png' => 1, | |
'bug_link.png' => 1, | |
'building.png' => 1, | |
'ioniconsasset.php' => 1, | |
'adminltewidgettrait.php' => 1, | |
'kotiktestbundle.php' => 1, | |
'building_delete.png' => 1, | |
'briefcase.png' => 1, | |
'yiifotoramawidget.php' => 1, | |
'shortid.php' => 1, | |
'smartersalesforcebundle.php' => 1, | |
'labelwidget.php' => 1, | |
'info.jpg' => 1, | |
'building_edit.png' => 1, | |
'korneiljtmpasseticfilterbundle.php' => 1, | |
'building_error.png' => 1, | |
'logentriestarget.php' => 1, | |
'conditionalvalidator.php' => 1, | |
'bug.png' => 1, | |
'bricks.png' => 1, | |
'building_go.png' => 1, | |
'jquery.nivo.slider.js' => 1, | |
'box.png' => 1, | |
'kreaitfirebasebundle.php' => 1, | |
'permissions.jpg' => 1, | |
'brick.png' => 1, | |
'brick_add.png' => 1, | |
'play.html' => 1, | |
'cinemr.php' => 1, | |
'nivoslider.jquery.json' => 1, | |
'nivo-slider.css' => 1, | |
'jquery.nivo.slider.pack.js' => 1, | |
'stpredactorbundle.php' => 1, | |
'brick_link.png' => 1, | |
'stubs.php' => 1, | |
'brick_delete.png' => 1, | |
'brick_edit.png' => 1, | |
'brick_error.png' => 1, | |
'php_jitfu.h' => 1, | |
'jitfu.c' => 1, | |
'brick_go.png' => 1, | |
'renderer' => 1, | |
'relcopyasset.php' => 1, | |
'kpicazagoogleanalyticsbundle.php' => 1, | |
'codehighlightbundle.php' => 1, | |
'k1.php' => 1, | |
'k1.bat' => 1, | |
'kretacorebundle.php' => 1, | |
'bullet_error.png' => 1, | |
'bullet_black.png' => 1, | |
'eee' => 1, | |
'ddd' => 1, | |
'bullet_blue.png' => 1, | |
'ccc' => 1, | |
'bbb' => 1, | |
'altax.phar' => 1, | |
'bullet_delete.png' => 1, | |
'adminer.png' => 1, | |
'bullet_disk.png' => 1, | |
'kodifysimplecrudbundle.php' => 1, | |
'skcmsadminbundle.php' => 1, | |
'kodifydownloaderbundle.php' => 1, | |
'kodazzi' => 1, | |
'bullet_feed.png' => 1, | |
'ys' => 1, | |
'bullet_go.png' => 1, | |
'example-mailhide.php' => 1, | |
'example-captcha.php' => 1, | |
'swfupload.js' => 1, | |
'swfupload license' => 1, | |
'core changelog' => 1, | |
'http' => 1, | |
'bullet_arrow_up.png' => 1, | |
'k1' => 1, | |
'unteist.services.yml' => 1, | |
'building_key.png' => 1, | |
'konkretnyphpnewsletter.class.php' => 1, | |
'sendpush.php' => 1, | |
'building_link.png' => 1, | |
'bullet_add.png' => 1, | |
'bullet_arrow_bottom.png' => 1, | |
'konkretnygcm.class.php' => 1, | |
'konduto.php' => 1, | |
'bullet_arrow_down.png' => 1, | |
'unteist.yml' => 1, | |
'config-sample.yml' => 1, | |
'skcmsckfinderbundle.php' => 1, | |
'auth' => 1, | |
'kolbaassetsinstallextendedbundle.php' => 1, | |
'bullet_arrow_top.png' => 1, | |
'skcmsuserbundle.php' => 1, | |
'skcmstrashbinbundle.php' => 1, | |
'skcmstrackingbundle.php' => 1, | |
'skcmsshopbundle.php' => 1, | |
'skcmslocalebundle.php' => 1, | |
'skcmsfrontbundle.php' => 1, | |
'skcmscorebundle.php' => 1, | |
'skcmscontactbundle.php' => 1, | |
'checkboxtree.php' => 1, | |
'kretaissuebundle.php' => 1, | |
'arrow_redo.png' => 1, | |
'award_star_silver_1.png' => 1, | |
'smartmenusasset.php' => 1, | |
'award_star_bronze_1.png' => 1, | |
'award_star_bronze_2.png' => 1, | |
'award_star_bronze_3.png' => 1, | |
'award_star_delete.png' => 1, | |
'materializeinitasset.php' => 1, | |
'award_star_gold_1.png' => 1, | |
'upload.htaccess' => 1, | |
'award_star_gold_2.png' => 1, | |
'award_star_gold_3.png' => 1, | |
'award_star_silver_2.png' => 1, | |
'kuborghcsvbundle.php' => 1, | |
'award_star_silver_3.png' => 1, | |
'kcfindertextinput.php' => 1, | |
'kt_init.inc.php' => 1, | |
'basket.png' => 1, | |
'basket_add.png' => 1, | |
'rfcvalidator.php' => 1, | |
'curpvalidator.php' => 1, | |
'agilezenapi.php' => 1, | |
'numeroaletra.php' => 1, | |
'acknowledgements' => 1, | |
'award_star_add.png' => 1, | |
'datatransferbundle.php' => 1, | |
'phcompile.min.js' => 1, | |
'arrow_turn_right.png' => 1, | |
'taginputasset.php' => 1, | |
'taginput.php' => 1, | |
'arrow_refresh.png' => 1, | |
'followersocial.php' => 1, | |
'arrow_refresh_small.png' => 1, | |
'arrow_right.png' => 1, | |
'arrow_rotate_anticlockwise.png' => 1, | |
'arrow_rotate_clockwise.png' => 1, | |
'arrow_switch.png' => 1, | |
'arrow_turn_left.png' => 1, | |
'arrow_undo.png' => 1, | |
'kuborghqueuebundle.php' => 1, | |
'arrow_up.png' => 1, | |
'asterisk_orange.png' => 1, | |
'crear_phps.sh' => 1, | |
'asterisk_yellow.png' => 1, | |
'attach.png' => 1, | |
'doc_php_beautifier.ini' => 1, | |
'beautifier.php' => 1, | |
'kukulililabsfeaturetogglebundle.php' => 1, | |
'menu-icons-icomoon.php' => 1, | |
'icomoon.php' => 1, | |
'icomoon-ip.php' => 1, | |
'ksn135htpasswdbundle.php' => 1, | |
'basket_edit.png' => 1, | |
'kretamediabundle.php' => 1, | |
'gridviewassets.php' => 1, | |
'book_edit.png' => 1, | |
'book_error.png' => 1, | |
'book_go.png' => 1, | |
'book_key.png' => 1, | |
'book_link.png' => 1, | |
'skinasset.php' => 1, | |
'beyondasset.php' => 1, | |
'mageboy.png' => 1, | |
'book_next.png' => 1, | |
'blade-foundation.sublime-project' => 1, | |
'activetreeprovider.php' => 1, | |
'book_delete.png' => 1, | |
'referencebuilder.php' => 1, | |
'outputparser.php' => 1, | |
'diatheke.php' => 1, | |
'cogstupidmqbundle.php' => 1, | |
'kretaworkflowbundle.php' => 1, | |
'kretauserbundle.php' => 1, | |
'kretaprojectbundle.php' => 1, | |
'kretanotificationbundle.php' => 1, | |
'book_open.png' => 1, | |
'book_previous.png' => 1, | |
'kristofvclistbundle.php' => 1, | |
'book_addresses.png' => 1, | |
'phcompile.js' => 1, | |
'bell_go.png' => 1, | |
'basket_error.png' => 1, | |
'basket_go.png' => 1, | |
'tests_config.php' => 1, | |
'basket_put.png' => 1, | |
'basket_remove.png' => 1, | |
'bell.png' => 1, | |
'bell_add.png' => 1, | |
'bell_delete.png' => 1, | |
'bell_error.png' => 1, | |
'db_latest.sql' => 1, | |
'bell_link.png' => 1, | |
'book_add.png' => 1, | |
'bin.png' => 1, | |
'bin_closed.png' => 1, | |
'api-key.php.enc' => 1, | |
'bin_empty.png' => 1, | |
'api-key.php' => 1, | |
'smpp.php' => 1, | |
'kronassmppclientbundle.php' => 1, | |
'kronasrollbarbundle.php' => 1, | |
'krocosfileuploadbundle.php' => 1, | |
'bomb.png' => 1, | |
'book.png' => 1, | |
'hostnameseek.php' => 1, | |
'jsnaphelpers.php' => 1, | |
'swfobject.js' => 1, | |
'breadcrumbspanel.php' => 1, | |
'external.json.dist' => 1, | |
'256colors.php' => 1, | |
'ktwdatabasemenubundle.php' => 1, | |
'fvd.php' => 1, | |
'readme.mt' => 1, | |
'filetest.php' => 1, | |
'baseplugin.php' => 1, | |
'changelogsplugin.php' => 1, | |
'uploads3.php' => 1, | |
'amazonses.php' => 1, | |
'imageajax.php' => 1, | |
'parserconstants.php' => 1, | |
'jsonform.php' => 1, | |
'lastpage.php' => 1, | |
'panelcount.php' => 1, | |
'pluploadjuiasset.php' => 1, | |
'verticalmenu.php' => 1, | |
'basegateway.php' => 1, | |
'zclipbtn.php' => 1, | |
'jsonattributebehavior.php' => 1, | |
'flintlabsh5bpbundle.php' => 1, | |
'generatorasset.php' => 1, | |
'composer copy.json' => 1, | |
'xhubsignature.php' => 1, | |
'uspsratepackage.php' => 1, | |
'leapti18nbundle.php' => 1, | |
'leekgitdebugbundle.php' => 1, | |
'.scrutinizer-ci.phpunit.xml.dist' => 1, | |
'phptutorialslib.php' => 1, | |
'lazy_vs_strict.php' => 1, | |
'services_openstreetmap-0.0.1.tgz' => 1, | |
'tpsutilbundle.php' => 1, | |
'tpspaypalbundle.php' => 1, | |
'dndfileuploadbundle.php' => 1, | |
'errorvalidationpicker.php' => 1, | |
'leaptimbundle.php' => 1, | |
'leaptelasticabundle.php' => 1, | |
'jqueryajaxbundle.php' => 1, | |
'leaptcorebundle.php' => 1, | |
'leaptcachebundle.php' => 1, | |
'leaptbootstrapbundle.php' => 1, | |
'leaptadminbundle.php' => 1, | |
'taggablequerybehavior.php' => 1, | |
'csp-report.php' => 1, | |
'php_cs' => 1, | |
'brench.php' => 1, | |
'plug.php' => 1, | |
'classicmodels.dump' => 1, | |
'sagittarius.zip' => 1, | |
'ziparchivefilesystem.php' => 1, | |
'uspsxmlparser.php' => 1, | |
'dump_r.php' => 1, | |
'mysqldatetimebehavior.php' => 1, | |
'crisistextlineuserprofilebundle.php' => 1, | |
'beaver.php' => 1, | |
'readme.ko' => 1, | |
'imgtext.php' => 1, | |
'ooapc.php' => 1, | |
'imagetest.php' => 1, | |
'phprandom.php' => 1, | |
'pinboard-api.php' => 1, | |
'ary.php' => 1, | |
'arytest.php' => 1, | |
'rackspacefilesystem.php' => 1, | |
'nodetype_piwik.png' => 1, | |
'qiniufilesystem.php' => 1, | |
'nullfilesystem.php' => 1, | |
'localfilesystem.php' => 1, | |
'leapscache.php' => 1, | |
'gridfsfilesystem.php' => 1, | |
'ftpfilesystem.php' => 1, | |
'dropboxfilesystem.php' => 1, | |
'relatedbehavior.php' => 1, | |
'copyfilesystem.php' => 1, | |
'azurefilesystem.php' => 1, | |
'multilanguageserviceprovider.php' => 1, | |
'module_piwik.png' => 1, | |
'potx.admin.inc' => 1, | |
'eyecare' => 1, | |
'potx.drush.inc' => 1, | |
'potx.inc' => 1, | |
'potx.info.yml' => 1, | |
'potx.local.inc' => 1, | |
'potx.module' => 1, | |
'kgpagerbundle.php' => 1, | |
'kgweinrebundle.php' => 1, | |
'divlooperinboxbundle.php' => 1, | |
'cashnpay.php' => 1, | |
'cashnpaygatewayfactory.php' => 1, | |
'interactiveconsolebundle.php' => 1, | |
'nodetype_calendar_list.png' => 1, | |
'khepindrupaltransliteratorbundle.php' => 1, | |
'transliterator.php' => 1, | |
'khepinyamlfixturesbundle.php' => 1, | |
'runkit.php' => 1, | |
'khergeuuidbundle.php' => 1, | |
'redsysapi.php' => 1, | |
'redsyswdg.php' => 1, | |
'wp-vc-template-manager.php' => 1, | |
'webdavfilesystem.php' => 1, | |
'module_calendar.png' => 1, | |
'sftpfilesystem.php' => 1, | |
'route66.php' => 1, | |
'font_delete.png' => 1, | |
'aliossfilesystem.php' => 1, | |
'llssqsbundle.php' => 1, | |
'zenstruckobjectroutingbundle.php' => 1, | |
'zenstruckresourcebundle.php' => 1, | |
'multicraftapi.php' => 1, | |
'imperaviassets.php' => 1, | |
'fileapiadvanced.php' => 1, | |
'fileapi.php' => 1, | |
'barcodevalidator.php' => 1, | |
'barcodechecksum.php' => 1, | |
'barcodeasset.php' => 1, | |
'barcodeabstracttype.php' => 1, | |
'llsmonologextrabundle.php' => 1, | |
'zenstruckmobilebundle.php' => 1, | |
'llsdynamodbbundle.php' => 1, | |
'zenstruckslugifybundle.php' => 1, | |
'llsawsbundle.php' => 1, | |
'l3yincubatorsearchbundle.php' => 1, | |
'zenstruckversionbundle.php' => 1, | |
'webhookbundle.php' => 1, | |
'kdconsolealiasbundle.php' => 1, | |
'cronworker.php' => 1, | |
'webcroncontroller.php' => 1, | |
'webcronserviceprovider.php' => 1, | |
'routecontext.php' => 1, | |
'zenstruckmigrationsbundle.php' => 1, | |
'dotenvfillerserviceprovider.php' => 1, | |
'leohtajaxsearchbundle.php' => 1, | |
'gelfconfig.php' => 1, | |
'beanstalklr.php' => 1, | |
'opcoes.php' => 1, | |
'metodos.php' => 1, | |
'manutencao.php' => 1, | |
'historia' => 1, | |
'gera.php' => 1, | |
'creditos.php' => 1, | |
'classgenerator_2013-02-25.sql' => 1, | |
'zippy.inc.php' => 1, | |
'zenstruckdashboardbundle.php' => 1, | |
'zenstruckmediabundle.php' => 1, | |
'paginatedgrid.php' => 1, | |
'leogoutpaginatorbundle.php' => 1, | |
'zenstruckdatagridbundle.php' => 1, | |
'leogoutgallerybundle.php' => 1, | |
'leogoutbasebundle.php' => 1, | |
'unit.xml' => 1, | |
'integration.xml' => 1, | |
'bb.jpg' => 1, | |
'zenstruckformbundle.php' => 1, | |
'zenstruckimagineextrabundle.php' => 1, | |
'botdetectorinterface.php' => 1, | |
'dotenvfillercommand.php' => 1, | |
'encryptable.php' => 1, | |
'daterange.php' => 1, | |
'make_currencies.php' => 1, | |
'todayrange.php' => 1, | |
'statisticsproviderinterface.php' => 1, | |
'statisticsprovidercollection.php' => 1, | |
'logo2-96.png' => 1, | |
'statisticshelper.php' => 1, | |
'rangehelper.php' => 1, | |
'providershelper.php' => 1, | |
'monthrange.php' => 1, | |
'logo2.png' => 1, | |
'keesscheperspostcodenlapibundle.php' => 1, | |
'octoberplugintestcase.php' => 1, | |
'logo2-48.png' => 1, | |
'sipdoctrineextensionsbundle.php' => 1, | |
'kejwmenwhoopsbundle.php' => 1, | |
'kinwaebootstrapbundle.php' => 1, | |
'kinwaeuserbundle.php' => 1, | |
'lastyearrange.php' => 1, | |
'lastweekrange.php' => 1, | |
'lastmonthrange.php' => 1, | |
'kndradbundle.php' => 1, | |
'kjpaymentstripebundle.php' => 1, | |
'dayrange.php' => 1, | |
'logo2-64.png' => 1, | |
'logo2-32.png' => 1, | |
'guidable.php' => 1, | |
'logo-48.png' => 1, | |
'slugabble.php' => 1, | |
'permissionsserviceprovider.php' => 1, | |
'protecttrait.php' => 1, | |
'polishvalidatorrulesserviceprovider.php' => 1, | |
'keboolagoogleclientbundle.php' => 1, | |
'syrupcomponentbundle.php' => 1, | |
'changelog-id' => 1, | |
'logo-128.png' => 1, | |
'logo-256.png' => 1, | |
'logo-32.png' => 1, | |
'logo-64.png' => 1, | |
'weekrange.php' => 1, | |
'logo-96.png' => 1, | |
'logo2-128.png' => 1, | |
'logo2-256.png' => 1, | |
'lmlphp_logo_200.png' => 1, | |
'lml.php' => 1, | |
'lml.min.php' => 1, | |
4 => 1, | |
2 => 1, | |
'er_formatters.info.yml' => 1, | |
'yesterdayrange.php' => 1, | |
'yearrange.php' => 1, | |
'awss3filesystem.php' => 1, | |
'dialogpluginasset.php' => 1, | |
'junosspace.php' => 1, | |
'miniquery.php' => 1, | |
'kitpagesutilbundle.php' => 1, | |
'divisions_zh_cn.php' => 1, | |
'divisions_extra_zh_cn.php' => 1, | |
'worldquery.php' => 1, | |
'taobaoquery.php' => 1, | |
'sinaquery.php' => 1, | |
'kitpagesworkflowbundle.php' => 1, | |
'qqwryquery.php' => 1, | |
'kitpagesworkflowevents.php' => 1, | |
'monipdbquery.php' => 1, | |
'fullquery.php' => 1, | |
'guess_college.php' => 1, | |
'freeipipquery.php' => 1, | |
'filequery.php' => 1, | |
'databasequery.php' => 1, | |
'chinaquery.php' => 1, | |
'baidumapquery.php' => 1, | |
'kixstaticpagesbundle.php' => 1, | |
'liquidmetal.php' => 1, | |
'ipv4.yaml' => 1, | |
'ipv4' => 1, | |
'kjdatranslationbundle.php' => 1, | |
'guess_china.php' => 1, | |
'guess_world.php' => 1, | |
'light.php' => 1, | |
'lassomailparserbundle.php' => 1, | |
'kitpagesshopevents.php' => 1, | |
'lassomultilogbundle.php' => 1, | |
'jsonlogobject.php' => 1, | |
'partfactory.php' => 1, | |
'parsedmail.php' => 1, | |
'kitpagesshopcmsbundle.php' => 1, | |
'kitpagessimplecachebundle.php' => 1, | |
'kitpagessimpleedmbundle.php' => 1, | |
'kitpagessimpleedmevents.php' => 1, | |
'parsehelper.php' => 1, | |
'simpleedmexception.php' => 1, | |
'kitpagesusergeneratedevents.php' => 1, | |
'kitpagesstepbundle.php' => 1, | |
'registration' => 1, | |
'kitpagesstepevents.php' => 1, | |
'readme-regular-admin-forms' => 1, | |
'readme-lookup-tables' => 1, | |
'attila_tutoriel.docx' => 1, | |
'apollina_tutoriel.docx' => 1, | |
'stepexception.php' => 1, | |
'kitpagesusergeneratedbundle.php' => 1, | |
'moves.php' => 1, | |
'说昞' => 1, | |
'kkuetnetprestashopwebservicebundle.php' => 1, | |
'xpresion.png' => 1, | |
'kitpagesshopbundle.php' => 1, | |
'configuration.json' => 1, | |
'facebookextensiontrait.php' => 1, | |
'klesksliderbundle.php' => 1, | |
'headerparser.php' => 1, | |
'fgchttpclient.php' => 1, | |
'proxylib.php' => 1, | |
'neo4jclientbundle.php' => 1, | |
'jsonldresponse.php' => 1, | |
'hydrabundle.php' => 1, | |
'kickstart.sh' => 1, | |
'hydraapi.php' => 1, | |
'gitsynchronizer.php' => 1, | |
'lara' => 1, | |
'swoole_doc.php' => 1, | |
'nginx.tmpl' => 1, | |
'laravelserviceprovider.php' => 1, | |
'landingilogglybundle.php' => 1, | |
'framework.sql' => 1, | |
'adsb_raw.dat' => 1, | |
'lamosty-blog-helper.php' => 1, | |
'bedrock-plugin-control.php' => 1, | |
'markupbuilder.php' => 1, | |
'junosnetconf.php' => 1, | |
'facebookextensioninterface.php' => 1, | |
'composer.json.stub' => 1, | |
'lagdoctrinerepositorybundle.php' => 1, | |
'envoy' => 1, | |
'lagadminbundle.php' => 1, | |
'mongodbauthadapter.php' => 1, | |
'facebookauthenticationbundle.php' => 1, | |
'img.png' => 1, | |
'lissandra.png' => 1, | |
'ekko.jpg' => 1, | |
'example.gif' => 1, | |
'flare' => 1, | |
'facebookloginurlredirectresponse.php' => 1, | |
'lumen' => 1, | |
'facebookadapter.php' => 1, | |
'laraedit-v0.0.1.png' => 1, | |
'facebookadapteraware.php' => 1, | |
'lj-blog.php' => 1, | |
'trans_lang_lines.json' => 1, | |
'trans_comments.json' => 1, | |
'bladed.wiki' => 1, | |
'facebookadapterawareinterface.php' => 1, | |
'laravelcn' => 1, | |
'facebookadapterawaretrait.php' => 1, | |
'ordinationtrait.php' => 1, | |
'ordinationserviceprovider.php' => 1, | |
'laraedit-v0.0.2.png' => 1, | |
'multilogfactory.php' => 1, | |
'onlymessageformatter.php' => 1, | |
'fileobject.php' => 1, | |
'arraydiffhtml.php' => 1, | |
'wizard2.php' => 1, | |
'kimai.json' => 1, | |
'vinsearch.php' => 1, | |
'vehicles.php' => 1, | |
'vehicle.php' => 1, | |
'unit.php' => 1, | |
'unifilter.php' => 1, | |
'thanatosdigitaloceanbundle.php' => 1, | |
'nemesis.php' => 1, | |
'forker' => 1, | |
'readme-tests' => 1, | |
'wizardsearch.php' => 1, | |
'qgroups.php' => 1, | |
'qdetails.php' => 1, | |
'prag.php' => 1, | |
'localization_ru.php' => 1, | |
'localization_en.php' => 1, | |
'codecov' => 1, | |
'dependency.yml' => 1, | |
'framesearch.php' => 1, | |
'detailfilter.php' => 1, | |
'km.pm' => 1, | |
'wizard2bystep.php' => 1, | |
'wizardsearch2.php' => 1, | |
'applicability.php' => 1, | |
'ldaptoolsbundle.php' => 1, | |
'supercachebundle.php' => 1, | |
'h4md1jsqueezebundle.php' => 1, | |
'leaphlycartbundle.php' => 1, | |
'.realsync' => 1, | |
'treegridasset.php' => 1, | |
'treegrid.php' => 1, | |
'treecolumn.php' => 1, | |
'phpunit.xml.dist | |
' => 1, | |
'lepharemenubundle.php' => 1, | |
'lephareadmingeneratorbundle.php' => 1, | |
'killerwolfjcdecauxcyclocitybundle.php' => 1, | |
'procfile_dev' => 1, | |
'server-livereload.php' => 1, | |
'server-livereload.js' => 1, | |
'composer.jso' => 1, | |
'gatekeeperpropelbundle.php' => 1, | |
'lazyantsworkflowbundle.php' => 1, | |
'lazyantstoolkitbundle.php' => 1, | |
'lazyantsdynatreebundle.php' => 1, | |
'test-module-guestbook.yml' => 1, | |
'module-guestbook.yml' => 1, | |
'cody' => 1, | |
'code.yml' => 1, | |
'catalogs.php' => 1, | |
'am_searchpanel.php' => 1, | |
'clientfactory.php' => 1, | |
'kitpagesdatagridbundle.php' => 1, | |
'mu.php' => 1, | |
'ev.php' => 1, | |
'mess.php' => 1, | |
'.gitignore_global' => 1, | |
'mailboxmanager.php' => 1, | |
'kitpageschainevents.php' => 1, | |
'kitpagescommonstepbundle.php' => 1, | |
'lassovmailbundle.php' => 1, | |
'kitpagescompanybundle.php' => 1, | |
'kitpagescompanyevents.php' => 1, | |
'aliasmanager.php' => 1, | |
'chainexception.php' => 1, | |
'kitpagesdatagridevents.php' => 1, | |
'tokenfactory.php' => 1, | |
'lassooauth2clientbundle.php' => 1, | |
'kitpagesfilebundle.php' => 1, | |
'kitpagesfileevents.php' => 1, | |
'kitpagesfilesystembundle.php' => 1, | |
'kitpagesfilesystemevents.php' => 1, | |
'kitpagesmobileappbuilderbundle.php' => 1, | |
'kitpagespdfbundle.php' => 1, | |
'kitpagesredirectbundle.php' => 1, | |
'kitpagessemaphorebundle.php' => 1, | |
'kitpageschainbundle.php' => 1, | |
'kitpagescachecontrolbundle.php' => 1, | |
'am_manufacturerinfo.php' => 1, | |
'crunz' => 1, | |
'am_listmanufacturer.php' => 1, | |
'am_findoem.php' => 1, | |
'am_finddetail.php' => 1, | |
'aftermarket.php' => 1, | |
'lavoiesljquerybundle.php' => 1, | |
'jquery.resetform.js' => 1, | |
'polyfill.php' => 1, | |
'jquery.autocollapser.min.js' => 1, | |
'jquery.autocollapser.js' => 1, | |
'sked' => 1, | |
'endroidqrcodebundle.php' => 1, | |
'kitpagesactivityevents.php' => 1, | |
'lopipusherbundle.php' => 1, | |
'latyshababundle.php' => 1, | |
'example.zip' => 1, | |
'murmurhash3.php' => 1, | |
'km.php' => 1, | |
'km.py' => 1, | |
'km.rb' => 1, | |
'webuipopover.php' => 1, | |
'webuipopoverasset.php' => 1, | |
'activityexception.php' => 1, | |
'kitpagesactivitybundle.php' => 1, | |
'2.2.0.1.kdev4' => 1, | |
'xhtml_valid.png' => 1, | |
'moipbundle.php' => 1, | |
'page_white_coldfusion.png' => 1, | |
'drive_edit.png' => 1, | |
'drive_error.png' => 1, | |
'page_white_cup.png' => 1, | |
'drive_go.png' => 1, | |
'page_white_csharp.png' => 1, | |
'page_white_cplusplus.png' => 1, | |
'page_white_copy.png' => 1, | |
'drive_key.png' => 1, | |
'page_white_compressed.png' => 1, | |
'drive_link.png' => 1, | |
'page_white_code_red.png' => 1, | |
'page_white_delete.png' => 1, | |
'drive_magnify.png' => 1, | |
'drive_network.png' => 1, | |
'drive_rename.png' => 1, | |
'drive_user.png' => 1, | |
'page_white_code.png' => 1, | |
'drive_web.png' => 1, | |
'dvd.png' => 1, | |
'page_white_cd.png' => 1, | |
'page_white_camera.png' => 1, | |
'page_white_c.png' => 1, | |
'page_white_database.png' => 1, | |
'drive_disk.png' => 1, | |
'page_white_actionscript.png' => 1, | |
'page_white_horizontal.png' => 1, | |
'drink_empty.png' => 1, | |
'page_white_medal.png' => 1, | |
'drive.png' => 1, | |
'drive_add.png' => 1, | |
'page_white_magnify.png' => 1, | |
'page_white_link.png' => 1, | |
'drive_burn.png' => 1, | |
'page_white_lightning.png' => 1, | |
'drive_cd.png' => 1, | |
'page_white_key.png' => 1, | |
'page_white_h.png' => 1, | |
'drive_delete.png' => 1, | |
'page_white_go.png' => 1, | |
'page_white_get.png' => 1, | |
'page_white_gear.png' => 1, | |
'page_white_freehand.png' => 1, | |
'page_white_flash.png' => 1, | |
'page_white_find.png' => 1, | |
'page_white_excel.png' => 1, | |
'page_white_error.png' => 1, | |
'page_white_edit.png' => 1, | |
'drive_cd_empty.png' => 1, | |
'page_white_dvd.png' => 1, | |
'page_white_add.png' => 1, | |
'page_white_acrobat.png' => 1, | |
'page_white_office.png' => 1, | |
'overlays.png' => 1, | |
'page_attach.png' => 1, | |
'page_add.png' => 1, | |
'page.png' => 1, | |
'package_link.png' => 1, | |
'package_green.png' => 1, | |
'package_go.png' => 1, | |
'package_delete.png' => 1, | |
'package_add.png' => 1, | |
'email_delete.png' => 1, | |
'email_edit.png' => 1, | |
'email_error.png' => 1, | |
'page_copy.png' => 1, | |
'email_go.png' => 1, | |
'note_go.png' => 1, | |
'email_link.png' => 1, | |
'email_open.png' => 1, | |
'note_error.png' => 1, | |
'note_edit.png' => 1, | |
'note_delete.png' => 1, | |
'email_open_image.png' => 1, | |
'emoticon_evilgrin.png' => 1, | |
'note_add.png' => 1, | |
'page_code.png' => 1, | |
'page_delete.png' => 1, | |
'page_white.png' => 1, | |
'page_key.png' => 1, | |
'page_save.png' => 1, | |
'page_refresh.png' => 1, | |
'page_red.png' => 1, | |
'page_paste.png' => 1, | |
'dvd_add.png' => 1, | |
'page_paintbrush.png' => 1, | |
'dvd_delete.png' => 1, | |
'page_link.png' => 1, | |
'dvd_edit.png' => 1, | |
'page_lightning.png' => 1, | |
'page_green.png' => 1, | |
'page_error.png' => 1, | |
'dvd_error.png' => 1, | |
'dvd_go.png' => 1, | |
'dvd_key.png' => 1, | |
'dvd_link.png' => 1, | |
'page_go.png' => 1, | |
'email.png' => 1, | |
'page_gear.png' => 1, | |
'email_add.png' => 1, | |
'email_attach.png' => 1, | |
'page_find.png' => 1, | |
'page_excel.png' => 1, | |
'drink.png' => 1, | |
'page_white_paint.png' => 1, | |
'emoticon_happy.png' => 1, | |
'database_gear.png' => 1, | |
'picture_save.png' => 1, | |
'picture_link.png' => 1, | |
'picture_key.png' => 1, | |
'database_error.png' => 1, | |
'picture_go.png' => 1, | |
'picture_error.png' => 1, | |
'picture_empty.png' => 1, | |
'picture_edit.png' => 1, | |
'picture_delete.png' => 1, | |
'picture_add.png' => 1, | |
'database_go.png' => 1, | |
'pilcrow.png' => 1, | |
'database_key.png' => 1, | |
'database_lightning.png' => 1, | |
'photos.png' => 1, | |
'photo_link.png' => 1, | |
'photo_delete.png' => 1, | |
'database_link.png' => 1, | |
'photo_add.png' => 1, | |
'photo.png' => 1, | |
'phone_sound.png' => 1, | |
'database_refresh.png' => 1, | |
'pictures.png' => 1, | |
'pill.png' => 1, | |
'database_table.png' => 1, | |
'cut_red.png' => 1, | |
'cup_go.png' => 1, | |
'printer_empty.png' => 1, | |
'printer_delete.png' => 1, | |
'printer_add.png' => 1, | |
'cup_key.png' => 1, | |
'printer.png' => 1, | |
'plugin_link.png' => 1, | |
'cup_link.png' => 1, | |
'cursor.png' => 1, | |
'cut.png' => 1, | |
'plugin_go.png' => 1, | |
'pill_add.png' => 1, | |
'plugin_error.png' => 1, | |
'database_add.png' => 1, | |
'plugin_edit.png' => 1, | |
'plugin_disabled.png' => 1, | |
'plugin_delete.png' => 1, | |
'database_connect.png' => 1, | |
'plugin_add.png' => 1, | |
'database_delete.png' => 1, | |
'pill_go.png' => 1, | |
'pill_delete.png' => 1, | |
'database_edit.png' => 1, | |
'database_save.png' => 1, | |
'date.png' => 1, | |
'page_white_paintbrush.png' => 1, | |
'page_white_text.png' => 1, | |
'page_white_word.png' => 1, | |
'page_white_width.png' => 1, | |
'page_white_visualstudio.png' => 1, | |
'disk.png' => 1, | |
'page_white_vector.png' => 1, | |
'page_white_tux.png' => 1, | |
'page_white_text_width.png' => 1, | |
'disk_multiple.png' => 1, | |
'door.png' => 1, | |
'door_in.png' => 1, | |
'page_white_swoosh.png' => 1, | |
'page_white_wrench.png' => 1, | |
'door_open.png' => 1, | |
'door_out.png' => 1, | |
'page_white_star.png' => 1, | |
'page_white_stack.png' => 1, | |
'page_white_ruby.png' => 1, | |
'page_white_put.png' => 1, | |
'page_white_powerpoint.png' => 1, | |
'page_white_picture.png' => 1, | |
'page_white_php.png' => 1, | |
'page_white_paste.png' => 1, | |
'page_white_world.png' => 1, | |
'disconnect.png' => 1, | |
'date_add.png' => 1, | |
'pencil_add.png' => 1, | |
'date_delete.png' => 1, | |
'date_edit.png' => 1, | |
'date_error.png' => 1, | |
'date_go.png' => 1, | |
'phone_delete.png' => 1, | |
'phone_add.png' => 1, | |
'phone.png' => 1, | |
'pencil_go.png' => 1, | |
'date_link.png' => 1, | |
'pencil_delete.png' => 1, | |
'date_magnify.png' => 1, | |
'delete.png' => 1, | |
'date_next.png' => 1, | |
'pencil.png' => 1, | |
'paste_word.png' => 1, | |
'paste_plain.png' => 1, | |
'palette.png' => 1, | |
'paintcan.png' => 1, | |
'paintbrush.png' => 1, | |
'page_world.png' => 1, | |
'page_word.png' => 1, | |
'page_white_zip.png' => 1, | |
'date_previous.png' => 1, | |
'emoticon_grin.png' => 1, | |
'note.png' => 1, | |
'printer_error.png' => 1, | |
'ipod_sound.png' => 1, | |
'key.png' => 1, | |
'flag_yellow.png' => 1, | |
'joystick_error.png' => 1, | |
'folder.png' => 1, | |
'folder_add.png' => 1, | |
'joystick_delete.png' => 1, | |
'joystick_add.png' => 1, | |
'folder_bell.png' => 1, | |
'folder_brick.png' => 1, | |
'joystick.png' => 1, | |
'folder_bug.png' => 1, | |
'key_delete.png' => 1, | |
'ipod_cast_delete.png' => 1, | |
'folder_camera.png' => 1, | |
'folder_database.png' => 1, | |
'folder_delete.png' => 1, | |
'folder_edit.png' => 1, | |
'folder_error.png' => 1, | |
'ipod_cast_add.png' => 1, | |
'ipod_cast.png' => 1, | |
'ipod.png' => 1, | |
'information.png' => 1, | |
'key_add.png' => 1, | |
'key_go.png' => 1, | |
'image_link.png' => 1, | |
'layout_edit.png' => 1, | |
'lightbulb_off.png' => 1, | |
'lightbulb_delete.png' => 1, | |
'lightbulb_add.png' => 1, | |
'lightbulb.png' => 1, | |
'flag_blue.png' => 1, | |
'flag_green.png' => 1, | |
'layout_sidebar.png' => 1, | |
'layout_link.png' => 1, | |
'layout_header.png' => 1, | |
'layout_error.png' => 1, | |
'flag_orange.png' => 1, | |
'flag_red.png' => 1, | |
'layout_delete.png' => 1, | |
'layout_content.png' => 1, | |
'layout_add.png' => 1, | |
'flag_pink.png' => 1, | |
'flag_purple.png' => 1, | |
'layout.png' => 1, | |
'layers.png' => 1, | |
'keyboard_magnify.png' => 1, | |
'keyboard_delete.png' => 1, | |
'keyboard_add.png' => 1, | |
'keyboard.png' => 1, | |
'images.png' => 1, | |
'folder_explore.png' => 1, | |
'lightning_add.png' => 1, | |
'folder_user.png' => 1, | |
'heart_delete.png' => 1, | |
'heart_add.png' => 1, | |
'heart.png' => 1, | |
'group_link.png' => 1, | |
'group_key.png' => 1, | |
'folder_page_white.png' => 1, | |
'folder_palette.png' => 1, | |
'folder_picture.png' => 1, | |
'folder_star.png' => 1, | |
'folder_table.png' => 1, | |
'folder_wrench.png' => 1, | |
'hourglass.png' => 1, | |
'font.png' => 1, | |
'group_go.png' => 1, | |
'group_gear.png' => 1, | |
'group_error.png' => 1, | |
'font_add.png' => 1, | |
'group_edit.png' => 1, | |
'group_delete.png' => 1, | |
'group_add.png' => 1, | |
'group.png' => 1, | |
'font_go.png' => 1, | |
'help.png' => 1, | |
'hourglass_add.png' => 1, | |
'image_edit.png' => 1, | |
'folder_image.png' => 1, | |
'image_delete.png' => 1, | |
'folder_feed.png' => 1, | |
'folder_find.png' => 1, | |
'image_add.png' => 1, | |
'image.png' => 1, | |
'html_valid.png' => 1, | |
'html_go.png' => 1, | |
'folder_go.png' => 1, | |
'html_delete.png' => 1, | |
'folder_heart.png' => 1, | |
'html_add.png' => 1, | |
'hourglass_delete.png' => 1, | |
'html.png' => 1, | |
'house_link.png' => 1, | |
'house_go.png' => 1, | |
'house.png' => 1, | |
'folder_key.png' => 1, | |
'folder_lightbulb.png' => 1, | |
'folder_link.png' => 1, | |
'hourglass_link.png' => 1, | |
'hourglass_go.png' => 1, | |
'folder_magnify.png' => 1, | |
'folder_page.png' => 1, | |
'lightning.png' => 1, | |
'lightning_delete.png' => 1, | |
'emoticon_smile.png' => 1, | |
'money_delete.png' => 1, | |
'monitor_edit.png' => 1, | |
'monitor_delete.png' => 1, | |
'monitor_add.png' => 1, | |
'monitor.png' => 1, | |
'money_yen.png' => 1, | |
'feed_delete.png' => 1, | |
'money_pound.png' => 1, | |
'feed_disk.png' => 1, | |
'money_euro.png' => 1, | |
'money_dollar.png' => 1, | |
'money_add.png' => 1, | |
'feed_add.png' => 1, | |
'money.png' => 1, | |
'medal_silver_delete.png' => 1, | |
'medal_silver_add.png' => 1, | |
'medal_silver_3.png' => 1, | |
'medal_silver_2.png' => 1, | |
'medal_silver_1.png' => 1, | |
'medal_gold_delete.png' => 1, | |
'feed_edit.png' => 1, | |
'feed_error.png' => 1, | |
'feed_go.png' => 1, | |
'monitor_error.png' => 1, | |
'feed.png' => 1, | |
'medal_gold_add.png' => 1, | |
'music.png' => 1, | |
'emoticon_surprised.png' => 1, | |
'newspaper_link.png' => 1, | |
'emoticon_tongue.png' => 1, | |
'newspaper_go.png' => 1, | |
'newspaper_delete.png' => 1, | |
'newspaper_add.png' => 1, | |
'emoticon_unhappy.png' => 1, | |
'newspaper.png' => 1, | |
'new.png' => 1, | |
'emoticon_waii.png' => 1, | |
'emoticon_wink.png' => 1, | |
'monitor_go.png' => 1, | |
'error_add.png' => 1, | |
'mouse_error.png' => 1, | |
'error_delete.png' => 1, | |
'mouse_delete.png' => 1, | |
'mouse_add.png' => 1, | |
'error_go.png' => 1, | |
'mouse.png' => 1, | |
'exclamation.png' => 1, | |
'monitor_link.png' => 1, | |
'eye.png' => 1, | |
'monitor_lightning.png' => 1, | |
'feed_key.png' => 1, | |
'medal_gold_3.png' => 1, | |
'find.png' => 1, | |
'lock_break.png' => 1, | |
'lorry_go.png' => 1, | |
'lorry_flatbed.png' => 1, | |
'lorry_error.png' => 1, | |
'lorry_delete.png' => 1, | |
'lorry_add.png' => 1, | |
'lorry.png' => 1, | |
'lock_open.png' => 1, | |
'lock_go.png' => 1, | |
'lock_edit.png' => 1, | |
'lock_delete.png' => 1, | |
'lock_add.png' => 1, | |
'magifier_zoom_out.png' => 1, | |
'film_link.png' => 1, | |
'link_go.png' => 1, | |
'link_error.png' => 1, | |
'link_edit.png' => 1, | |
'link_delete.png' => 1, | |
'link_break.png' => 1, | |
'link_add.png' => 1, | |
'link.png' => 1, | |
'lightning_go.png' => 1, | |
'film_save.png' => 1, | |
'lorry_link.png' => 1, | |
'magnifier.png' => 1, | |
'medal_gold_2.png' => 1, | |
'film_delete.png' => 1, | |
'medal_gold_1.png' => 1, | |
'feed_link.png' => 1, | |
'medal_bronze_delete.png' => 1, | |
'medal_bronze_add.png' => 1, | |
'medal_bronze_3.png' => 1, | |
'medal_bronze_2.png' => 1, | |
'feed_magnify.png' => 1, | |
'female.png' => 1, | |
'film.png' => 1, | |
'film_add.png' => 1, | |
'medal_bronze_1.png' => 1, | |
'magnifier_zoom_in.png' => 1, | |
'map_magnify.png' => 1, | |
'film_edit.png' => 1, | |
'map_go.png' => 1, | |
'map_edit.png' => 1, | |
'map_delete.png' => 1, | |
'map_add.png' => 1, | |
'film_error.png' => 1, | |
'map.png' => 1, | |
'film_go.png' => 1, | |
'male.png' => 1, | |
'film_key.png' => 1, | |
'cup_error.png' => 1, | |
'rainbow.png' => 1, | |
'xhtml_go.png' => 1, | |
'text_indent_remove.png' => 1, | |
'text_lowercase.png' => 1, | |
'chart_bar_link.png' => 1, | |
'text_list_numbers.png' => 1, | |
'chart_curve.png' => 1, | |
'text_list_bullets.png' => 1, | |
'text_linespacing.png' => 1, | |
'text_letterspacing.png' => 1, | |
'text_letter_omega.png' => 1, | |
'text_kerning.png' => 1, | |
'text_italic.png' => 1, | |
'chart_curve_add.png' => 1, | |
'chart_bar_error.png' => 1, | |
'text_indent.png' => 1, | |
'text_horizontalrule.png' => 1, | |
'text_heading_6.png' => 1, | |
'text_heading_5.png' => 1, | |
'text_heading_4.png' => 1, | |
'text_heading_3.png' => 1, | |
'text_heading_2.png' => 1, | |
'text_heading_1.png' => 1, | |
'text_dropcaps.png' => 1, | |
'text_columns.png' => 1, | |
'text_padding_bottom.png' => 1, | |
'chart_bar_edit.png' => 1, | |
'chart_curve_delete.png' => 1, | |
'cart_put.png' => 1, | |
'text_underline.png' => 1, | |
'text_superscript.png' => 1, | |
'cart_error.png' => 1, | |
'cart_go.png' => 1, | |
'text_subscript.png' => 1, | |
'text_strikethrough.png' => 1, | |
'text_smallcaps.png' => 1, | |
'text_signature.png' => 1, | |
'text_replace.png' => 1, | |
'text_padding_top.png' => 1, | |
'cart_remove.png' => 1, | |
'chart_bar_delete.png' => 1, | |
'cd.png' => 1, | |
'cd_add.png' => 1, | |
'cd_burn.png' => 1, | |
'cd_delete.png' => 1, | |
'cd_edit.png' => 1, | |
'cd_eject.png' => 1, | |
'cd_go.png' => 1, | |
'chart_bar.png' => 1, | |
'text_padding_right.png' => 1, | |
'chart_bar_add.png' => 1, | |
'text_padding_left.png' => 1, | |
'text_bold.png' => 1, | |
'chart_curve_edit.png' => 1, | |
'textfield.png' => 1, | |
'clock_add.png' => 1, | |
'chart_pie_add.png' => 1, | |
'chart_pie_delete.png' => 1, | |
'chart_pie_edit.png' => 1, | |
'chart_pie_error.png' => 1, | |
'telephone.png' => 1, | |
'chart_pie_link.png' => 1, | |
'clock.png' => 1, | |
'tag_yellow.png' => 1, | |
'tag_red.png' => 1, | |
'tag_purple.png' => 1, | |
'clock_delete.png' => 1, | |
'chart_organisation_delete.png' => 1, | |
'clock_edit.png' => 1, | |
'tag_pink.png' => 1, | |
'tag_orange.png' => 1, | |
'clock_error.png' => 1, | |
'clock_go.png' => 1, | |
'clock_link.png' => 1, | |
'clock_pause.png' => 1, | |
'clock_play.png' => 1, | |
'tag_green.png' => 1, | |
'clock_red.png' => 1, | |
'chart_pie.png' => 1, | |
'chart_organisation_add.png' => 1, | |
'text_allcaps.png' => 1, | |
'chart_line_delete.png' => 1, | |
'text_align_right.png' => 1, | |
'chart_curve_error.png' => 1, | |
'text_align_left.png' => 1, | |
'text_align_justify.png' => 1, | |
'text_align_center.png' => 1, | |
'chart_curve_go.png' => 1, | |
'chart_curve_link.png' => 1, | |
'television_delete.png' => 1, | |
'chart_line.png' => 1, | |
'chart_line_add.png' => 1, | |
'chart_line_edit.png' => 1, | |
'chart_organisation.png' => 1, | |
'television_add.png' => 1, | |
'chart_line_error.png' => 1, | |
'chart_line_link.png' => 1, | |
'television.png' => 1, | |
'telephone_link.png' => 1, | |
'telephone_key.png' => 1, | |
'telephone_go.png' => 1, | |
'telephone_error.png' => 1, | |
'telephone_edit.png' => 1, | |
'telephone_delete.png' => 1, | |
'telephone_add.png' => 1, | |
'text_uppercase.png' => 1, | |
'cart_edit.png' => 1, | |
'tag_blue_delete.png' => 1, | |
'calendar_edit.png' => 1, | |
'calculator_delete.png' => 1, | |
'calculator_edit.png' => 1, | |
'calculator_error.png' => 1, | |
'calculator_link.png' => 1, | |
'calendar_add.png' => 1, | |
'webcam_error.png' => 1, | |
'webcam_delete.png' => 1, | |
'webcam_add.png' => 1, | |
'calendar_delete.png' => 1, | |
'webcam.png' => 1, | |
'weather_sun.png' => 1, | |
'world.png' => 1, | |
'weather_snow.png' => 1, | |
'weather_rain.png' => 1, | |
'weather_lightning.png' => 1, | |
'weather_cloudy.png' => 1, | |
'weather_clouds.png' => 1, | |
'wand.png' => 1, | |
'vector_delete.png' => 1, | |
'vector_add.png' => 1, | |
'vector.png' => 1, | |
'vcard_edit.png' => 1, | |
'calculator_add.png' => 1, | |
'calculator.png' => 1, | |
'calendar_view_day.png' => 1, | |
'world_go.png' => 1, | |
'xhtml_delete.png' => 1, | |
'bullet_green.png' => 1, | |
'xhtml_add.png' => 1, | |
'bullet_key.png' => 1, | |
'bullet_orange.png' => 1, | |
'xhtml.png' => 1, | |
'bullet_picture.png' => 1, | |
'wrench_orange.png' => 1, | |
'wrench.png' => 1, | |
'world_link.png' => 1, | |
'bullet_pink.png' => 1, | |
'cake.png' => 1, | |
'bullet_purple.png' => 1, | |
'bullet_red.png' => 1, | |
'bullet_star.png' => 1, | |
'bullet_toggle_minus.png' => 1, | |
'bullet_toggle_plus.png' => 1, | |
'bullet_white.png' => 1, | |
'bullet_wrench.png' => 1, | |
'bullet_yellow.png' => 1, | |
'world_edit.png' => 1, | |
'world_delete.png' => 1, | |
'world_add.png' => 1, | |
'calendar_link.png' => 1, | |
'calendar_view_month.png' => 1, | |
'textfield_add.png' => 1, | |
'cart_add.png' => 1, | |
'camera_small.png' => 1, | |
'transmit_blue.png' => 1, | |
'cancel.png' => 1, | |
'car.png' => 1, | |
'transmit_add.png' => 1, | |
'transmit.png' => 1, | |
'car_add.png' => 1, | |
'car_delete.png' => 1, | |
'cart.png' => 1, | |
'timeline_marker.png' => 1, | |
'time_go.png' => 1, | |
'camera_go.png' => 1, | |
'time_delete.png' => 1, | |
'time_add.png' => 1, | |
'time.png' => 1, | |
'tick.png' => 1, | |
'thumb_up.png' => 1, | |
'thumb_down.png' => 1, | |
'textfield_rename.png' => 1, | |
'textfield_key.png' => 1, | |
'cart_delete.png' => 1, | |
'textfield_delete.png' => 1, | |
'camera_link.png' => 1, | |
'camera_error.png' => 1, | |
'calendar_view_week.png' => 1, | |
'user_go.png' => 1, | |
'camera.png' => 1, | |
'vcard_delete.png' => 1, | |
'camera_add.png' => 1, | |
'vcard_add.png' => 1, | |
'vcard.png' => 1, | |
'user_suit.png' => 1, | |
'user_red.png' => 1, | |
'user_orange.png' => 1, | |
'user_green.png' => 1, | |
'user_gray.png' => 1, | |
'user_female.png' => 1, | |
'transmit_delete.png' => 1, | |
'user_edit.png' => 1, | |
'user_delete.png' => 1, | |
'user_comment.png' => 1, | |
'camera_delete.png' => 1, | |
'user_add.png' => 1, | |
'camera_edit.png' => 1, | |
'user.png' => 1, | |
'tux.png' => 1, | |
'transmit_go.png' => 1, | |
'transmit_error.png' => 1, | |
'transmit_edit.png' => 1, | |
'tag_blue_edit.png' => 1, | |
'tag_blue_add.png' => 1, | |
'report.png' => 1, | |
'controller.png' => 1, | |
'control_stop_blue.png' => 1, | |
'shading.png' => 1, | |
'server_uncompressed.png' => 1, | |
'server_link.png' => 1, | |
'server_lightning.png' => 1, | |
'server_key.png' => 1, | |
'server_go.png' => 1, | |
'server_error.png' => 1, | |
'server_edit.png' => 1, | |
'server_delete.png' => 1, | |
'server_database.png' => 1, | |
'control_stop.png' => 1, | |
'server_connect.png' => 1, | |
'server_compressed.png' => 1, | |
'server_chart.png' => 1, | |
'server_add.png' => 1, | |
'controller_add.png' => 1, | |
'server.png' => 1, | |
'script_save.png' => 1, | |
'script_palette.png' => 1, | |
'script_link.png' => 1, | |
'script_lightning.png' => 1, | |
'shape_align_bottom.png' => 1, | |
'shape_align_center.png' => 1, | |
'controller_delete.png' => 1, | |
'shape_move_backwards.png' => 1, | |
'shape_square_edit.png' => 1, | |
'shape_square_delete.png' => 1, | |
'shape_square_add.png' => 1, | |
'shape_square.png' => 1, | |
'shape_rotate_clockwise.png' => 1, | |
'control_repeat.png' => 1, | |
'control_repeat_blue.png' => 1, | |
'shape_rotate_anticlockwise.png' => 1, | |
'shape_move_front.png' => 1, | |
'shape_move_forwards.png' => 1, | |
'shape_move_back.png' => 1, | |
'shape_align_left.png' => 1, | |
'control_rewind.png' => 1, | |
'control_rewind_blue.png' => 1, | |
'shape_handles.png' => 1, | |
'shape_group.png' => 1, | |
'shape_flip_vertical.png' => 1, | |
'control_start.png' => 1, | |
'shape_flip_horizontal.png' => 1, | |
'control_start_blue.png' => 1, | |
'shape_align_top.png' => 1, | |
'shape_align_right.png' => 1, | |
'shape_align_middle.png' => 1, | |
'script_key.png' => 1, | |
'script_go.png' => 1, | |
'shape_square_go.png' => 1, | |
'cup.png' => 1, | |
'rss_add.png' => 1, | |
'rss.png' => 1, | |
'rosette.png' => 1, | |
'resultset_previous.png' => 1, | |
'resultset_next.png' => 1, | |
'resultset_last.png' => 1, | |
'resultset_first.png' => 1, | |
'report_word.png' => 1, | |
'report_user.png' => 1, | |
'report_picture.png' => 1, | |
'report_magnify.png' => 1, | |
'rss_delete.png' => 1, | |
'cup_add.png' => 1, | |
'report_link.png' => 1, | |
'report_key.png' => 1, | |
'report_go.png' => 1, | |
'report_edit.png' => 1, | |
'report_disk.png' => 1, | |
'report_delete.png' => 1, | |
'cup_delete.png' => 1, | |
'report_add.png' => 1, | |
'cup_edit.png' => 1, | |
'css_valid.png' => 1, | |
'rss_go.png' => 1, | |
'controller_error.png' => 1, | |
'css_add.png' => 1, | |
'script_gear.png' => 1, | |
'creditcards.png' => 1, | |
'script_error.png' => 1, | |
'script_edit.png' => 1, | |
'cross.png' => 1, | |
'script_delete.png' => 1, | |
'css.png' => 1, | |
'script_code_red.png' => 1, | |
'script_code.png' => 1, | |
'script_add.png' => 1, | |
'script.png' => 1, | |
'rss_valid.png' => 1, | |
'ruby_put.png' => 1, | |
'ruby_link.png' => 1, | |
'ruby_key.png' => 1, | |
'ruby_go.png' => 1, | |
'css_delete.png' => 1, | |
'css_go.png' => 1, | |
'ruby_get.png' => 1, | |
'ruby_gear.png' => 1, | |
'ruby_delete.png' => 1, | |
'ruby_add.png' => 1, | |
'ruby.png' => 1, | |
'shape_square_error.png' => 1, | |
'shape_square_key.png' => 1, | |
'tag_blue.png' => 1, | |
'sum.png' => 1, | |
'color_swatch.png' => 1, | |
'table.png' => 1, | |
'tab_go.png' => 1, | |
'tab_edit.png' => 1, | |
'tab_delete.png' => 1, | |
'color_wheel.png' => 1, | |
'comment.png' => 1, | |
'comment_add.png' => 1, | |
'tab_add.png' => 1, | |
'tab.png' => 1, | |
'style_go.png' => 1, | |
'table_delete.png' => 1, | |
'style_edit.png' => 1, | |
'style_delete.png' => 1, | |
'style_add.png' => 1, | |
'style.png' => 1, | |
'stop.png' => 1, | |
'status_online.png' => 1, | |
'comment_delete.png' => 1, | |
'comment_edit.png' => 1, | |
'status_offline.png' => 1, | |
'status_busy.png' => 1, | |
'table_add.png' => 1, | |
'coins_delete.png' => 1, | |
'star.png' => 1, | |
'table_row_insert.png' => 1, | |
'tag.png' => 1, | |
'clock_stop.png' => 1, | |
'table_sort.png' => 1, | |
'cog.png' => 1, | |
'cog_add.png' => 1, | |
'cog_delete.png' => 1, | |
'cog_edit.png' => 1, | |
'cog_error.png' => 1, | |
'table_save.png' => 1, | |
'cog_go.png' => 1, | |
'table_row_delete.png' => 1, | |
'table_edit.png' => 1, | |
'table_relationship.png' => 1, | |
'table_refresh.png' => 1, | |
'table_multiple.png' => 1, | |
'table_link.png' => 1, | |
'coins.png' => 1, | |
'table_lightning.png' => 1, | |
'table_key.png' => 1, | |
'table_go.png' => 1, | |
'coins_add.png' => 1, | |
'table_gear.png' => 1, | |
'table_error.png' => 1, | |
'status_away.png' => 1, | |
'sport_tennis.png' => 1, | |
'shape_square_link.png' => 1, | |
'control_play.png' => 1, | |
'control_equalizer_blue.png' => 1, | |
'control_fastforward.png' => 1, | |
'control_fastforward_blue.png' => 1, | |
'sport_basketball.png' => 1, | |
'control_pause.png' => 1, | |
'sport_8ball.png' => 1, | |
'spellcheck.png' => 1, | |
'sound_none.png' => 1, | |
'sound_mute.png' => 1, | |
'control_pause_blue.png' => 1, | |
'sound_low.png' => 1, | |
'control_end_blue.png' => 1, | |
'sound_delete.png' => 1, | |
'sound_add.png' => 1, | |
'sound.png' => 1, | |
'sitemap_color.png' => 1, | |
'sitemap.png' => 1, | |
'control_play_blue.png' => 1, | |
'shield_go.png' => 1, | |
'shield_delete.png' => 1, | |
'shield_add.png' => 1, | |
'shield.png' => 1, | |
'shape_ungroup.png' => 1, | |
'control_equalizer.png' => 1, | |
'control_end.png' => 1, | |
'sport_soccer.png' => 1, | |
'computer_edit.png' => 1, | |
'comments.png' => 1, | |
'comments_add.png' => 1, | |
'sport_shuttlecock.png' => 1, | |
'comments_delete.png' => 1, | |
'sport_raquet.png' => 1, | |
'compress.png' => 1, | |
'sport_golf.png' => 1, | |
'computer.png' => 1, | |
'computer_add.png' => 1, | |
'computer_delete.png' => 1, | |
'computer_error.png' => 1, | |
'control_eject_blue.png' => 1, | |
'computer_go.png' => 1, | |
'computer_key.png' => 1, | |
'sport_football.png' => 1, | |
'computer_link.png' => 1, | |
'connect.png' => 1, | |
'contrast.png' => 1, | |
'contrast_decrease.png' => 1, | |
'contrast_high.png' => 1, | |
'contrast_increase.png' => 1, | |
'contrast_low.png' => 1, | |
'control_eject.png' => 1, | |
'gelfgl.php' => 1, | |
'tearrespectvalidationbundle.php' => 1, | |
'sync-install.sh' => 1, | |
'doc-parser' => 1, | |
'pdfmanager.php' => 1, | |
'ddpdfbundle.php' => 1, | |
'elementbuilder.php' => 1, | |
'phpclasseditor.php' => 1, | |
'phpirt.php' => 1, | |
'curl' => 1, | |
'tokenparser.php' => 1, | |
'dduserbundle.php' => 1, | |
'doc-parser.php' => 1, | |
'layoutmanager.php' => 1, | |
'tv' => 1, | |
'emadsystem.php' => 1, | |
'licence.bsd' => 1, | |
'divine.php' => 1, | |
'example-output.jpg' => 1, | |
'typoscript-lint' => 1, | |
'tslint.yml' => 1, | |
'tslint.dist.yml' => 1, | |
'go-pear.php' => 1, | |
'graphizer' => 1, | |
'.graphpizer.json' => 1, | |
'scrclubcmsbundle.php' => 1, | |
'ddfiltertypeguesserbundle.php' => 1, | |
'do' => 1, | |
'idnmacros.php' => 1, | |
'edemyeventbundle.php' => 1, | |
'readme_l4' => 1, | |
'edemythemebundle.php' => 1, | |
'edemyproductbundle.php' => 1, | |
'edemymathbundle.php' => 1, | |
'cmb2-related-links.php' => 1, | |
'ju1iuswebpackassetsbundle.php' => 1, | |
'edemymainbundle.php' => 1, | |
'juanber84profilercommandbundle.php' => 1, | |
'edemylinkbundle.php' => 1, | |
'edemyfbbundle.php' => 1, | |
'edemydesignbundle.php' => 1, | |
'csstestmatrix.html' => 1, | |
'juanber84simplei18nbundle.php' => 1, | |
'edemycustomerbundle.php' => 1, | |
'monologplugin.php' => 1, | |
'edemycrawlerbundle.php' => 1, | |
'ddcdnbundle.php' => 1, | |
'edemycartbundle.php' => 1, | |
'edemycarruselbundle.php' => 1, | |
'edemybookingbundle.php' => 1, | |
'edemybackupbundle.php' => 1, | |
'edemybackgroundbundle.php' => 1, | |
'edemyagendabundle.php' => 1, | |
'debugwrapper.php' => 1, | |
'hoathisresourcelocatorbundle.php' => 1, | |
'edemywikibundle.php' => 1, | |
'class-tlc-transient-update-server.php' => 1, | |
'travis_config.ini' => 1, | |
'.stickler.yml' => 1, | |
'markpavlitskiconstraintextrabundle.php' => 1, | |
'pluploadwidget.php' => 1, | |
'phpunit-teardown.php' => 1, | |
'phpunit-config.php' => 1, | |
'ensurecoverage.sh' => 1, | |
'mlphp-ghpages.ini' => 1, | |
'tlc-transients.php' => 1, | |
'class-tlc-transient.php' => 1, | |
'server_time.php' => 1, | |
'package.py' => 1, | |
'_sync_types.php' => 1, | |
'testloop.sh' => 1, | |
'xxammailclientbundle.php' => 1, | |
'composerfuture.json' => 1, | |
'layoutfuture.php' => 1, | |
'breakfast.xml' => 1, | |
'imgbuilder.php' => 1, | |
'accounts-woocommerce-plugin.php' => 1, | |
'__condorcetautoload.php' => 1, | |
'condorcet-logo.png' => 1, | |
'luminous' => 1, | |
'supported.php' => 1, | |
'catcha.php' => 1, | |
'initial_document' => 1, | |
'jucevejuflowchartbundle.php' => 1, | |
'tab.phtml' => 1, | |
'supportedmutations' => 1, | |
'jusimplesearchbundle.php' => 1, | |
'ieditable.php' => 1, | |
'babelfish.php' => 1, | |
'cmssettings.php' => 1, | |
'push-server.php' => 1, | |
'dokumentacja.html' => 1, | |
'pushconnection.php' => 1, | |
'marshmninkbundle.php' => 1, | |
'versioncheck.php' => 1, | |
'savegridpaginationbehavior.php' => 1, | |
'savegridfiltersbehavior.php' => 1, | |
'videothumb.php' => 1, | |
'marquesbehavior.php' => 1, | |
'jackalope.db' => 1, | |
'updgrade-2.0-dev' => 1, | |
'marmelabsonataelasticabundle.php' => 1, | |
'marmelabngadmingeneratorbundle.php' => 1, | |
'slim.php' => 1, | |
'wp-on-routes.php' => 1, | |
'awesomeheader.php' => 1, | |
'sample.log' => 1, | |
'dynamodbwrapper.php' => 1, | |
'mabaoauthcommerceproxybundle.php' => 1, | |
'asdadmbundle.php' => 1, | |
'teocorebundle.php' => 1, | |
'ginny.dist.yml' => 1, | |
'advemail.php' => 1, | |
'tordf-0111-in.jsonld' => 1, | |
'cjsdeliverybundle.php' => 1, | |
'cjsdelivery.php' => 1, | |
'itsdangerous.php' => 1, | |
'iptools.php' => 1, | |
'developer_detection.php' => 1, | |
'debugging.php' => 1, | |
'tordf-0111-out.nq' => 1, | |
'sluggenerator.php' => 1, | |
'categorieswidget.ss' => 1, | |
'categorieswidget.php' => 1, | |
'.travis_redis.sh' => 1, | |
'xlproc.php' => 1, | |
'examples-config.json.template' => 1, | |
'php-makeup' => 1, | |
'php-make-up.php' => 1, | |
'gitspam.sh' => 1, | |
'tordf-0112-in.jsonld' => 1, | |
'tordf-0112-out.nq' => 1, | |
'teodb18nbundle.php' => 1, | |
'teoproductbundle.php' => 1, | |
'gitspam.php' => 1, | |
'cypresslesselephantbundle.php' => 1, | |
'magic_forms.info' => 1, | |
'tordf-0105-in.jsonld' => 1, | |
'tordf-0105-out.nq' => 1, | |
'tordf-0106-in.jsonld' => 1, | |
'examples.inc' => 1, | |
'gulpfile.coffee' => 1, | |
'cypressdidebuggerbundle.php' => 1, | |
'cypresspygmentselephantbundle.php' => 1, | |
'tordf-0106-out.nq' => 1, | |
'tordf-0107-in.jsonld' => 1, | |
'tordf-0107-out.nq' => 1, | |
'teoboilerplatebundle.php' => 1, | |
'tordf-0108-in.jsonld' => 1, | |
'cypressgitelephantbundle.php' => 1, | |
'cypresstreebundle.php' => 1, | |
'cypressfixturesbundle.php' => 1, | |
'tordf-0108-out.nq' => 1, | |
'tordf-0109-in.jsonld' => 1, | |
'tordf-0109-out.nq' => 1, | |
'tordf-0110-in.jsonld' => 1, | |
'tordf-0110-out.nq' => 1, | |
'cypressconsoledefaultsbundle.php' => 1, | |
'cypresscompasselephantbundle.php' => 1, | |
'tordf-0113-in.jsonld' => 1, | |
'behat.ci.yml' => 1, | |
'tordf-manifest.jsonld' => 1, | |
'tordf-0118-in.jsonld' => 1, | |
'crud.class.php' => 1, | |
'function.script.php' => 1, | |
'function.css.php' => 1, | |
'velikonjalabbybundle.php' => 1, | |
'nb-configuration.xml' => 1, | |
'mumscrum-db-bak-latest.sql' => 1, | |
'tordf-0117-in.jsonld' => 1, | |
'tordf-0117-out.nq' => 1, | |
'insur-leav-type.sql' => 1, | |
'.springbeans' => 1, | |
'tordf-0118-out.nq' => 1, | |
'otbsbundle.php' => 1, | |
'tordf-0119-in.jsonld' => 1, | |
'massivesearchbundle.php' => 1, | |
'massivebuildbundle.php' => 1, | |
'epnumberstowordsbundle.php' => 1, | |
'massilmultiuserbundle.php' => 1, | |
'phptube.php' => 1, | |
'phpman.php' => 1, | |
'phpman.phar' => 1, | |
'tordf-0119-out.nq' => 1, | |
'asmmarkdowncontentbundle.php' => 1, | |
'routes.class.php' => 1, | |
'non-production-robots-ignore.php' => 1, | |
'customersupportbundle.php' => 1, | |
'customnavblocks.php' => 1, | |
'debug' => 1, | |
'axiolabbootstrapselectbundle.php' => 1, | |
'tordf-0113-out.nq' => 1, | |
'tordf-0114-in.jsonld' => 1, | |
'tordf-0114-out.nq' => 1, | |
'tordf-0115-in.jsonld' => 1, | |
'tordf-0115-out.nq' => 1, | |
'uml.class.violet' => 1, | |
'glue.class.violet.html' => 1, | |
'mathielenimportenginebundle.php' => 1, | |
'matheouserbundle.php' => 1, | |
'gorgcasbundle.php' => 1, | |
'migrant' => 1, | |
'docker.sh' => 1, | |
'gorguserbundle.php' => 1, | |
'gorgreplicationtriggerbundle.php' => 1, | |
'pdepend.xsl' => 1, | |
'cpd.xsl' => 1, | |
'gorgldapormbundle.php' => 1, | |
'tordf-0116-in.jsonld' => 1, | |
'gorgjirabundle.php' => 1, | |
'gorggramapiclientbundle.php' => 1, | |
'tordf-0116-out.nq' => 1, | |
'condorcet-logo.psd' => 1, | |
'mabaoauthcommerceencryptedcredentialsbundle.php' => 1, | |
'magic_forms.module' => 1, | |
'sync.ini.example' => 1, | |
'bootstrapnotifyalertasset.php' => 1, | |
'flashalert.php' => 1, | |
'mapadotwigextensionsbundle.php' => 1, | |
'taggingasset.php' => 1, | |
'taggingquery.php' => 1, | |
'taggingwidget.php' => 1, | |
'manyrussmsbundle.php' => 1, | |
'logomb.jpg' => 1, | |
'itplogo.png' => 1, | |
'flow' => 1, | |
'wssepassworddigestcreator.php' => 1, | |
'message-board.php' => 1, | |
'addons' => 1, | |
'options' => 1, | |
'wsseheadersfactory.php' => 1, | |
'wsseserverbundle.php' => 1, | |
'kusf2utilsbundle.php' => 1, | |
'date-picker-cs.js' => 1, | |
'ventasconfig.php' => 1, | |
'uploaddatabundle.php' => 1, | |
'configprovider.php' => 1, | |
'ssoserverbundle' => 1, | |
'mapadotypeaheadjsbundle.php' => 1, | |
'hybrid.php' => 1, | |
'kussoserverbundle.php' => 1, | |
'polylang-translate-rewrite-slugs.php' => 1, | |
'oxrun.phar' => 1, | |
'test_mysql.php' => 1, | |
'test_mysql_timeout.php' => 1, | |
'gizlabdoctrinebundle.php' => 1, | |
'readme.1.3.x' => 1, | |
'hooker.yml.dist' => 1, | |
'obhighchartsbundle.php' => 1, | |
'obcmsbundle.php' => 1, | |
'obcachenukebundle.php' => 1, | |
'oauth-server.php' => 1, | |
'readme.src' => 1, | |
'mockingjconsole' => 1, | |
'important' => 1, | |
'asanastrategy.php' => 1, | |
'documentation.pdf' => 1, | |
'consoler.php' => 1, | |
'mapbenderfeatureinfobundle.php' => 1, | |
'mapbenderdigitizerbundle.php' => 1, | |
'mapbendermaptoolbundle.php' => 1, | |
'vice.php' => 1, | |
'openuserbundle.php' => 1, | |
'mapbendergeotransporterbundle.php' => 1, | |
'mapbenderdatasourcebundle.php' => 1, | |
'ssoevents.php' => 1, | |
'kussoclientbundle.php' => 1, | |
'epilog' => 1, | |
'mb_str_replace_license' => 1, | |
'base-files.zip' => 1, | |
'jhomepermissionsbundle.php' => 1, | |
'supervisor.conf.example' => 1, | |
'htme.php' => 1, | |
'web_tester.sh' => 1, | |
'web_tester.json' => 1, | |
'datatext.php' => 1, | |
'emma_config.php' => 1, | |
'repositoryasaservicebundle.php' => 1, | |
'admin.crt' => 1, | |
'safety.png' => 1, | |
'jhvuserevents.php' => 1, | |
'fa' => 1, | |
'rest.sql' => 1, | |
'orm_validation.php' => 1, | |
'orm_table.php' => 1, | |
'orm_primary_key.php' => 1, | |
'orm_model.php' => 1, | |
'holiday_jp' => 1, | |
'imgin.php' => 1, | |
'orm_field.php' => 1, | |
'orm_association.php' => 1, | |
'mangatibasebundle.php' => 1, | |
'comingsoon' => 1, | |
'presupuestobundle.php' => 1, | |
'saveprice.php' => 1, | |
'manueltranslationbundle.php' => 1, | |
'manuelajaxflashbundle.php' => 1, | |
'kuajaxbundle.php' => 1, | |
'ajaxhandler.php' => 1, | |
'labobundle.php' => 1, | |
'labotestmanubundle.php' => 1, | |
'ajaxcontentmixed.html' => 1, | |
'uploadlink.php' => 1, | |
'date-picker.js' => 1, | |
'uploadfile.php' => 1, | |
'template.phtml' => 1, | |
'jhvuserbundle.php' => 1, | |
'jhveasyinheritancemappingbundle.php' => 1, | |
'parseryml.php' => 1, | |
'parserjson.php' => 1, | |
'parserexcel.php' => 1, | |
'parsefileinterface.php' => 1, | |
'jhvpaymentcorebundle.php' => 1, | |
'jhvpaymentplugincobrebembundle.php' => 1, | |
'jhvpaymentservicebundle.php' => 1, | |
'jhvseobundle.php' => 1, | |
'readme-old' => 1, | |
'manager.sql' => 1, | |
'settingsindbbundle.php' => 1, | |
'bootstrap-phar.php' => 1, | |
'atys.png' => 1, | |
'jumalepagemetabundle.php' => 1, | |
'marduke182twigbundle.php' => 1, | |
'marcwserversideanalyticsbundle.php' => 1, | |
'jumaleattachmentbundle.php' => 1, | |
'countries.aggregate.php' => 1, | |
'cccn.php' => 1, | |
'marcwwurstbundle.php' => 1, | |
'marcvsqldumpbundle.php' => 1, | |
'lerconfig.php' => 1, | |
'inutilizar.php' => 1, | |
'imprimircce.php' => 1, | |
'openidconnectclient.php' => 1, | |
'opaqueencoder.php' => 1, | |
'danfe.php' => 1, | |
'cancelar.php' => 1, | |
'nfefacade.php' => 1, | |
'ping.php' => 1, | |
'dmrbundle.php' => 1, | |
'marcoshoyaboletophpbundle.php' => 1, | |
'sphinxbundle.php' => 1, | |
'class.smushit.php' => 1, | |
'client_example.php' => 1, | |
'mlbdagbundle.php' => 1, | |
'kurzor_config.php.sample' => 1, | |
'opaque.py' => 1, | |
'jsonbehavior.php' => 1, | |
'latestblogs.php' => 1, | |
'simpleresize.php' => 1, | |
'tubular.php' => 1, | |
'tubularasset.php' => 1, | |
'mabaoauthcommercecommonbundle.php' => 1, | |
'wake.php' => 1, | |
'animate.php' => 1, | |
'702.gif' => 1, | |
'review.php' => 1, | |
'latestblogs.ss' => 1, | |
'buzzbundle.php' => 1, | |
'blogeventdates.php' => 1, | |
'jumaleadminbundle.php' => 1, | |
'blogarchivemenuwidget.ss' => 1, | |
'buzzprofilerbundle.php' => 1, | |
'blogarchivemenuwidget.php' => 1, | |
'my_opml_file.xml' => 1, | |
'simpleitclaireexercisebundle.php' => 1, | |
'gearman.php' => 1, | |
'embedded.php' => 1, | |
'jdformbundle.php' => 1, | |
'butterweedsf1embedderbundle.php' => 1, | |
'fastrelibravatarbundle.php' => 1, | |
'testvectors' => 1, | |
'attributebehavior.php' => 1, | |
'dbad.license' => 1, | |
'__functions.php' => 1, | |
'payments.php' => 1, | |
'xeditableasset.php' => 1, | |
'chartpluginasset.php' => 1, | |
'xeditableaction.php' => 1, | |
'xeditable.php' => 1, | |
'test_dns_strings.php' => 1, | |
'wysihtml5asset.php' => 1, | |
'typeaheadnewasset.php' => 1, | |
'combodateasset.php' => 1, | |
'yii2_readme' => 1, | |
'yii2_license' => 1, | |
'menu.sql' => 1, | |
'all_tests.html' => 1, | |
'nestedsortableaction.php' => 1, | |
'tks.php' => 1, | |
'sample_config.php' => 1, | |
'jsonfcts.php' => 1, | |
'bd_field.php' => 1, | |
'auto-bd-class.php' => 1, | |
'540.php' => 1, | |
'yay_pretty.php' => 1, | |
'yay_parse.php' => 1, | |
'yay_compile.php' => 1, | |
'alltests.js' => 1, | |
'xeditablechecklist.php' => 1, | |
'wp_serve_file.php' => 1, | |
'configglobal.php' => 1, | |
'ð¡allablebehavior.php' => 1, | |
'captchainterface.php' => 1, | |
'vkbase.php' => 1, | |
'mjstwigapplyfilterbundle.php' => 1, | |
'workspacebehaviorpeer.php' => 1, | |
'workspacebehaviorclass.php' => 1, | |
'workspacebehavior.php' => 1, | |
'ramblerwebdriver.php' => 1, | |
'vkwebdriver.php' => 1, | |
'webdriverbase.php' => 1, | |
'gitlog' => 1, | |
'xeditablecolumn.php' => 1, | |
'frontcontroler.php' => 1, | |
'pch' => 1, | |
'xeditablewysihtml5.php' => 1, | |
'xeditabletextarea.php' => 1, | |
'xeditabletext.php' => 1, | |
'xeditableselect.php' => 1, | |
'xeditabledatetime.php' => 1, | |
'xeditabledate.php' => 1, | |
'doctrinedumpfixturesbundle.php' => 1, | |
'xeditableconfig.php' => 1, | |
'xeditablecombodate.php' => 1, | |
'magic_forms.install' => 1, | |
'logcounter' => 1, | |
'origami.sql' => 1, | |
'nodenotfoundexception.php' => 1, | |
'class.messages.php' => 1, | |
'envato_marketplaces.php' => 1, | |
'melifarobookingbundle.php' => 1, | |
'tordf-0057-in.jsonld' => 1, | |
'console_table.php' => 1, | |
'stringbuilder.php' => 1, | |
'tordf-0057-out.nq' => 1, | |
'quickaccesstrait.php' => 1, | |
'queryableexception.php' => 1, | |
'queryable.php' => 1, | |
'invalidexpressionexception.php' => 1, | |
'tordf-0056-in.jsonld' => 1, | |
'badtypeexception.php' => 1, | |
'tordf-0058-in.jsonld' => 1, | |
'tordf-0058-out.nq' => 1, | |
'tordf-0059-in.jsonld' => 1, | |
'rawexample.php' => 1, | |
'resamplr.php' => 1, | |
'spell_it.gemspec' => 1, | |
'recordlogger.php' => 1, | |
'serializeconverter.php' => 1, | |
'relatedconverter.php' => 1, | |
'tordf-0056-out.nq' => 1, | |
'tordf-0055-out.nq' => 1, | |
'tordf-0059-out.nq' => 1, | |
'sample.ini' => 1, | |
'meedivideobundle.php' => 1, | |
'lesspls.php' => 1, | |
'lesspls' => 1, | |
'emojiformat.php' => 1, | |
'online_check.php' => 1, | |
'tordf-0052-out.nq' => 1, | |
'tordf-0053-in.jsonld' => 1, | |
'tordf-0053-out.nq' => 1, | |
'cleancache.php' => 1, | |
'mlpostmasterbundle.php' => 1, | |
'yazquery.php' => 1, | |
'config.testing.php' => 1, | |
'parserini.php' => 1, | |
'parsequery.php' => 1, | |
'tordf-0054-in.jsonld' => 1, | |
'tordf-0054-out.nq' => 1, | |
'parserserviceprovider.php' => 1, | |
'marcxml.php' => 1, | |
'tordf-0055-in.jsonld' => 1, | |
'skoap-build.sublime-project' => 1, | |
'travs-config.ini' => 1, | |
'queueing-example.php' => 1, | |
'example-worker.php' => 1, | |
'numeralconverter.php' => 1, | |
'enumtrait.php' => 1, | |
'class.javascriptpacker.php4' => 1, | |
'tordf-0069-in.jsonld' => 1, | |
'tordf-0067-in.jsonld' => 1, | |
'mcwebbnormalizeddatabundle.php' => 1, | |
'phiremock.phar' => 1, | |
'example.yaml' => 1, | |
'regression.phar' => 1, | |
'tordf-0067-out.nq' => 1, | |
'money.phar' => 1, | |
'linear-algebra.phar' => 1, | |
'tordf-0068-in.jsonld' => 1, | |
'tordf-0068-out.nq' => 1, | |
'debug.inc.php' => 1, | |
'relatedsearchbehavior.php' => 1, | |
'glyphicons.png' => 1, | |
'libphonenumber.php' => 1, | |
'tordf-0069-out.nq' => 1, | |
'tordf-0070-in.jsonld' => 1, | |
'tordf-0070-out.nq' => 1, | |
'tordf-0071-in.jsonld' => 1, | |
'tordf-0071-out.nq' => 1, | |
'tordf-0072-in.jsonld' => 1, | |
'tordf-0072-out.nq' => 1, | |
'tordf-0073-in.jsonld' => 1, | |
'keenactivedataprovider.php' => 1, | |
'symfonypersiajalalidatebundle.php' => 1, | |
'enumconverter.php' => 1, | |
'tordf-0062-in.jsonld' => 1, | |
'tordf-0060-in.jsonld' => 1, | |
'dateconverter.php' => 1, | |
'clientbehavior.php' => 1, | |
'tordf-0060-out.nq' => 1, | |
'checkreload.php' => 1, | |
'appcache.php' => 1, | |
'tordf-0061-in.jsonld' => 1, | |
'tordf-0061-out.nq' => 1, | |
'autonumbervalidator.php' => 1, | |
'autonumber.php' => 1, | |
'tordf-0062-out.nq' => 1, | |
'tordf-0066-out.nq' => 1, | |
'tordf-0063-in.jsonld' => 1, | |
'relationuniquevalidator.php' => 1, | |
'tordf-0063-out.nq' => 1, | |
'tordf-0064-in.jsonld' => 1, | |
'queryscopebehavior.php' => 1, | |
'tordf-0064-out.nq' => 1, | |
'verifycontroller.php' => 1, | |
'tordf-0065-in.jsonld' => 1, | |
'entercode.php' => 1, | |
'tordf-0065-out.nq' => 1, | |
'tordf-0066-in.jsonld' => 1, | |
'tordf-0052-in.jsonld' => 1, | |
'example-file.php' => 1, | |
'tordf-0074-in.jsonld' => 1, | |
'tordf-0036-in.jsonld' => 1, | |
'mespronos.info.yml' => 1, | |
'mespronos_website.profile' => 1, | |
'mespronos_website.install' => 1, | |
'mespronos_website.info.yml' => 1, | |
'mespronos_front.theme' => 1, | |
'mespronos_front.libraries.yml' => 1, | |
'mespronos_front.info.yml' => 1, | |
'tordf-0035-in.jsonld' => 1, | |
'tordf-0035-out.nq' => 1, | |
'langselector.php' => 1, | |
'md.php' => 1, | |
'mespronos.libraries.yml' => 1, | |
'tordf-0036-out.nq' => 1, | |
'emojioneasset.php' => 1, | |
'manymanybehavior.php' => 1, | |
'aaencoder.php' => 1, | |
'aadecoder.php' => 1, | |
'curlhelper.php' => 1, | |
'tordf-0041-in.jsonld' => 1, | |
'tordf-0041-out.nq' => 1, | |
'smarttest.php' => 1, | |
'merobasebundle.php' => 1, | |
'mespronos.install' => 1, | |
'mespronos.links.action.yml' => 1, | |
'tordf-0042-out.nq' => 1, | |
'metalvarezcommentsbundle.php' => 1, | |
'tordf-0029-in.jsonld' => 1, | |
'tordf-0029-out.nq' => 1, | |
'tordf-0030-in.jsonld' => 1, | |
'tordf-0030-out.nq' => 1, | |
'metator' => 1, | |
'rdap.php' => 1, | |
'retro.php' => 1, | |
'metalvarezvotingbundle.php' => 1, | |
'tordf-0031-in.jsonld' => 1, | |
'tordf-0031-out.nq' => 1, | |
'tordf-0032-in.jsonld' => 1, | |
'tordf-0034-out.nq' => 1, | |
'metaclassauthenticationguardbundle.php' => 1, | |
'mespronos.services.yml' => 1, | |
'mespronos.routing.yml' => 1, | |
'tordf-0032-out.nq' => 1, | |
'tordf-0033-in.jsonld' => 1, | |
'mespronos.permissions.yml' => 1, | |
'mespronos.module' => 1, | |
'tordf-0033-out.nq' => 1, | |
'tordf-0034-in.jsonld' => 1, | |
'mespronos.links.task.yml' => 1, | |
'mespronos.links.menu.yml' => 1, | |
'tordf-0042-in.jsonld' => 1, | |
'testsimpletemplate.php' => 1, | |
'example-inline.php' => 1, | |
'tordf-0047-out.nq' => 1, | |
'cli-composer-config.json' => 1, | |
'sellsyapibundle.php' => 1, | |
'multipleinheritancebundle.php' => 1, | |
'mefdcontaofoundationbundle.php' => 1, | |
'tordf-0044-out.nq' => 1, | |
'tordf-0045-in.jsonld' => 1, | |
'tordf-0045-out.nq' => 1, | |
'tordf-0046-in.jsonld' => 1, | |
'tordf-0046-out.nq' => 1, | |
'tordf-0047-in.jsonld' => 1, | |
'tordf-0048-in.jsonld' => 1, | |
'access.xml' => 1, | |
'tordf-0048-out.nq' => 1, | |
'tordf-0049-in.jsonld' => 1, | |
'tordf-0049-out.nq' => 1, | |
'tordf-0050-in.jsonld' => 1, | |
'tordf-0050-out.nq' => 1, | |
'tordf-0051-in.jsonld' => 1, | |
'tordf-0051-out.nq' => 1, | |
'mefdcommonbundle.php' => 1, | |
'testshipment.php' => 1, | |
'testparcelstatus.php' => 1, | |
'test_services.dist.json' => 1, | |
'lang.xml' => 1, | |
'testheadlinks.php' => 1, | |
'currentinstallation.png' => 1, | |
'phartest.php' => 1, | |
'envmap.php' => 1, | |
'merkdoughbundle.php' => 1, | |
'phpunit.jenkins.xml' => 1, | |
'merchiumclient.php' => 1, | |
'insomniamaxmindgeoipbundle.php' => 1, | |
'tordf-0043-in.jsonld' => 1, | |
'ctocommunication.php' => 1, | |
'move.psd' => 1, | |
'frontendcheckboxmenu.png' => 1, | |
'clipboard.psd' => 1, | |
'parsers.xml' => 1, | |
'puphpet.json' => 1, | |
'memeoirspaymillbundle.php' => 1, | |
'tordf-0043-out.nq' => 1, | |
'tordf-0044-in.jsonld' => 1, | |
'dbase.php' => 1, | |
'memaw-phpcs.php.dist' => 1, | |
'melnikovedpopplerbundle.php' => 1, | |
'mekrasoberegbundle.php' => 1, | |
'xmlserver.php' => 1, | |
'urlhandler.php' => 1, | |
'router.xml' => 1, | |
'tordf-0073-out.nq' => 1, | |
'tordf-0074-out.nq' => 1, | |
'mysql2pdoexception.php' => 1, | |
'tordf-0092-out.nq' => 1, | |
'cartasi.php' => 1, | |
'tordf-0091-out.nq' => 1, | |
'laravel-installer' => 1, | |
'darkwoodgeneratorbundle.php' => 1, | |
'torfeed.php' => 1, | |
'tpbtorfeedhandler.php' => 1, | |
'standardtorfeedhandler.php' => 1, | |
'matuckmenubundle.php' => 1, | |
'kickasstorfeedhandler.php' => 1, | |
'tordf-0092-in.jsonld' => 1, | |
'matuckaliasbundle.php' => 1, | |
'appwebuser.php' => 1, | |
'mattwellss_magentocomposerautoloader.xml' => 1, | |
'mahangosignupbundle.php' => 1, | |
'tordf-0093-in.jsonld' => 1, | |
'tordf-0093-out.nq' => 1, | |
'tordf-0094-in.jsonld' => 1, | |
'tordf-0094-out.nq' => 1, | |
'mattvickharvestappbundle.php' => 1, | |
'tordf-0095-in.jsonld' => 1, | |
'mattschesvulnerabilitiesbundle.php' => 1, | |
'mattschesversioneyebundle.php' => 1, | |
'ajaxreturnobject.php' => 1, | |
'tordf-0091-in.jsonld' => 1, | |
'servicedefinitionvalidatorinterface.php' => 1, | |
'tordf-0088-out.nq' => 1, | |
'parsedownconverter.php' => 1, | |
'sculpineditorbundle.php' => 1, | |
'phpcs.conf.dist' => 1, | |
'.pairs' => 1, | |
'findbundle.php' => 1, | |
'twitterwidget.php' => 1, | |
'tordf-0087-out.nq' => 1, | |
'tordf-0088-in.jsonld' => 1, | |
'twittertweet.php' => 1, | |
'twitterreader.php' => 1, | |
'updatewidget.php' => 1, | |
'tordf-0090-out.nq' => 1, | |
'telegrambot.php' => 1, | |
'photosize.php' => 1, | |
'tordf-0089-in.jsonld' => 1, | |
'rpslswidget.php' => 1, | |
'rpslsasset.php' => 1, | |
'workinprogresswidget.php' => 1, | |
'tordf-0089-out.nq' => 1, | |
'passwordhelper.php' => 1, | |
'namedactiverecord.php' => 1, | |
'emailvalidator.php' => 1, | |
'tordf-0090-in.jsonld' => 1, | |
'tordf-0095-out.nq' => 1, | |
'servicedefinitionvalidatorfactoryinterface.php' => 1, | |
'projects.php' => 1, | |
'tordf-0103-in.jsonld' => 1, | |
'servicecontainerinterface.php' => 1, | |
'tordf-0102-in.jsonld' => 1, | |
'refactoring' => 1, | |
'nobackdoctrineormvalueobjectbundle.php' => 1, | |
'matthiaslazyservicesbundle.php' => 1, | |
'matthiasconsolecommandgeneratorbundle.php' => 1, | |
'.cauditor.yml' => 1, | |
'ogone.php' => 1, | |
'bayerjsonapibundle.php' => 1, | |
'tordf-0102-out.nq' => 1, | |
'test_v11.php' => 1, | |
'argumentvalidatorinterface.php' => 1, | |
'tordf-0103-out.nq' => 1, | |
'mysql_test_schema.sql' => 1, | |
'mysql_test_results' => 1, | |
'mysql_test_after.php' => 1, | |
'mysql_test.php' => 1, | |
'mysql_functions.php' => 1, | |
'tordf-0104-in.jsonld' => 1, | |
'mysql_example.php' => 1, | |
'mysql_definitions.php' => 1, | |
'tordf-0104-out.nq' => 1, | |
'argumentvalidator.php' => 1, | |
'argumentsvalidator.php' => 1, | |
'tordf-0096-in.jsonld' => 1, | |
'tordf-0098-out.nq' => 1, | |
'tordf-0096-out.nq' => 1, | |
'tordf-0097-in.jsonld' => 1, | |
'servicedefinitionvalidatorfactory.php' => 1, | |
'tordf-0097-out.nq' => 1, | |
'servicedefinitionvalidator.php' => 1, | |
'resultingclassresolverinterface.php' => 1, | |
'resultingclassresolver.php' => 1, | |
'methodcallsvalidatorinterface.php' => 1, | |
'tordf-0098-in.jsonld' => 1, | |
'methodcallsvalidator.php' => 1, | |
'tordf-0099-in.jsonld' => 1, | |
'argumentsvalidatorinterface.php' => 1, | |
'definitionargumentsvalidatorinterface.php' => 1, | |
'tordf-0099-out.nq' => 1, | |
'tordf-0100-in.jsonld' => 1, | |
'tordf-0100-out.nq' => 1, | |
'tordf-0101-in.jsonld' => 1, | |
'tordf-0101-out.nq' => 1, | |
'definitionargumentsvalidator.php' => 1, | |
'constructorresolverinterface.php' => 1, | |
'constructorresolver.php' => 1, | |
'batchservicedefinitionvalidatorinterface.php' => 1, | |
'batchservicedefinitionvalidator.php' => 1, | |
'tordf-0087-in.jsonld' => 1, | |
'sculpinprojectsbundle.php' => 1, | |
'tordf-0075-in.jsonld' => 1, | |
'mazuploadclass.php' => 1, | |
'varnishpurger.php' => 1, | |
'varnishpurgeprovider.php' => 1, | |
'livephpmonitor.php' => 1, | |
'livephp.js' => 1, | |
'livephpbundle.php' => 1, | |
'phpinteractorbundle.php' => 1, | |
'mboptimizationbundle.php' => 1, | |
'mbdashboardbundle.php' => 1, | |
'menumodules.php' => 1, | |
'hartija.html' => 1, | |
'processingbundle.php' => 1, | |
'tordf-0080-out.nq' => 1, | |
'mazarinisluggerbundle.php' => 1, | |
'redisenablebundle.php' => 1, | |
'responseevent.php' => 1, | |
'notificationerrorevent.php' => 1, | |
'mayeconotificationsbundle.php' => 1, | |
'mayecoinvoicesbundle.php' => 1, | |
'mayecogooglebundle.php' => 1, | |
'tordf-0081-out.nq' => 1, | |
'easyannotationbundle.php' => 1, | |
'tinymcewidget.php' => 1, | |
'tordf-0081-in.jsonld' => 1, | |
'tordf-0080-in.jsonld' => 1, | |
'owlcarouselwidget.php' => 1, | |
'dataparserapplication.php' => 1, | |
'tordf-0075-out.nq' => 1, | |
'tordf-0076-in.jsonld' => 1, | |
'tordf-0076-out.nq' => 1, | |
'tordf-0077-in.jsonld' => 1, | |
'tordf-0077-out.nq' => 1, | |
'tordf-0078-in.jsonld' => 1, | |
'tordf-0078-out.nq' => 1, | |
'mch0licopenflashchartbundle.php' => 1, | |
'wp-recaptcha-integration.php' => 1, | |
'mkzip.sh' => 1, | |
'softwaredeskbiketraderapibundle.php' => 1, | |
'ffixture.php' => 1, | |
'contact-process.php' => 1, | |
'flashmessagehandlerbundle.php' => 1, | |
'tordf-0079-in.jsonld' => 1, | |
'eventhubbundle.php' => 1, | |
'cleanvendorscontroller.php' => 1, | |
'cleanassetscontroller.php' => 1, | |
'zf2base.sql' => 1, | |
'zf2base-workflow.jpg' => 1, | |
'makutaclientbundle.php' => 1, | |
'ffixtureseed.php' => 1, | |
'tordf-0079-out.nq' => 1, | |
'tinymcecustomasset.php' => 1, | |
'owlcarouselasset.php' => 1, | |
'redirectgenerator.php' => 1, | |
'tordf-0085-out.nq' => 1, | |
'tordf-0083-out.nq' => 1, | |
'testit' => 1, | |
'tordf-0084-in.jsonld' => 1, | |
'build_archive.sh' => 1, | |
'tordf-0084-out.nq' => 1, | |
'harvester.php' => 1, | |
'tordf-0085-in.jsonld' => 1, | |
'githubapibundle.php' => 1, | |
'navbar.tpl' => 1, | |
'materialize.yml' => 1, | |
'blog_post.tpl' => 1, | |
'imagefilevalidator.php' => 1, | |
'blog.tpl' => 1, | |
'keyword-generator.php' => 1, | |
'common-words-ru_ru.php' => 1, | |
'tordf-0086-in.jsonld' => 1, | |
'twigpress.php' => 1, | |
'tordf-0086-out.nq' => 1, | |
'phpunit.dist' => 1, | |
'nginx-conf-parser' => 1, | |
'mawiajaxautocompletebundle.php' => 1, | |
'console.config.php' => 1, | |
'sculpinredirectbundle.php' => 1, | |
'testit.config.yml' => 1, | |
'imageprocessor.php' => 1, | |
'minifymanager.php' => 1, | |
'angularmainasset.php' => 1, | |
'minifyhelper.php' => 1, | |
'searchtrait.php' => 1, | |
'processfilterevent.php' => 1, | |
'additionstrait.php' => 1, | |
'fullpagejswidget.php' => 1, | |
'fullpagejsasset.php' => 1, | |
'tordf-0082-in.jsonld' => 1, | |
'appbootstrap.php' => 1, | |
'angularsanitizeasset.php' => 1, | |
'tordf-0082-out.nq' => 1, | |
'angulari18nasset.php' => 1, | |
'imageprocessorcontroller.php' => 1, | |
'angularuirouterasset.php' => 1, | |
'gc-example.php' => 1, | |
'maxmodegeneratorbundle.php' => 1, | |
'.travis-test.sh' => 1, | |
'.travis-install-prereqs.sh' => 1, | |
'.coveralls-phpunit.xml.dist' => 1, | |
'maxmind-db' => 1, | |
'readme.dev' => 1, | |
'jsviewsasset.php' => 1, | |
'tordf-0083-in.jsonld' => 1, | |
'imagevalidator.php' => 1, | |
'po.png' => 1, | |
'my_form_validation.php' => 1, | |
'demo-general.php' => 1, | |
'whhgasset.php' => 1, | |
'openiconicasset.php' => 1, | |
'multisitelanguageswitcher.php' => 1, | |
'sociconasset.php' => 1, | |
'phpct.yml' => 1, | |
'typiconsasset.php' => 1, | |
'mylogphp.class.php' => 1, | |
'uniasset.php' => 1, | |
'crudbundle.php' => 1, | |
'codekit-config.json' => 1, | |
'lanewechat.php' => 1, | |
'ipinfo.php' => 1, | |
'tweetercorebundle.php' => 1, | |
'agentdetect.php' => 1, | |
'livsisdtoolsbundle.php' => 1, | |
'ipinfoasset.php' => 1, | |
'dosuserbundle.php' => 1, | |
'html5input.php' => 1, | |
'html5inputasset.php' => 1, | |
'pluginassetbundle.php' => 1, | |
'translationtrait.php' => 1, | |
'dossmsbundle.php' => 1, | |
'dossettingsbundle.php' => 1, | |
'octiconsasset.php' => 1, | |
'cubebundle.php' => 1, | |
'syliusmediabundle.php' => 1, | |
'cache-clear' => 1, | |
'db-login' => 1, | |
'db-credentials' => 1, | |
'db-backup' => 1, | |
'coverage-report' => 1, | |
'coverage-ensure' => 1, | |
'composer-reinstall' => 1, | |
'composer-install' => 1, | |
'composer-binaries' => 1, | |
'codesniffer-run' => 1, | |
'gridresizestoreasset.php' => 1, | |
'baremetal-bootstrap' => 1, | |
'efoundationbundle.php' => 1, | |
'radiocolumn.php' => 1, | |
'radiocolumnasset.php' => 1, | |
'elusiveasset.php' => 1, | |
'smirikquizbundle.php' => 1, | |
'smirikexambundle.php' => 1, | |
'smirikcoursebundle.php' => 1, | |
'smirikcontentbundle.php' => 1, | |
'smirikadminbundle.php' => 1, | |
'lms2migrationbundle.php' => 1, | |
'flagiconasset.php' => 1, | |
'html.tpl.php' => 1, | |
'dosresourcebundle.php' => 1, | |
'dosmailerbundle.php' => 1, | |
'gridresizecolumnsasset.php' => 1, | |
'depdropasset.php' => 1, | |
'twitterplugin.php' => 1, | |
'vkplugin.php' => 1, | |
'sortableinput.php' => 1, | |
'sortableinputasset.php' => 1, | |
'stickytabsasset.php' => 1, | |
'tabsx.php' => 1, | |
'tabsxasset.php' => 1, | |
'affixasset.php' => 1, | |
'colorinputasset.php' => 1, | |
'depdropaction.php' => 1, | |
'depdropextasset.php' => 1, | |
'githubxplugin.php' => 1, | |
'starratingthemeasset.php' => 1, | |
'blazon.yml' => 1, | |
'render.inc.php' => 1, | |
'c2g_listvhosts.php' => 1, | |
'c2g_listbackups.php' => 1, | |
'c2g_functions.php' => 1, | |
'dataexchange.php' => 1, | |
'pharmaintelligencegstandaardbundle.php' => 1, | |
'foundationassets.php' => 1, | |
'datetimepickerassets.php' => 1, | |
'googleplugin.php' => 1, | |
'githubplugin.php' => 1, | |
'sdfaefeafe' => 1, | |
'init_aspect.php' => 1, | |
'biz_sub_apis.php' => 1, | |
'biz_apis.php' => 1, | |
'fastest' => 1, | |
'liuggiostatsdclientbundle.php' => 1, | |
'labelinplace.php' => 1, | |
'labelinplaceasset.php' => 1, | |
'navxasset.php' => 1, | |
'jdexception.php' => 1, | |
'jdclient.php' => 1, | |
'sweetcaptchabundle.php' => 1, | |
'stormapi.class.php' => 1, | |
'facebookplugin.php' => 1, | |
'lioshiwondercachebundle.php' => 1, | |
'popoverx.php' => 1, | |
'prophet' => 1, | |
'make_test_environment.sh' => 1, | |
'magicdoc' => 1, | |
'advancedconnectorbundle.php' => 1, | |
'transmogrifier.sublime-project' => 1, | |
'screenshot.json.dist' => 1, | |
'objectstorage.conf.dist' => 1, | |
'filelist.conf.dist' => 1, | |
'popoverxasset.php' => 1, | |
'db-sample-data' => 1, | |
'docs-generate' => 1, | |
'backstrech.php' => 1, | |
'index.tp.php' => 1, | |
'losodiannotationsbundle.php' => 1, | |
'how to install' => 1, | |
'faq and docs' => 1, | |
'dbtable.php' => 1, | |
'ult.php' => 1, | |
'initinterface.php' => 1, | |
'http_cache.php' => 1, | |
'muzijk.php' => 1, | |
'libslize.php.tp' => 1, | |
'libslize' => 1, | |
'libslize.php' => 1, | |
'superbanner.php' => 1, | |
'hunter.js' => 1, | |
'spaces.css' => 1, | |
'bootstrapvalidator.min.js' => 1, | |
'detailviewasset.php' => 1, | |
'dialogbootstrapasset.php' => 1, | |
'dropdownxasset.php' => 1, | |
'dynagrid.php' => 1, | |
'dynagridasset.php' => 1, | |
'dynagriddetail.php' => 1, | |
'bootstrapvalidator.min.css' => 1, | |
'contextmenu.php' => 1, | |
'ezpublishcoreextrabundle.php' => 1, | |
'phpunit.php52.xml.dist' => 1, | |
'demo1.html' => 1, | |
'antdeb.xml' => 1, | |
'ant-deb.jar' => 1, | |
'antcontrib.xml' => 1, | |
'tabularform.php' => 1, | |
'tabularformasset.php' => 1, | |
'postal_resolver.js' => 1, | |
'cleanup' => 1, | |
'spefilesizeextensionbundle.php' => 1, | |
'flot' => 1, | |
'checkboxx.php' => 1, | |
'yunxin.php' => 1, | |
'krajeeflatbluethemeasset.php' => 1, | |
'yuntongxun.php' => 1, | |
'yunpian.php' => 1, | |
'webchinese.php' => 1, | |
'sxt.php' => 1, | |
'smsbao.php' => 1, | |
'chuanglan.php' => 1, | |
'checkboxxasset.php' => 1, | |
'tetranslationbundle.php' => 1, | |
'tesearchifybundle.php' => 1, | |
'tedoctrinebehaviorsbundle.php' => 1, | |
'lolautruchepaylinebundle.php' => 1, | |
'callbackassets.php' => 1, | |
'dynagriddetailasset.php' => 1, | |
'gridperfectscrollbarasset.php' => 1, | |
'gridexportasset.php' => 1, | |
'checkboxcolumnasset.php' => 1, | |
'rename-empty' => 1, | |
'owner-set' => 1, | |
'columntrait.php' => 1, | |
'nfsexports-setsudoaccess' => 1, | |
'editablecolumnaction.php' => 1, | |
'expandrowcolumn.php' => 1, | |
'migrations' => 1, | |
'expandrowcolumnasset.php' => 1, | |
'formulacolumn.php' => 1, | |
'metrics-generate' => 1, | |
'booleancolumn.php' => 1, | |
'logs-clear' => 1, | |
'git-remotechanges' => 1, | |
'git-localchanges' => 1, | |
'git-hook-workingcopychange' => 1, | |
'git-currentbranch' => 1, | |
'folder-delete-items-older-than-days' => 1, | |
'email' => 1, | |
'docs-post' => 1, | |
'gridfloatheadasset.php' => 1, | |
'gridgroupasset.php' => 1, | |
'tests-run' => 1, | |
'exportmenuasset.php' => 1, | |
'dynagridstore.php' => 1, | |
'constantsarray.php' => 1, | |
'migration-doctrine-cli.php' => 1, | |
'migration-create.php' => 1, | |
'migrate-to-version.php' => 1, | |
'migrate-to-latest.php' => 1, | |
'migrate-init.php' => 1, | |
'editableasset.php' => 1, | |
'migrate-init-config.php' => 1, | |
'gls online api.pdf' => 1, | |
'dpd-api.pdf' => 1, | |
'api-test.php' => 1, | |
'editablepjaxasset.php' => 1, | |
'vagrant-exec' => 1, | |
'exportcolumnasset.php' => 1, | |
'exportmenu.php' => 1, | |
'phpunix.xml.dist' => 1, | |
'locastictcompaywaypayumbundle.php' => 1, | |
'github-changelog' => 1, | |
'loamoksubformsmadeeasybundle.php' => 1, | |
'loamokjquerysliderbundle.php' => 1, | |
'phpdoc.dist.xml.template' => 1, | |
'composer.json.template' => 1, | |
'readme.md.template' => 1, | |
'.travis.yml.template' => 1, | |
'backstrechassets.php' => 1, | |
'example_url.php' => 1, | |
'updaterepositorytask.php' => 1, | |
'css_browser_selector.min.js' => 1, | |
'kyticketpost.php' => 1, | |
'kyticketpriority.php' => 1, | |
'kyticketstatus.php' => 1, | |
'arraytoxml.php' => 1, | |
'kytickettimetrack.php' => 1, | |
'kytickettype.php' => 1, | |
'clsms.php' => 1, | |
'kytroubleshooterattachment.php' => 1, | |
'kytroubleshootercategory.php' => 1, | |
'bitcoin.php' => 1, | |
'css_browser_selector.js' => 1, | |
'kyticketcustomfieldgroup.php' => 1, | |
'css_browser_selector.class.php' => 1, | |
'rawhttpmethod.php' => 1, | |
'vim.tar.gz' => 1, | |
'lhpalaciobackupmanagerbundle.php' => 1, | |
'kytroubleshootercomment.php' => 1, | |
'kytroubleshooterstep.php' => 1, | |
'lexxpavlovpagebundle.php' => 1, | |
'lexxpavlovsettingsbundle.php' => 1, | |
'lexikworkflowbundle.php' => 1, | |
'kyuser.php' => 1, | |
'kyticketnote.php' => 1, | |
'cookiehelper.php' => 1, | |
'lexikpayboxbundle.php' => 1, | |
'librinfobaseentitiesbundle.php' => 1, | |
'notormpanel.php' => 1, | |
'librinfovarietiesbundle.php' => 1, | |
'librinfouserbundle.php' => 1, | |
'librinfouibundle.php' => 1, | |
'librinfosecuritybundle.php' => 1, | |
'librinfodoctrinepgsqlbundle.php' => 1, | |
'librinfodoctrinebundle.php' => 1, | |
'librinfodecoratorbundle.php' => 1, | |
'librinfocorebundle.php' => 1, | |
'librinfocrmbundle.php' => 1, | |
'readme-from-scratch' => 1, | |
'simplearraytoxml.php' => 1, | |
'links' => 1, | |
'dev.sh' => 1, | |
'dev-cleanstart.sh' => 1, | |
'dev-check.sh' => 1, | |
'kyresultset.php' => 1, | |
'kystaff.php' => 1, | |
'kystaffgroup.php' => 1, | |
'gravitonvcapbundle.php' => 1, | |
'qy.php' => 1, | |
'kyticket.php' => 1, | |
'kyticketattachment.php' => 1, | |
'kyusergroup.php' => 1, | |
'lexikmonologbrowserbundle.php' => 1, | |
'weixinapi' => 1, | |
'post-test.bat' => 1, | |
'kayueessencebundle.php' => 1, | |
'kayuewordpressbundle.php' => 1, | |
'db.bat' => 1, | |
'wordpressevents.php' => 1, | |
'favicon' => 1, | |
'kwparserbundle.php' => 1, | |
'zenstruckcontentbundle.php' => 1, | |
'sws.php' => 1, | |
'zenstruckcontrollerutilbundle.php' => 1, | |
'serve.bat' => 1, | |
'config.integration.example.json' => 1, | |
'recreate_test_db.sh' => 1, | |
'coding_standard.xml' => 1, | |
'dployer' => 1, | |
'tisql.php' => 1, | |
'leozaentitiesbundle.php' => 1, | |
'entitymanagerexception.php' => 1, | |
'entitygeneratorexception.php' => 1, | |
'entitygenerator.php' => 1, | |
'leozaapiserverbundle.php' => 1, | |
'leozaapiclientbundle.php' => 1, | |
'demo-mysql.php' => 1, | |
'ruckusing.conf.php' => 1, | |
'yammer.php' => 1, | |
'lexikjwtauthenticationbundle.php' => 1, | |
'mongodbmanager.php' => 1, | |
'lexikframeworkacceleratorbundle.php' => 1, | |
'lexikformfilterbundle.php' => 1, | |
'lexikdatalayerbundle.php' => 1, | |
'lexikcurrencybundle.php' => 1, | |
'lexikcolissimobundle.php' => 1, | |
'eyandexmetrikawidget.php' => 1, | |
'tuner' => 1, | |
'chords.yml' => 1, | |
'fminorrepertoire.php' => 1, | |
'repertoireinterface.php' => 1, | |
'kyuserorganization.php' => 1, | |
'jstreeinput.php' => 1, | |
'rbaccached.php' => 1, | |
'angellist.php' => 1, | |
'deviantart.php' => 1, | |
'flattr.php' => 1, | |
'formstack.php' => 1, | |
'mixcloud.php' => 1, | |
'nestedsetsquerybehavior.php' => 1, | |
'msn.php' => 1, | |
'snapr.php' => 1, | |
'socialmedia_oauth_connect.php' => 1, | |
'stocktwits.php' => 1, | |
'panel.latte' => 1, | |
'php-wechat.wiki' => 1, | |
'avatar.php' => 1, | |
'kycustomfield.php' => 1, | |
'kycommentbase.php' => 1, | |
'searchfactoryinterface.php' => 1, | |
'kycommentablebase.php' => 1, | |
'liipsearchbundle.php' => 1, | |
'pidfile.php' => 1, | |
'kyconfig.php' => 1, | |
'lockexception.php' => 1, | |
'liiponeallbundle.php' => 1, | |
'liipmultiplexbundle.php' => 1, | |
'liipmonitorbundle.php' => 1, | |
'imagineevents.php' => 1, | |
'exceptional.php' => 1, | |
'liiphyphenatorbundle.php' => 1, | |
'hyphenatorfactory.php' => 1, | |
'kycustomfielddate.php' => 1, | |
'kycustomfielddefinition.php' => 1, | |
'liiphellobundle.php' => 1, | |
'paratest' => 1, | |
'liipfoxycartbundle.php' => 1, | |
'cartvalidation.php' => 1, | |
'kycustomfieldfile.php' => 1, | |
'liipformtranslationchoicebundle.php' => 1, | |
'liipsoaprecorderbundle.php' => 1, | |
'example-vejnavn.php' => 1, | |
'drupaltranslationmodule.module' => 1, | |
'tojsonldinterface.php' => 1, | |
'limitlandldapbundle.php' => 1, | |
'switchinputasset.php' => 1, | |
'ormdfixerbundle.php' => 1, | |
'bootstrapmedialightboxasset.php' => 1, | |
'instantconfigurationplugin.php' => 1, | |
'lilwebextrabundle.php' => 1, | |
'lilwebcoffeescriptbundle.php' => 1, | |
'lilwebldapbundle.php' => 1, | |
'lilwebjobbundle.php' => 1, | |
'lilwebevolutionbundle.php' => 1, | |
'liipviebundle.php' => 1, | |
'activetheme.php' => 1, | |
'fromjsonldinterface.php' => 1, | |
'typeaheadbasicasset.php' => 1, | |
'typeaheadhbasset.php' => 1, | |
'karudevproductbundle.php' => 1, | |
'liipurlautoconverterbundle.php' => 1, | |
'sinlinebundle.php' => 1, | |
'envato-plugin-update.php' => 1, | |
'liiptranslationbundle.php' => 1, | |
'example.build.xml' => 1, | |
'liipthemebundle.php' => 1, | |
'dyndns.php' => 1, | |
'vm.drush.inc' => 1, | |
'drupaltranslationmodule.info' => 1, | |
'.gitattributes.dist' => 1, | |
'lcmbrightcovebundle.php' => 1, | |
'kynewscomment.php' => 1, | |
'liipcachecontrolbundle.php' => 1, | |
'readme.developers' => 1, | |
'liilomangopaybundle.php' => 1, | |
'kynewsitem.php' => 1, | |
'kynewssubscriber.php' => 1, | |
'w2ui.jquery.json' => 1, | |
'kyobjectbase.php' => 1, | |
'brainstorm' => 1, | |
'kyobjectwithcustomfieldsbase.php' => 1, | |
'lighthartgridbundle.php' => 1, | |
'migrate_fos' => 1, | |
'schedules' => 1, | |
'cocarbundle.php' => 1, | |
'kyrestclient.php' => 1, | |
'kyrestclientinterface.php' => 1, | |
'example-module.php' => 1, | |
'lifotypeaheadbundle.php' => 1, | |
'lidaatwigbundle.php' => 1, | |
'lidaatransbundle.php' => 1, | |
'lockformasset.php' => 1, | |
'lockbsformasset.php' => 1, | |
'layermobileasset.php' => 1, | |
'kynewscategory.php' => 1, | |
'liipcodebundle.php' => 1, | |
'drupalregistrymodule.module' => 1, | |
'kyhelpers.php' => 1, | |
'kycustomfieldgroupbase.php' => 1, | |
'drupalregistrymodule.info' => 1, | |
'drupaleventmanagermodule.module' => 1, | |
'drupaleventmanagermodule.info' => 1, | |
'kycustomfieldlinkedselect.php' => 1, | |
'kycustomfieldmultiselect.php' => 1, | |
'drupalcrudadminmodule.module' => 1, | |
'kycustomfieldoption.php' => 1, | |
'kycustomfieldselect.php' => 1, | |
'kydepartment.php' => 1, | |
'kyincludes.php' => 1, | |
'liipcontainerwrapperbundle.php' => 1, | |
'kyknowledgebasearticle.php' => 1, | |
'kyknowledgebaseattachment.php' => 1, | |
'kyknowledgebasecategory.php' => 1, | |
'kyknowledgebasecomment.php' => 1, | |
'drupalcrudadminmodule.install' => 1, | |
'drupalcrudadminmodule.info' => 1, | |
'drupalcrudadminmodule.helper.inc' => 1, | |
'drupalcrudadminmodule.admin.inc' => 1, | |
'drupalconnectormodule.module' => 1, | |
'drupalconnectormodule.info' => 1, | |
'liipdoctrinecachebundle.php' => 1, | |
'installtask.php' => 1, | |
'debpkg.phing.xml' => 1, | |
'star.php' => 1, | |
'maciaddressbundle.php' => 1, | |
'maciorderbundle.php' => 1, | |
'macimediabundle.php' => 1, | |
'macimailerbundle.php' => 1, | |
'macilistbundle.php' => 1, | |
'macicorebundle.php' => 1, | |
'macicontactbundle.php' => 1, | |
'kairosgoogleanalyticsclientbundle.php' => 1, | |
'kairosgoogleanalyticsserversidebundle.php' => 1, | |
'maciblogbundle.php' => 1, | |
'maciadminbundle.php' => 1, | |
'swaggeruiasset.php' => 1, | |
'macitranslatorbundle.php' => 1, | |
'apiresponse.php' => 1, | |
'apimodel.php' => 1, | |
'apigenerator.php' => 1, | |
'sparkline.php' => 1, | |
'softdeletetrait.php' => 1, | |
'notificationsmodule.php' => 1, | |
'flot.php' => 1, | |
'boxtrait.php' => 1, | |
'.php-version' => 1, | |
'yiimailmessage.php' => 1, | |
'maciproductbundle.php' => 1, | |
'http_build_url.php' => 1, | |
'wrepidealbundle.php' => 1, | |
'stringplural.php' => 1, | |
'datetimerangepicker.php' => 1, | |
'socketserver.php' => 1, | |
'socketserverclient.php' => 1, | |
'multiloader.php' => 1, | |
'xmldeserializer.php' => 1, | |
'xmlserializable.php' => 1, | |
'xmlserializer.php' => 1, | |
'hicri.php' => 1, | |
'hilal.php' => 1, | |
'parse_netscape_bookmarks.php' => 1, | |
'kaguxsilexintegrationbundle.php' => 1, | |
'metadatabehavior.php' => 1, | |
'backendmodule.php' => 1, | |
'mrsectionwidgetasset.php' => 1, | |
'imagecropsection.php' => 1, | |
'us.stackdump' => 1, | |
'tmdbapi.php' => 1, | |
'www' => 1, | |
'simplequeuemessage.php' => 1, | |
'simplequeuecontroller.php' => 1, | |
'simplequeueaction.php' => 1, | |
'simplequeue.php' => 1, | |
'googleanalyticsbundle.php' => 1, | |
'yiimail.php' => 1, | |
'paragraph.php' => 1, | |
'fakeuploadedfile.php' => 1, | |
'm4griosepomexbundle.php' => 1, | |
'mandrillmailer.php' => 1, | |
'quicky.class.php' => 1, | |
'quicky.form.class.php' => 1, | |
'mrocarequestlogbundle.php' => 1, | |
'mczolkoherokuschedulerbundle.php' => 1, | |
'quicky_bbcode.class.php' => 1, | |
'rsentrylog.php' => 1, | |
'rsentrycomponent.php' => 1, | |
'alternativemail.php' => 1, | |
'foppdfbundle.php' => 1, | |
'quicky_compiler.class.php' => 1, | |
'localstorage.class.php' => 1, | |
'xppaut' => 1, | |
'mophugbearbundle.php' => 1, | |
'moparangodbbundle.php' => 1, | |
'datacollector.php' => 1, | |
'newscooptageswochewidgetspluginbundle.php' => 1, | |
'blitz.class.php' => 1, | |
'newscoopingestparsersuperdeskcontentapibundle.php' => 1, | |
'jskasset.php' => 1, | |
'jsk.php' => 1, | |
'terminatur.bootstrap.inc' => 1, | |
'wbxcommunesdefrancebundle.php' => 1, | |
'wbxfilebundle.php' => 1, | |
'measuretextresult.php' => 1, | |
'about.png' => 1, | |
'measuretextcounts.php' => 1, | |
'measuretext.php' => 1, | |
'linesbreaker.php' => 1, | |
'linesbreakpointresult.php' => 1, | |
'uaparserbundle.php' => 1, | |
'linesbreakpoint.php' => 1, | |
'linesbreakcharresult.php' => 1, | |
'linesbreakchar.php' => 1, | |
'translatethis' => 1, | |
'seo.png' => 1, | |
'character optimization for translation service.xlsx' => 1, | |
'redcodeflowbundle.php' => 1, | |
'kalista' => 1, | |
'mmwhoisbundle.php' => 1, | |
'dojobundle.php' => 1, | |
'googlesearchengineplugin.php' => 1, | |
'duckduckgosearchengineplugin.php' => 1, | |
'bingsearchengineplugin.php' => 1, | |
'zohoinvoiceapiclient.php' => 1, | |
'twitterapi.php' => 1, | |
'oauthhmacsha1.php' => 1, | |
'kairoszohoinvoiceconnectorbundle.php' => 1, | |
'redcodetransactionmanagerbundle.php' => 1, | |
'socketclient.php' => 1, | |
'networkexception.php' => 1, | |
'terminatur.code.inc' => 1, | |
'acumulusbundle.php' => 1, | |
'sf_dic.module' => 1, | |
'sf_dic.install' => 1, | |
'sf_dic.info' => 1, | |
'sf_dic.container.php' => 1, | |
'env.sample.json' => 1, | |
'env.json' => 1, | |
'dumpcontent.php' => 1, | |
'mdmtranslatorcheckerbundle.php' => 1, | |
'mapperinterface.php' => 1, | |
'broadwayrethinkdbbundle.php' => 1, | |
'zf1wrapperbundle.php' => 1, | |
'sf_dic.services.yml' => 1, | |
'requests' => 1, | |
'setup.cfg' => 1, | |
'gtm.php' => 1, | |
'newemailwatcherdump.php' => 1, | |
'newemailwatcherinterface.php' => 1, | |
'servercustom.php' => 1, | |
'sendinblueapibundle.php' => 1, | |
'mailxpertapibundle.php' => 1, | |
'cffie.png' => 1, | |
'dataresponse.php' => 1, | |
'sf_dic.path.inc' => 1, | |
'makingwavesezaddthisbundle.php' => 1, | |
'mongod.conf' => 1, | |
'autoloadwidget.php' => 1, | |
'eventstore.config.php' => 1, | |
'autoloader.ini' => 1, | |
'readme.md.old' => 1, | |
'phantastic' => 1, | |
'config.yaml.sample' => 1, | |
'rgba-server.php' => 1, | |
'rgba-cli' => 1, | |
'ajarloader.php' => 1, | |
'ajar.php' => 1, | |
'mediaasset.php' => 1, | |
'yak.png' => 1, | |
'makingwavesezstarratingbundle.php' => 1, | |
'\\com\\iesebre\\dam2\\max\\persons\\person.uml' => 1, | |
'\\com\\iesebre\\dam2\\max\\curriculum\\study.uml' => 1, | |
'diagrampersons.png' => 1, | |
'diagramcurriculum.png' => 1, | |
'icalendar.php' => 1, | |
'icalperson.php' => 1, | |
'icalevent.php' => 1, | |
'icalattendee.php' => 1, | |
'icalalarm.php' => 1, | |
'frontendbundle.php' => 1, | |
'mapperbuilder.php' => 1, | |
'psxbundle.php' => 1, | |
'test_form.php' => 1, | |
'abstractserverclient.php' => 1, | |
'madesstdoctrinegenerationbundle.php' => 1, | |
'db_init.php' => 1, | |
'cookie2' => 1, | |
'cookie' => 1, | |
'dropboxuploader.php' => 1, | |
'clientmessagedtos.proto' => 1, | |
'kachkaevdropboxbackupbundle.php' => 1, | |
'.bookignore' => 1, | |
'kachkaevphprbundle.php' => 1, | |
'install-elasticsearch.sh' => 1, | |
'madesstsecurityextrabundle.php' => 1, | |
'madesstapidebugbundle.php' => 1, | |
'contributor-readme' => 1, | |
'keylighter.php' => 1, | |
'staging.jpg' => 1, | |
'development.jpg' => 1, | |
'backendauthasset.php' => 1, | |
'textformatsbehavior.php' => 1, | |
'selectizetextinput.php' => 1, | |
'selectizedropdownlist.php' => 1, | |
'selectizebase.php' => 1, | |
'abstractserver.php' => 1, | |
'autocompletestyleasset.php' => 1, | |
'pagee.php' => 1, | |
'ssbuilderscrack' => 1, | |
'preview.gif' => 1, | |
'jarlssen_cmsfiles.xml' => 1, | |
'.arty.example.yml' => 1, | |
'math_captcha.php' => 1, | |
'magican' => 1, | |
'run_tests' => 1, | |
'imagicreativityjqueryknobbundle.php' => 1, | |
'magallanes.sublime-project' => 1, | |
'isolation.php' => 1, | |
'package.json.sample' => 1, | |
'gruntfile.js.sample' => 1, | |
'report.full' => 1, | |
'mgf.php' => 1, | |
'sandbox.html' => 1, | |
'mgf.bat' => 1, | |
'magento-finder.php' => 1, | |
'magento-finder.bat' => 1, | |
'synctranslitbehavior.php' => 1, | |
'synctranslit.php' => 1, | |
'font.php' => 1, | |
'phatic.yml.dist' => 1, | |
'magaritestbundle.php' => 1, | |
'maestrano.png' => 1, | |
'kachkaevcountersbundle.php' => 1, | |
'kachkaevdafbundle.php' => 1, | |
'treeviewassets.php' => 1, | |
'tinymcefilemanagerasset.php' => 1, | |
'debpkg.xml' => 1, | |
'update-locales.sh' => 1, | |
'.travisload.sh' => 1, | |
'kamranxmlformbundle.php' => 1, | |
'.phpunit.dist.xml' => 1, | |
'.magmierrors' => 1, | |
'.localtest.sh' => 1, | |
'config.dist.yml' => 1, | |
'phpunit-unit.xml.dist' => 1, | |
'lsroudiclassifiedadsevents.php' => 1, | |
'lsroudiclassifiedadsbundle.php' => 1, | |
'update-pot.sh' => 1, | |
'run-phpdoc.sh' => 1, | |
'athens.php' => 1, | |
'makepackagexml.php' => 1, | |
'make-release.sh' => 1, | |
'ixr_library.php' => 1, | |
'radiofilter.php' => 1, | |
'dropdownfilter.php' => 1, | |
'datefilter.php' => 1, | |
'checkboxfilter.php' => 1, | |
'lpwebpaymentevents.php' => 1, | |
'lpwebpaymentbundle.php' => 1, | |
'reflection_php4.php' => 1, | |
'baseaccount.php' => 1, | |
'facerepository.php' => 1, | |
'service.json' => 1, | |
'wechatshakearound.php' => 1, | |
'notificationhandler.php' => 1, | |
'googledrivebundle.php' => 1, | |
'drivemodifier.php' => 1, | |
'drivefinder.php' => 1, | |
'driveconnector.php' => 1, | |
'channelmanager.php' => 1, | |
'start-selenium-server.bat' => 1, | |
'screenshot-simpletest-gui.png' => 1, | |
'wechatuser.php' => 1, | |
'wechatstat.php' => 1, | |
'wechatsemantic.php' => 1, | |
'photorepository.php' => 1, | |
'wechatqrcode.php' => 1, | |
'wechatoauth2.php' => 1, | |
'migrations.xml' => 1, | |
'wechatmessage.php' => 1, | |
'wechatmenu.php' => 1, | |
'wechatkf.php' => 1, | |
'wechatcard.php' => 1, | |
'b2backblazebundle.php' => 1, | |
'kamrangroupchoicelistbundle.php' => 1, | |
'kamransettingbundle.php' => 1, | |
'payserver.php' => 1, | |
'phpup' => 1, | |
'documentasset.php' => 1, | |
'pdfparserbundle.php' => 1, | |
'karserrobokassabundle.php' => 1, | |
'easytest.php' => 1, | |
'symvirins' => 1, | |
'symvirins.phar' => 1, | |
'kahorimagethumbnailbundle.php' => 1, | |
'binarythinkinglastfmbundle.php' => 1, | |
'openmiddlewarebundle.php' => 1, | |
'ussd.php' => 1, | |
'phpunit_ci.xml' => 1, | |
'karsergoogletranslatebundle.php' => 1, | |
'karsermainsmsbundle.php' => 1, | |
'karsersmsbundle.php' => 1, | |
'richerrortest.php' => 1, | |
'karsersmsvestibundle.php' => 1, | |
'activeformevent.php' => 1, | |
'gemaadminbundle.php' => 1, | |
'puzzle' => 1, | |
'svn.xml' => 1, | |
'phplint.xml' => 1, | |
'formgrid.php' => 1, | |
'formtrait.php' => 1, | |
'git.xml' => 1, | |
'exec.xml' => 1, | |
'default.yaml' => 1, | |
'richerror.php' => 1, | |
'wubookapibundle.php' => 1, | |
'ajaxq.php' => 1, | |
'config_merge.php' => 1, | |
'greek_vat_validator.php' => 1, | |
'events.test.php' => 1, | |
'transelot.php' => 1, | |
'reversepagination.php' => 1, | |
'reverselinkpager.php' => 1, | |
'ajaxqasset.php' => 1, | |
'bvcmsbundle.php' => 1, | |
'bvitemplatebundle.php' => 1, | |
'bvrolebundle.php' => 1, | |
'kapcontactbundle.php' => 1, | |
'restfulparser.php' => 1, | |
'try_catch.php' => 1, | |
'notify_url.php' => 1, | |
'alipayapi.php' => 1, | |
'alipay.config.php' => 1, | |
'ophir.php' => 1, | |
'file_upload.php' => 1, | |
'propelmodelparserbundle.php' => 1, | |
'propertycollection.php' => 1, | |
'sample_config.inc.php' => 1, | |
'create_database.sql' => 1, | |
'rsparsertest.php' => 1, | |
'pdfparser.php' => 1, | |
'gitaski' => 1, | |
'terminatur.database.inc' => 1, | |
'domquery.js' => 1, | |
'lifestreamserviceprovider.php' => 1, | |
'config.yml-dist' => 1, | |
'wc-edostavka.php' => 1, | |
'.platform-project' => 1, | |
'emailmakr' => 1, | |
'windwalker' => 1, | |
'phpunit.xml.pgsql.dist' => 1, | |
'admin-global-search-autocomplete.php' => 1, | |
'moduleloader.js' => 1, | |
'etmas.css' => 1, | |
'ajaxutil.js' => 1, | |
'direction.php' => 1, | |
'imageuploadasset.php' => 1, | |
'imageupload.php' => 1, | |
'ezmigrationbundle.php' => 1, | |
'makephar' => 1, | |
'kaliopqueueingpluginskinesisbundle.php' => 1, | |
'kaliopqueueingpluginssqsbundle.php' => 1, | |
'kaliopqueueingpluginsstompbundle.php' => 1, | |
'kaliopqueueingbundle.php' => 1, | |
'simplemenu.php' => 1, | |
'shortcutmenu.php' => 1, | |
'lyrixxlifestreambundle.php' => 1, | |
'city.mmdb' => 1, | |
'viewengine.php' => 1, | |
'b3wasset.php' => 1, | |
'tinymcecontentstylesasset.php' => 1, | |
'elfindercontroller.php' => 1, | |
'authitem.php' => 1, | |
'terminatur.drush.inc' => 1, | |
'fullcalendarassets.php' => 1, | |
'terminatur.files.inc' => 1, | |
'dynmodels.php' => 1, | |
'dynmodelfields.php' => 1, | |
'dynmodeleditor.php' => 1, | |
'checkboxlist.php' => 1, | |
'wtexception.php' => 1, | |
'country.mmdb' => 1, | |
'simpledemo.php' => 1, | |
'groupdemo.php' => 1, | |
'worldtextsms.class.php' => 1, | |
'worldtextgroup.class.php' => 1, | |
'worldtextadmin.class.php' => 1, | |
'worldtext.php' => 1, | |
'terminatur.settings.inc' => 1, | |
'terminatur.utils.inc' => 1, | |
'symfonyformgeneratorbundle.php' => 1, | |
'lzakrzewskifacebookauthenticationbundle.php' => 1, | |
'pingpp.php' => 1, | |
'notifymenu.php' => 1, | |
'webuploaderhtml5onlyasset.php' => 1, | |
'readme.eng' => 1, | |
'mage.package.xml' => 1, | |
'localebundleevents.php' => 1, | |
'changelog-2_1' => 1, | |
'wp-nonce.php' => 1, | |
'listsearchwidget.php' => 1, | |
'coalaconsolebundle.php' => 1, | |
'coalacatchphperrorsbundle.php' => 1, | |
'decoder.php' => 1, | |
'interface-pm-proxy' => 1, | |
'pdo.class.inc.php' => 1, | |
'pear.package.xml' => 1, | |
'micro.sql' => 1, | |
'wysibbwidgetasset.php' => 1, | |
'.atoum.php.ci' => 1, | |
'playbloomguzzlebundle.php' => 1, | |
'.kisma.php' => 1, | |
'pbarcode39.php~' => 1, | |
'gusuploaderbundle.php' => 1, | |
'multicombinator.php' => 1, | |
'klein.php' => 1, | |
'ppie.php~' => 1, | |
'humbuglog' => 1, | |
'workstead' => 1, | |
'snowflake' => 1, | |
'luneticstimezonebundle.php' => 1, | |
'timezonebundleevents.php' => 1, | |
'webuploaderflashonlyasset.php' => 1, | |
'remote-admin.png' => 1, | |
'uploaderaction.php' => 1, | |
'ueditorassets.php' => 1, | |
'amazeuithreepresenter.php' => 1, | |
'test3.jpeg' => 1, | |
'test2.jpeg' => 1, | |
'test1.jpeg' => 1, | |
'featurecheckerbundle.php' => 1, | |
'garbagecollector.php' => 1, | |
'phreepio' => 1, | |
'kumitebundle.php' => 1, | |
'registerinterface.php' => 1, | |
'website' => 1, | |
'luya.php' => 1, | |
'bootstrap4asset.php' => 1, | |
'luxiferrabbitmqmanagementbundle.php' => 1, | |
'googlemapassets.php' => 1, | |
'navcustom.php' => 1, | |
'resizecrop.php' => 1, | |
'selectmaplocationassets.php' => 1, | |
'composer.jsonbak' => 1, | |
'chrome.crx' => 1, | |
'selectmaplocationwidget.php' => 1, | |
'wysibbwidget.php' => 1, | |
'subtree-split.config' => 1, | |
'twbsmaxlengthasset.php' => 1, | |
'wp-plugin-core.php' => 1, | |
'socolissimo.php' => 1, | |
'theliasmarty.php' => 1, | |
'theliamigratecountry.php' => 1, | |
'theliahybridauth.php' => 1, | |
'theliagooglemap.php' => 1, | |
'theliadebugbar.php' => 1, | |
'taxruleimport.php' => 1, | |
'takecustomeraccount.php' => 1, | |
'tntfrance.php' => 1, | |
'supportticket.php' => 1, | |
'stripepayment.php' => 1, | |
'storeseo.php' => 1, | |
'stockonorder.php' => 1, | |
'stockalert.php' => 1, | |
'smartyredirection.php' => 1, | |
'theliatwig.php' => 1, | |
'smartyfilter.php' => 1, | |
'smartycache.php' => 1, | |
'shoppingflux.php' => 1, | |
'routesmatchinverter.php' => 1, | |
'rewriteurl.php' => 1, | |
'removeuselesscart.php' => 1, | |
'redsys.php' => 1, | |
'redirection.php' => 1, | |
'recentlyviewed.php' => 1, | |
'productsearch.php' => 1, | |
'productonlinewithoutstock.php' => 1, | |
'productofflinewithstock.php' => 1, | |
'popin.php' => 1, | |
'theliastudio.php' => 1, | |
'tokenrenew.php' => 1, | |
'payzenmulti.php' => 1, | |
'configuration.html' => 1, | |
'document-edit.html' => 1, | |
'customers.html' => 1, | |
'customer-edit.html' => 1, | |
'currency-edit.html' => 1, | |
'currencies.html' => 1, | |
'create-password.html' => 1, | |
'create-password-success.html' => 1, | |
'coupon-update.html' => 1, | |
'coupon-list.html' => 1, | |
'coupon-create.html' => 1, | |
'country-edit.html' => 1, | |
'countries.html' => 1, | |
'content-edit.html' => 1, | |
'config-store.html' => 1, | |
'transferpayment.php' => 1, | |
'category-edit.html' => 1, | |
'categories.html' => 1, | |
'brands.html' => 1, | |
'brand-edit.html' => 1, | |
'attributes.html' => 1, | |
'attribute-edit.html' => 1, | |
'api.html' => 1, | |
'advanced-configuration.html' => 1, | |
'administrators.html' => 1, | |
'admin-logs.html' => 1, | |
'admin-layout.tpl' => 1, | |
'wiretransfer.php' => 1, | |
'virtualproductdelivery.php' => 1, | |
'virtualproductcontrol.php' => 1, | |
'payzenoneoffsepa.php' => 1, | |
'payzen.php' => 1, | |
'export-page.html' => 1, | |
'dealerteam.php' => 1, | |
'googleshopping.php' => 1, | |
'freeorder.php' => 1, | |
'forcephone.php' => 1, | |
'flatfeedelivery.php' => 1, | |
'featuretype.php' => 1, | |
'extraorderdata.php' => 1, | |
'duplicateorder.php' => 1, | |
'dpdpickup.php' => 1, | |
'dpdclassic.php' => 1, | |
'diaporamas.php' => 1, | |
'deliveryround.php' => 1, | |
'deliveryexcludedate.php' => 1, | |
'deliverydelay.php' => 1, | |
'dealer.php' => 1, | |
'gratisonlinealert.php' => 1, | |
'databasesmanager.php' => 1, | |
'customerscope.php' => 1, | |
'customergroupacl.php' => 1, | |
'phpcbf.sh' => 1, | |
'customergroup.php' => 1, | |
'customerfamily.php' => 1, | |
'customerbirthdate.php' => 1, | |
'customdelivery.php' => 1, | |
'criteriasearch.php' => 1, | |
'creditnote.php' => 1, | |
'creditaccount.php' => 1, | |
'contest.php' => 1, | |
'contentcode.php' => 1, | |
'googleuniversalanalytics.php' => 1, | |
'hookadminhome.php' => 1, | |
'paymentrecall.php' => 1, | |
'imagefactory.php' => 1, | |
'paybox.php' => 1, | |
'ordercreation.php' => 1, | |
'ordercomment.php' => 1, | |
'opensearchserversearch.php' => 1, | |
'moneris.php' => 1, | |
'mailjet.php' => 1, | |
'loyalty.php' => 1, | |
'lengow.php' => 1, | |
'legacyproductattributes.php' => 1, | |
'keyword.php' => 1, | |
'indexengine.php' => 1, | |
'importt1.php' => 1, | |
'importexportseo.php' => 1, | |
'inseegeo.php' => 1, | |
'hookanalytics.php' => 1, | |
'hooksocial.php' => 1, | |
'hooksearch.php' => 1, | |
'hookproductsoffer.php' => 1, | |
'hookproductsnew.php' => 1, | |
'hooknewsletter.php' => 1, | |
'hooknavigation.php' => 1, | |
'hooklinks.php' => 1, | |
'hooklang.php' => 1, | |
'hookdoc.php' => 1, | |
'hookcustomer.php' => 1, | |
'hookcurrency.php' => 1, | |
'hookcookies.php' => 1, | |
'hookcontact.php' => 1, | |
'hookcart.php' => 1, | |
'error.html' => 1, | |
'export.html' => 1, | |
'colissimo.php' => 1, | |
'theme.ini' => 1, | |
'dtgeshibundle.php' => 1, | |
'atresourceaccessbundle.php' => 1, | |
'theodorogercmsbundle.php' => 1, | |
'theodoquizbundle.php' => 1, | |
'theodoframeworkextrabundle.php' => 1, | |
'theodoevolutionsessionbundle.php' => 1, | |
'theodoevolutionlegacywrapperbundle.php' => 1, | |
'theododrupal8bundle.php' => 1, | |
'theodoesendexclientbundle.php' => 1, | |
'twade.php' => 1, | |
'katana' => 1, | |
'ovhsmsbundle.php' => 1, | |
'imagesbase64converterbundle.php' => 1, | |
'tmhoauth.php' => 1, | |
'.shuntpwd' => 1, | |
'maschitcryptencoderbundle.php' => 1, | |
'maschitbarcodebundle.php' => 1, | |
'unit-tests.sh' => 1, | |
'unit-tests.bat' => 1, | |
'reset_install.sh' => 1, | |
'reset_install.bat' => 1, | |
'php-cs.bat' => 1, | |
'php-cs' => 1, | |
'change-version.sh' => 1, | |
'thelia.sql' => 1, | |
'tax_faker.php' => 1, | |
'insert.sql.tpl' => 1, | |
'insert.sql' => 1, | |
'rfc5849' => 1, | |
'travis.xml.dist' => 1, | |
'faker_100categories_1000products_4locales.php' => 1, | |
'aismatakuliahbundle.php' => 1, | |
'aisuserbundle.php' => 1, | |
'aistranskripbundle.php' => 1, | |
'aisstatuskeaktifanbundle.php' => 1, | |
'aisslotbundle.php' => 1, | |
'aissemesterbundle.php' => 1, | |
'aisruangbundle.php' => 1, | |
'aisprovinsibundle.php' => 1, | |
'aisprodibundle.php' => 1, | |
'aisprestasibundle.php' => 1, | |
'aispimpinanprodibundle.php' => 1, | |
'aispertemuanmahasiswabundle.php' => 1, | |
'aispertemuandosenbundle.php' => 1, | |
'aispertemuanbundle.php' => 1, | |
'aismahasiswaprofilebundle.php' => 1, | |
'tacticianbundle.php' => 1, | |
'aismahasiswabundle.php' => 1, | |
'aiskontrakmahasiswabundle.php' => 1, | |
'aiskontrakdosenbundle.php' => 1, | |
'aiskabupatenbundle.php' => 1, | |
'aisjadwalbundle.php' => 1, | |
'aisijasahsmabundle.php' => 1, | |
'aisharibundle.php' => 1, | |
'aisgedungbundle.php' => 1, | |
'aisdosenbundle.php' => 1, | |
'aisdaftarbundle.php' => 1, | |
'aisbimbinganbundle.php' => 1, | |
'md2resume_dev.php' => 1, | |
'working.php' => 1, | |
'fb' => 1, | |
'faker_add_ecotax.php' => 1, | |
'faker.php' => 1, | |
'feature-edit.html' => 1, | |
'module-edit.html' => 1, | |
'shipping-zones-edit.html' => 1, | |
'shipping-configuration.html' => 1, | |
'shipping-configuration-edit.html' => 1, | |
'sales.html' => 1, | |
'sale-edit.html' => 1, | |
'profiles.html' => 1, | |
'profile-edit.html' => 1, | |
'product-edit.html' => 1, | |
'orders.html' => 1, | |
'order-edit.html' => 1, | |
'modules.html' => 1, | |
'module-hooks.html' => 1, | |
'module-hook-edit.html' => 1, | |
'module-configure.html' => 1, | |
'simple-layout.tpl' => 1, | |
'message-edit.html' => 1, | |
'mailing-system.html' => 1, | |
'lost-password.html' => 1, | |
'languages.html' => 1, | |
'import-page.html' => 1, | |
'image-edit.html' => 1, | |
'hooks.html' => 1, | |
'hook-edit.html' => 1, | |
'home.html' => 1, | |
'general_error.html' => 1, | |
'folders.html' => 1, | |
'folder-edit.html' => 1, | |
'features.html' => 1, | |
'shipping-zones.html' => 1, | |
'state-edit.html' => 1, | |
'database.yml.sample' => 1, | |
'admin_password' => 1, | |
'hooktest.php' => 1, | |
'delivery.html' => 1, | |
'password' => 1, | |
'password.html' => 1, | |
'order_notification' => 1, | |
'order_notification.html' => 1, | |
'order_confirmation' => 1, | |
'order_confirmation.html' => 1, | |
'newsletter_subscription_confirmation' => 1, | |
'newsletter_subscription_confirmation.html' => 1, | |
'email-layout.tpl' => 1, | |
'default-text-layout.tpl' => 1, | |
'default-html-layout.tpl' => 1, | |
'admin_password.html' => 1, | |
'states.html' => 1, | |
'account_created_by_admin' => 1, | |
'account_created_by_admin.html' => 1, | |
'account_changed_by_admin' => 1, | |
'account_changed_by_admin.html' => 1, | |
'variables.html' => 1, | |
'variable-edit.html' => 1, | |
'translations.html' => 1, | |
'tools.html' => 1, | |
'templates.html' => 1, | |
'template-edit.html' => 1, | |
'taxes-rules.html' => 1, | |
'tax-rule-edit.html' => 1, | |
'tax-edit.html' => 1, | |
'system-logs.html' => 1, | |
'configdoc.php' => 1, | |
'cmcic.php' => 1, | |
'vmcpatientbundle.php' => 1, | |
'tebruexecutionerbundle.php' => 1, | |
'release-1.1.0' => 1, | |
'api-2.0.0' => 1, | |
'api-1.1.0' => 1, | |
'api-1.0.0' => 1, | |
'license.orig' => 1, | |
'example-vanilla.php' => 1, | |
'example-composer.php' => 1, | |
'phpctags.class.php' => 1, | |
'pbc-export.sh' => 1, | |
'wp-async-task.php' => 1, | |
'tebrustripebundle.php' => 1, | |
'tebruretrofitbundle.php' => 1, | |
'servicescollection.php' => 1, | |
'teapotiobaseuserbundle.php' => 1, | |
'release-2.0.1' => 1, | |
'teapotiobasethemebundle.php' => 1, | |
'teapotiobaseforumbundle.php' => 1, | |
'teapotiobasecachebundle.php' => 1, | |
'statuscode.php' => 1, | |
'retention.php' => 1, | |
'retention.civix.php' => 1, | |
'nonmembers.php' => 1, | |
'nonmembers.civix.php' => 1, | |
'registerwithoutemail.php' => 1, | |
'registerwithoutemail.civix.php' => 1, | |
'management.php' => 1, | |
'management.civix.php' => 1, | |
'mailgun.civix.php' => 1, | |
'release-2.0.0' => 1, | |
'release-2.0.2' => 1, | |
'cache' => 1, | |
'uspsprioritylabel.php' => 1, | |
'update-checker' => 1, | |
'.circle.yml' => 1, | |
'pumukityoutubebundle.php' => 1, | |
'pumukitvideoeditorbundle.php' => 1, | |
'pumukitpaellaplayerbundle.php' => 1, | |
'pumukitmoodlebundle.php' => 1, | |
'pumukitgeantwebtvbundle.php' => 1, | |
'baserestservicetb.php' => 1, | |
'authtb.php' => 1, | |
'datatableassets.php' => 1, | |
'collapsewidgetasset.php' => 1, | |
'collapsewidget.php' => 1, | |
'uspsservicedeliverycalculator.php' => 1, | |
'uspsopendistributelabel.php' => 1, | |
'copying-gpl' => 1, | |
'uspsinternationallabel.php' => 1, | |
'uspsfirstclassservicestandards.php' => 1, | |
'cspoosmsbundle.php' => 1, | |
'cspooswiftmailermailgunbundle.php' => 1, | |
'data_bridge.php' => 1, | |
'siteidentifier.php' => 1, | |
'tedivmstashbundle.php' => 1, | |
'setupenvironment.sh' => 1, | |
'.dovecottestingmark' => 1, | |
'phpcs_test.xml' => 1, | |
'quickstart-guide' => 1, | |
'pear-summary' => 1, | |
'project.properties' => 1, | |
'readme.pear' => 1, | |
'voice' => 1, | |
'pagetsconfig' => 1, | |
'temporesourceextrabundle.php' => 1, | |
'memcachefactory.php' => 1, | |
'tfoxestidcardbundle.php' => 1, | |
'tfoxditoolsbundle.php' => 1, | |
'tfoxdbprocedureevents.php' => 1, | |
'tfoxdbprocedurebundle.php' => 1, | |
'tfoxcalendarbundle.php' => 1, | |
'tfoxbeanstalkdbundle.php' => 1, | |
'nginx_rewrite' => 1, | |
'thtranslationlogbundle.php' => 1, | |
'loggingmessagecatalogue.php' => 1, | |
'statsd.php' => 1, | |
'smstatsdbundle.php' => 1, | |
'smmemcachebundle.php' => 1, | |
'mockmemcache.php' => 1, | |
'tariochphealbundle.php' => 1, | |
'userpolicy.php' => 1, | |
'tariocheveapifetcherbundle.php' => 1, | |
'upstartmonitorbundle.php' => 1, | |
'upstartbundle.php' => 1, | |
'dockerfile.py' => 1, | |
'test-runner.php' => 1, | |
'torm.php' => 1, | |
'delayedmail.php' => 1, | |
'solrfacade.php' => 1, | |
'solrconnectionfactory.php' => 1, | |
'solrconnection.php' => 1, | |
'taprontoformfilterbundle.php' => 1, | |
'filterformservice.php' => 1, | |
'formulate.php' => 1, | |
'tfoxpangalinkbundle.php' => 1, | |
'workchatclient.php' => 1, | |
'rqlbundle.php' => 1, | |
'gan_tokenizer.php' => 1, | |
'leoorestbundle.php' => 1, | |
'teaandcodeapibundle.php' => 1, | |
'vertere' => 1, | |
'rml' => 1, | |
'agpl-3.0' => 1, | |
'example_torrent_creator.php' => 1, | |
'example_seeder.php' => 1, | |
'example_announce.php' => 1, | |
'license.gplv2' => 1, | |
'license.asl20' => 1, | |
'pxgif.php' => 1, | |
'pquery.php' => 1, | |
'gan_xml2array.php' => 1, | |
'gan_selector_html.php' => 1, | |
'class-page-layouts.php' => 1, | |
'gan_parser_html.php' => 1, | |
'gan_node_html.php' => 1, | |
'gan_formatter.php' => 1, | |
'iquery.php' => 1, | |
'server-conf.php' => 1, | |
'oandawrapreference.html' => 1, | |
'oandawraplicense' => 1, | |
'oandawrap.php' => 1, | |
'taviisqsjobqueuebundle.php' => 1, | |
'sqsjobqueueevents.php' => 1, | |
'sutra.kdev4' => 1, | |
'flourish-alternatives' => 1, | |
'field-groups.php' => 1, | |
'class-post-layouts.php' => 1, | |
'tempojsconfigurationbundle.php' => 1, | |
'samplev2.php' => 1, | |
'catchthelia1url.php' => 1, | |
'topribbonmenu.css' => 1, | |
'underscore.png' => 1, | |
'jquery-1.7.2.min.js' => 1, | |
'loading.gif' => 1, | |
'fileuploader.js' => 1, | |
'fileuploader.css' => 1, | |
'static_highlight.js' => 1, | |
'scrollable-page.html' => 1, | |
'kitchen-sink.html' => 1, | |
'kitchen-sink-req.html' => 1, | |
'druplash.module' => 1, | |
'druplash.info' => 1, | |
'messages.css' => 1, | |
'topribbonmenu.js' => 1, | |
'thecitystrategy.php' => 1, | |
'composer-mouf.lock' => 1, | |
'phpcliutil.class.php' => 1, | |
'phpcli.class.php' => 1, | |
'theapicctvblindfoldbundle.php' => 1, | |
'stepper.php' => 1, | |
'blindfold.php' => 1, | |
'lace' => 1, | |
'environment.json' => 1, | |
'.travis,yml' => 1, | |
'jquery.percentageloader-0.1.js' => 1, | |
'jquery.percentageloader-0.1.css' => 1, | |
'multiple.html' => 1, | |
'index8.html' => 1, | |
'index7.html' => 1, | |
'composer-mouf.json' => 1, | |
'composer-mouf.sh' => 1, | |
'index5.html' => 1, | |
'adminsubdomain.php' => 1, | |
'canonicalurl.php' => 1, | |
'canadapost.php' => 1, | |
'cbfranfinance3x.php' => 1, | |
'brandproductdisplay.php' => 1, | |
'brandcarousel.php' => 1, | |
'bosearch.php' => 1, | |
'beanstreammodule.php' => 1, | |
'be2bill.php' => 1, | |
'backofficepath.php' => 1, | |
'backofficecss.php' => 1, | |
'responsecode.php' => 1, | |
'attributetype.php' => 1, | |
'atos.php' => 1, | |
'admincomment.php' => 1, | |
'git-commit-packages.sh' => 1, | |
'pdo.json.default' => 1, | |
'memcache.php.default' => 1, | |
'app.php.default' => 1, | |
'mongo.json.default' => 1, | |
'upload_cc.sh' => 1, | |
'documentation.zip' => 1, | |
'gruntfile' => 1, | |
'gruntfile.php' => 1, | |
'rediscache.php' => 1, | |
'php-travis.ini' => 1, | |
'cacheadmin.php' => 1, | |
'node-js.png' => 1, | |
'install_screen.php' => 1, | |
'git-recursive.sh' => 1, | |
'index6.html' => 1, | |
'index4.html' => 1, | |
'tenelevengeolocatorbundle.php' => 1, | |
'modulelanguageredirect.php' => 1, | |
'mpforms.php' => 1, | |
'formmpformpageswitch.php' => 1, | |
'mailusername.php' => 1, | |
'leadsexport.php' => 1, | |
'leads.php' => 1, | |
'inserttags.php' => 1, | |
'formstylify.php' => 1, | |
'easythemes.php' => 1, | |
'checkboxchooseatleastone.php' => 1, | |
'formcountryselectmenu.php' => 1, | |
'formconditionalselectmenu.php' => 1, | |
'conditionalselectmenu.php' => 1, | |
'conditionalformfields.php' => 1, | |
'modulechangelanguage.php' => 1, | |
'newslanguage.php' => 1, | |
'changelanguage.php' => 1, | |
'ceaccess.php' => 1, | |
'namespaceclassloader.php' => 1, | |
'wiringpiphp.iml' => 1, | |
'nagios_check_nagixx' => 1, | |
'paginator.html.twig' => 1, | |
'dev-auth.php-sample' => 1, | |
'autoloader-dev.php' => 1, | |
'sitemap-glue.php.sample' => 1, | |
'ten24cmspagesbundle.php' => 1, | |
'blockdiag.php' => 1, | |
'rpc.php' => 1, | |
'btc_address_validator.php' => 1, | |
'mpformsformmanager.php' => 1, | |
'modulebackgroundimage.php' => 1, | |
'index3.html' => 1, | |
'youtrackticket.php' => 1, | |
'index2.html' => 1, | |
'wizard-list-place.html' => 1, | |
'wizard-list-boat.html' => 1, | |
'jquery.creditcardvalidator.js' => 1, | |
'cards.png' => 1, | |
'xiseasyformsbundle.php' => 1, | |
'hampezurbinkbundle.php' => 1, | |
'vendor.yml' => 1, | |
'lyrisapi.php' => 1, | |
'tgaforumbundle.php' => 1, | |
'tgaopengraphbundle.php' => 1, | |
'textpack' => 1, | |
'textmagic-cli.php' => 1, | |
'youtrackticket.body.php' => 1, | |
'modulepageimage.php' => 1, | |
'piwik_tracking_api.php' => 1, | |
'piwiktracker.php' => 1, | |
'tetranzselect2entitybundle.php' => 1, | |
'option-parser' => 1, | |
'option-parameter' => 1, | |
'bloggerblogbundle.php' => 1, | |
'fotogrid.php' => 1, | |
'commentsbundle.php' => 1, | |
'doctrinestackbundle.php' => 1, | |
'terramarsalesbundle.php' => 1, | |
'terramarcustomerbundle.php' => 1, | |
'modulealias.php' => 1, | |
'tablelookupwizard.php' => 1, | |
'pageimage.php' => 1, | |
'aiswisudabundle.php' => 1, | |
'vmcvisitbundle.php' => 1, | |
'alicache.php' => 1, | |
'precis.php' => 1, | |
'fnc.php' => 1, | |
'pecserkeyamlfixturesbundle.php' => 1, | |
'pecserketwigdoctrineloaderbundle.php' => 1, | |
'oauth.py' => 1, | |
'o1auth.php' => 1, | |
'moreoauth.php' => 1, | |
'index4.php' => 1, | |
'hello.py' => 1, | |
'flaskoauth.py' => 1, | |
'auth.py' => 1, | |
'valueexpression.php' => 1, | |
'dynamicactiverecord.php' => 1, | |
'dynamicactivequery.php' => 1, | |
'casefolddatatrait.php' => 1, | |
'debug-performance.css' => 1, | |
'casefold.php' => 1, | |
'bididatatrait.php' => 1, | |
'bidi.php' => 1, | |
'labeler.php' => 1, | |
'labeler' => 1, | |
'liver' => 1, | |
'test_login.php' => 1, | |
'abc.php' => 1, | |
'test_patterns.php' => 1, | |
'test_login_html_auto.php' => 1, | |
'test_login_html.php' => 1, | |
'test_login3.php' => 1, | |
'test_login2.php' => 1, | |
'conceptitorientdbbundle.php' => 1, | |
'debug-performance.js' => 1, | |
'ebi.phar' => 1, | |
'tiga' => 1, | |
'superglue.php' => 1, | |
'fm-demo2.png' => 1, | |
'fm-demo.png' => 1, | |
'demo_temp_for_laravel.blade.php' => 1, | |
'view.xml' => 1, | |
'tooffftoolsforcrudbundle.php' => 1, | |
'toofffsessionbundle.php' => 1, | |
'toofffformsbundle.php' => 1, | |
'ovethesaurusbundle.php' => 1, | |
'oveproceduresbundle.php' => 1, | |
'oveauthentificationbundle.php' => 1, | |
'tiga.php' => 1, | |
'tiga-command.php' => 1, | |
'threescalebundle.php' => 1, | |
'diffdir.php' => 1, | |
'biodb_body.php' => 1, | |
'biodb.php' => 1, | |
'semanticdataimport.php' => 1, | |
'semanticdataimport.i18n.php' => 1, | |
'pdflib.php' => 1, | |
'pdflibexception.php' => 1, | |
'dscountdownasset.php' => 1, | |
'dscountdown.php' => 1, | |
'arkulpasymfonyextensionsbundle.php' => 1, | |
'arkulpacontactformbundle.php' => 1, | |
'ruleset-for-tests.xml' => 1, | |
'ruleset-for-contexts.xml' => 1, | |
'tommygnrdatatablesbundle.php' => 1, | |
'create-composer-json.php' => 1, | |
'test_login1.php' => 1, | |
'toin0udigitaloceanbundle.php' => 1, | |
'create_migration.php' => 1, | |
'maczukinappversionbundle.php' => 1, | |
'couscous.phar' => 1, | |
'phpunit_stdlib.xml' => 1, | |
'phpunit_mvc.xml' => 1, | |
'phpunit_di.xml' => 1, | |
'module_documents' => 1, | |
'documents' => 1, | |
'test11' => 1, | |
123 => 1, | |
'access.log' => 1, | |
'tmcycyitmapbundle.php' => 1, | |
'themer-logo' => 1, | |
'enttestfile.php' => 1, | |
'algorithm' => 1, | |
'smtpmailer.php' => 1, | |
'tmwkcpaneluapibundle.php' => 1, | |
'oauth2china.php' => 1, | |
'sybase.php' => 1, | |
'tkuskauserevents.php' => 1, | |
'tkuskauserbundle.php' => 1, | |
'tkuskaribbonbundle.php' => 1, | |
'tkuskageneratorbundle.php' => 1, | |
'widgetprovider.php' => 1, | |
'tkuskadashboardbundle.php' => 1, | |
'refreshtabaction.php' => 1, | |
'dwzxheditorasset.php' => 1, | |
'dwzuploadifyasset.php' => 1, | |
'dwzprintasset.php' => 1, | |
'dwzcoreasset.php' => 1, | |
'ebfacebookbundle.php' => 1, | |
'naokihanzawa.php' => 1, | |
'toiinecouchbasebundle.php' => 1, | |
'skeleton.html.php' => 1, | |
'samples.html' => 1, | |
'toguuserbundle.php' => 1, | |
'togutemplatebundle.php' => 1, | |
'toguengine.php' => 1, | |
'toguserializationbundle.php' => 1, | |
'togumediabundle.php' => 1, | |
'togugeneratorbundle.php' => 1, | |
'togufrontendbundle.php' => 1, | |
'toguapplicationmodelsbundle.php' => 1, | |
'toguannotationbundle.php' => 1, | |
'toguadminbundle.php' => 1, | |
'toffiakurlshortenerbundle.php' => 1, | |
'skeleton.json.php' => 1, | |
'sitemap.xslt.php' => 1, | |
'email.class.php' => 1, | |
'tjmstandardeditionbundle.php' => 1, | |
'pprint_r.php' => 1, | |
'symfony2_env_vars' => 1, | |
'phpunit.bootstrapless.xml.dist' => 1, | |
'boris-loader.php' => 1, | |
'tobiassjostenthetvdbbundle.php' => 1, | |
'ascoraformatter.php' => 1, | |
'toavalidatorbundle.php' => 1, | |
'toatwitterbootstrapbundle.php' => 1, | |
'toaframeworkextrabundle.php' => 1, | |
'toalayoutbundle.php' => 1, | |
'toabowerbundle.php' => 1, | |
'toaasseticbundle.php' => 1, | |
'toaapcbundle.php' => 1, | |
'color_terminal.php' => 1, | |
'update_database.php' => 1, | |
'gaunt.php' => 1, | |
'my-sites-search.js' => 1, | |
'vhost.conf.dist' => 1, | |
'autocompletion.php' => 1, | |
'.env.docker.dist' => 1, | |
'jslogasset.php' => 1, | |
'arrayinputasset.php' => 1, | |
'arrayinput.php' => 1, | |
'aceeditor.php' => 1, | |
'capayable-client-php.sublime-project' => 1, | |
'myposeobundle.php' => 1, | |
'tristanbeselophantbundle.php' => 1, | |
'environment.php.dist' => 1, | |
'apiclientbundle.php' => 1, | |
'my-sites-search.php' => 1, | |
'my-sites-search.css' => 1, | |
'cerberus.mysql.sql' => 1, | |
'class-tp-taxonomy-terms.php' => 1, | |
'class-tp-post-type-posts.php' => 1, | |
'class-tp-widget-customizable.php' => 1, | |
'tw-sliders.php' => 1, | |
'class-tp-term-taxonomy-meta.php' => 1, | |
'class-tp-term-image.php' => 1, | |
'class-tp-term-description-editor.php' => 1, | |
'class-tp-tabs.php' => 1, | |
'class-tp-static-widget.php' => 1, | |
'class-tp-smtp.php' => 1, | |
'class-tp-related.php' => 1, | |
'class-tp-redirects.php' => 1, | |
'recurring-widgets.php' => 1, | |
'vhost.conf.docker.dist' => 1, | |
'cerberus.pgsql.sql' => 1, | |
'class-tp-post-type-archive-settings.php' => 1, | |
'tinymce.min.js' => 1, | |
'pingdom-rum.php' => 1, | |
'img-pingdom-logo.png' => 1, | |
'tuisessionbundle.php' => 1, | |
'tuhaokuai.php' => 1, | |
'rssreader.php' => 1, | |
'flagicon.php' => 1, | |
'uniqifier.php' => 1, | |
'bementioned' => 1, | |
'filebundle.php' => 1, | |
'update-1.1' => 1, | |
'tssbehatbuilderbundle.php' => 1, | |
'sculpinrelatedpostsbundle.php' => 1, | |
'relatedpostsgenerator.php' => 1, | |
'jquery.tinymce.min.js' => 1, | |
'clear.sql' => 1, | |
'cachedrivers.php.ini' => 1, | |
'asciimath.php' => 1, | |
'pkpass.php' => 1, | |
'trustly.php' => 1, | |
'ezcontentdecoratorbundle.php' => 1, | |
'trsteelhtmlformvalidationbundle.php' => 1, | |
'preloader.i18n.php' => 1, | |
'trovitcronmanagerbundle.php' => 1, | |
'doxyfile.in' => 1, | |
'gitnotes' => 1, | |
'mssqlbundle.php' => 1, | |
'httpwebrequest.php' => 1, | |
'sethost.php' => 1, | |
'composer54.json' => 1, | |
'class-tp-post-type-order.php' => 1, | |
'class-tp-opening-hours.php' => 1, | |
'future.json' => 1, | |
'privmsg.php' => 1, | |
'tpeigneadminbundle.php' => 1, | |
'activate' => 1, | |
'switcheryasset.php' => 1, | |
'switchery.php' => 1, | |
'fineuploaderjqueryasset.php' => 1, | |
'toukiftpbundle.php' => 1, | |
'index.csv' => 1, | |
'imageinspector' => 1, | |
'tzandertestbundle.php' => 1, | |
'tzblogbundle.php' => 1, | |
'pagefactory.iml' => 1, | |
'terms.php' => 1, | |
'styleguide.php' => 1, | |
'opensearch_desc_bt.xml' => 1, | |
'sitemapmodule.php' => 1, | |
'opensearch_desc.xml' => 1, | |
'modcp.php' => 1, | |
'group_edit.php' => 1, | |
'dl_list.php' => 1, | |
'dl.php' => 1, | |
'callseed.php' => 1, | |
'movefile.sample' => 1, | |
'uorm.lib.php' => 1, | |
'udb.php' => 1, | |
'mysqli-log.php' => 1, | |
'error-log.php' => 1, | |
'trtswiftcssinlinerbundle.php' => 1, | |
'trtasynctasksbundle.php' => 1, | |
'imagick.php' => 1, | |
'cmars.php' => 1, | |
'class-tp-opening-hours-widget.php' => 1, | |
'class-tp-debug.php' => 1, | |
'class-tp-opening-hours-special.php' => 1, | |
'class-tp-opening-hours-periods.php' => 1, | |
'class-tp-opening-hours-frontend.php' => 1, | |
'class-tp-opening-hours-day.php' => 1, | |
'class-tp-opening-hours-admin.php' => 1, | |
'multisite-labels.php' => 1, | |
'class-tp-multiple-thumbnails.php' => 1, | |
'multiple-content-blocks.php' => 1, | |
'class-tp-global-content-blocks.php' => 1, | |
'class-tp-events.php' => 1, | |
'class-tp-editor-capabilities.php' => 1, | |
'class-tp-dev-uploads.php' => 1, | |
'class-tp-dev-mail.php' => 1, | |
'credits.php' => 1, | |
'aliexpress.php' => 1, | |
'class-tp-contact-information.php' => 1, | |
'auto-update.php' => 1, | |
'trend404bundle.php' => 1, | |
'install_composer.sh' => 1, | |
'tweaks.patch' => 1, | |
'autoload.patch' => 1, | |
'pmd.xml' => 1, | |
'amkfile' => 1, | |
'.ctags' => 1, | |
'.empty' => 1, | |
'translationexchange.php' => 1, | |
'transferbundle.php' => 1, | |
'nikoladevanabookappbundle.php' => 1, | |
'cache-main.php' => 1, | |
'dwzasset.php' => 1, | |
'example.nginx.conf' => 1, | |
'phpab.bat' => 1, | |
'iron.json' => 1, | |
'formhandler.php' => 1, | |
'bpost.php' => 1, | |
'bpack247.php' => 1, | |
'dropbox.php' => 1, | |
'dbfact.php' => 1, | |
'ciscospa500.php' => 1, | |
'activecollab.php' => 1, | |
'translator.tpl.php' => 1, | |
'testfilter.php' => 1, | |
'lsoftadbundle.php' => 1, | |
'jigsaw' => 1, | |
'doctrinegeneratemodelsbundle.php' => 1, | |
'tigefa.jquery.json' => 1, | |
'tideways.php' => 1, | |
'shm-deep-integration-v3.xsd' => 1, | |
'tickitcachebundle.php' => 1, | |
'riak.php' => 1, | |
'php-doxyfile' => 1, | |
'testapi.php' => 1, | |
'freemobile.crt' => 1, | |
'freemobilenotificationsender.php' => 1, | |
'select2buttonasset.php' => 1, | |
'select2button.php' => 1, | |
'isloadingasset.php' => 1, | |
'isloadingajaxstatusasset.php' => 1, | |
'isloading.php' => 1, | |
'json2dto' => 1, | |
'triplepointphpunitsofmeasurebundle.php' => 1, | |
'geo6.php' => 1, | |
'log.todo' => 1, | |
'mapping.yaml' => 1, | |
'noderpcclient.php' => 1, | |
'booty.php' => 1, | |
'booty.i18n.php' => 1, | |
'booty.extension.php' => 1, | |
'booty.class.php' => 1, | |
'tester' => 1, | |
'u.php' => 1, | |
'elementoptionsplugin.php' => 1, | |
'rpcserverbundle.php' => 1, | |
'rpcserver.php' => 1, | |
'rpcproxy.php' => 1, | |
'rpcclientbundle.php' => 1, | |
'rpcclient.php' => 1, | |
'nodeserverbundle.php' => 1, | |
'nodeclientbundle.php' => 1, | |
'phonebook.mwb' => 1, | |
'nodeclient.php' => 1, | |
'geonamesbundle.php' => 1, | |
'geonames.php' => 1, | |
'querybuilder.png' => 1, | |
'devcon.jpg' => 1, | |
'varnishbundle.php' => 1, | |
'epicoftimewastedcryptobundle.php' => 1, | |
'timepadapi.php' => 1, | |
'stripeoauth2client.class.php' => 1, | |
'stripeoauth.class.php' => 1, | |
'raorocrmtimelapbundle.php' => 1, | |
'travis-codeclimate-report.sh' => 1, | |
'redis-cache.php' => 1, | |
'taskpaper.todo' => 1, | |
'sharepointapi.php' => 1, | |
'hinter.php' => 1, | |
'skinny.i18n.magic.php' => 1, | |
'rtti.php' => 1, | |
'newscoopmeteobluepluginbundle.php' => 1, | |
'newscoopdonationspluginbundle.php' => 1, | |
'inewstickerasset.php' => 1, | |
'thingdom.php' => 1, | |
'galdiboletobundle.php' => 1, | |
'thibaudtwittertwigextensionbundle.php' => 1, | |
'zenviamodule.php' => 1, | |
'apicomponent.php' => 1, | |
'skelgen' => 1, | |
'ppp.sublime-workspace' => 1, | |
'uploadutil.php' => 1, | |
'strutil.php' => 1, | |
'requestparser.php' => 1, | |
'paramutil.php' => 1, | |
'newscooptwitterpluginbundle.php' => 1, | |
'objectcreator.php' => 1, | |
'jsoninvoker.php' => 1, | |
'httpsender.php' => 1, | |
'classcreator.php' => 1, | |
'castutil.php' => 1, | |
'arrayutil.php' => 1, | |
'thewellcomcontactbundle.php' => 1, | |
'pirum-license' => 1, | |
'slim' => 1, | |
'phpdox.bat' => 1, | |
'phpdox' => 1, | |
'fdomdocument.spec' => 1, | |
'phpab.php' => 1, | |
'newscoopsmartyextensionspluginbundle.php' => 1, | |
'installing' => 1, | |
'helper.overframe.php' => 1, | |
'execute' => 1, | |
'config.overframe.php' => 1, | |
'statreportasset.php' => 1, | |
'statreport.php' => 1, | |
'series.php' => 1, | |
'fixedheaderasset.php' => 1, | |
'datatablesresponsiveasset.php' => 1, | |
'datatablesgridview.php' => 1, | |
'dataseries.php' => 1, | |
'thracemediabundle.php' => 1, | |
'thraceformbundle.php' => 1, | |
'thracedatagridbundle.php' => 1, | |
'thracecomponentbundle.php' => 1, | |
'execute.bat' => 1, | |
'booting.yml' => 1, | |
'apigeneratorbundle.php' => 1, | |
'thormeiertransportclientbundle.php' => 1, | |
'thormeierbreadcrumbbundle.php' => 1, | |
'thormeiermobiledetectlightbundle.php' => 1, | |
'twimultidomainlocalebundle.php' => 1, | |
'laravel-composer' => 1, | |
'bsd-3-clause-license' => 1, | |
'redpilllinprosimplereportsbundle.php' => 1, | |
'bisonlabsakonninbundle.php' => 1, | |
'bisonlabcommonbundle.php' => 1, | |
'querybuilderrepositorygeneratorbundle.php' => 1, | |
'jsonannotationbundle.php' => 1, | |
'tcreference_1.php' => 1, | |
'getsetforeignnormalizerbundle.php' => 1, | |
'doctrinerelationvisualizerbundle.php' => 1, | |
'skinny.class.php' => 1, | |
'skinny.i18n.php' => 1, | |
'tjvmollieidealbundle.php' => 1, | |
'file.hh' => 1, | |
'localeroute.hh' => 1, | |
'group.hh' => 1, | |
'filter.hh' => 1, | |
'callbackroute.hh' => 1, | |
'output.hh' => 1, | |
'middleware.hh' => 1, | |
'kernel.hh' => 1, | |
'input.hh' => 1, | |
'application.hh' => 1, | |
'abstractkernel.hh' => 1, | |
'writer.hh' => 1, | |
'node.hh' => 1, | |
'folder.hh' => 1, | |
'bundle.hh' => 1, | |
'route.hh' => 1, | |
'translator.hh' => 1, | |
'routeresolver.hh' => 1, | |
'pluralrule.hh' => 1, | |
'messageloader.hh' => 1, | |
'messagebundle.hh' => 1, | |
'localeregistry.hh' => 1, | |
'localebundle.hh' => 1, | |
'locale.hh' => 1, | |
'catalog.hh' => 1, | |
'outgoingresponseaware.hh' => 1, | |
'outgoingresponse.hh' => 1, | |
'mime.hh' => 1, | |
'message.hh' => 1, | |
'matcher.hh' => 1, | |
'router.hh' => 1, | |
'incomingrequest.hh' => 1, | |
'abstractvalidator.hh' => 1, | |
'test.selector.php' => 1, | |
'selector.inc' => 1, | |
'view.hh' => 1, | |
'template.hh' => 1, | |
'locator.hh' => 1, | |
'helper.hh' => 1, | |
'engineview.hh' => 1, | |
'engine.hh' => 1, | |
'abstractview.hh' => 1, | |
'validator.hh' => 1, | |
'corevalidator.hh' => 1, | |
'constraintprovider.hh' => 1, | |
'constraint.hh' => 1, | |
'validate.hh' => 1, | |
'urlbuilder.hh' => 1, | |
'time.hh' => 1, | |
'str.hh' => 1, | |
'sanitize.hh' => 1, | |
'path.hh' => 1, | |
'number.hh' => 1, | |
'inflect.hh' => 1, | |
'format.hh' => 1, | |
'config.hh' => 1, | |
'col.hh' => 1, | |
'xml.hh' => 1, | |
'stringbuffer.hh' => 1, | |
'objectcollection.hh' => 1, | |
'hashmap.hh' => 1, | |
'arraylist.hh' => 1, | |
'incomingrequestaware.hh' => 1, | |
'http.hh' => 1, | |
'skinny.php' => 1, | |
'zorbusadminthemebundle.php' => 1, | |
'arrayable.hh' => 1, | |
'storageaware.hh' => 1, | |
'storage.hh' => 1, | |
'missitem.hh' => 1, | |
'item.hh' => 1, | |
'hititem.hh' => 1, | |
'cache.hh' => 1, | |
'wiresannotations.hh' => 1, | |
'wireable.hh' => 1, | |
'annotation.hh' => 1, | |
'zorbususerthemebundle.php' => 1, | |
'zorbuspagebundle.php' => 1, | |
'zorbusblockbundle.php' => 1, | |
'zorbuslinkedinbundle.php' => 1, | |
'cacheable.hh' => 1, | |
'syncuptest.sh' => 1, | |
'syncup.sh' => 1, | |
'not_rsync_up' => 1, | |
'_deletepreviewfiles.php' => 1, | |
'webbotcheccker.php' => 1, | |
'tipimail.php' => 1, | |
'wikiseo.php' => 1, | |
'wikiseo.i18n.php' => 1, | |
'wikiseo.i18n.magic.php' => 1, | |
'wikiseo.body.php' => 1, | |
'skinny.template.php' => 1, | |
'skinny.slim.php' => 1, | |
'skinny.skin.php' => 1, | |
'bag.hh' => 1, | |
'jsonable.hh' => 1, | |
'cookie.hh' => 1, | |
'mcryptcipher.hh' => 1, | |
'subject.hh' => 1, | |
'observer.hh' => 1, | |
'listener.hh' => 1, | |
'event.hh' => 1, | |
'emitter.hh' => 1, | |
'emitsevents.hh' => 1, | |
'loader.hh' => 1, | |
'detector.hh' => 1, | |
'logger.hh' => 1, | |
'dumper.hh' => 1, | |
'debugger.hh' => 1, | |
'benchmark.hh' => 1, | |
'opensslcipher.hh' => 1, | |
'cipher.hh' => 1, | |
'macroable.hh' => 1, | |
'abstractcipher.hh' => 1, | |
'errorcontroller.hh' => 1, | |
'controller.hh' => 1, | |
'action.hh' => 1, | |
'abstractcontroller.hh' => 1, | |
'serviceprovider.hh' => 1, | |
'depository.hh' => 1, | |
'definition.hh' => 1, | |
'xmlable.hh' => 1, | |
'vectorable.hh' => 1, | |
'stringable.hh' => 1, | |
'staticcacheable.hh' => 1, | |
'mutable.hh' => 1, | |
'mapable.hh' => 1, | |
'alicacheserver.php' => 1, | |
'example.mdb' => 1, | |
'netsuite application developer license agreement' => 1, | |
'homonoia.php' => 1, | |
'staffimdtobundle.php' => 1, | |
'attachmentbuilder.php' => 1, | |
'stadlineexecutioncachebundle.php' => 1, | |
'stadlinejsextensionbundle.php' => 1, | |
'glog_util.php' => 1, | |
'stackinstancemailerbundle.php' => 1, | |
'xhprof.inc.php' => 1, | |
'yandexmetrika.php' => 1, | |
'metrikabase.php' => 1, | |
'metrika.php' => 1, | |
'ssonecmsbundle.php' => 1, | |
'talos.php' => 1, | |
'hygieia.php' => 1, | |
'hestia.php' => 1, | |
'staffimsplunkbundle.php' => 1, | |
'cache-manager.php' => 1, | |
'autoload.example.php' => 1, | |
'spjsonrpc.php' => 1, | |
'proxy.example.ini' => 1, | |
'test_converter.php' => 1, | |
'converter.class.php' => 1, | |
'apidoc.xml.dist' => 1, | |
'ceca.php' => 1, | |
'firebirdmigration.php' => 1, | |
'activeresponseasset.php' => 1, | |
'activeresponse.php' => 1, | |
'wp-cli-composer-command.php' => 1, | |
'no-wpmu.php' => 1, | |
'staffimdatetimebundle.php' => 1, | |
'staffimtimestampablebundle.php' => 1, | |
'socialshareevents.php' => 1, | |
'starkerxpcqrsesbundle.php' => 1, | |
'rebase.sh' => 1, | |
'deluntrackedbranch.sh' => 1, | |
'deltag.sh' => 1, | |
'addtag.sh' => 1, | |
'devbundle.php' => 1, | |
'contactbundle.php' => 1, | |
'spraedpdfgeneratorbundle.php' => 1, | |
'buildapidocs.sh' => 1, | |
'apcprofilerbundle.php' => 1, | |
'nyx.json.dist' => 1, | |
'dbmysql.php' => 1, | |
'startplatzwordpressintegrationbundle.php' => 1, | |
'soundex.php' => 1, | |
'wp-commonmark.php' => 1, | |
'cfvalidator.php' => 1, | |
'solero.php' => 1, | |
'wp-deep-links.php' => 1, | |
'deeplinks.php' => 1, | |
'lemonrestbundle.php' => 1, | |
'lemonreportbundle.php' => 1, | |
'lemoncrudbundle.php' => 1, | |
'lemonbootstrapbundle.php' => 1, | |
'lemonappbundle.php' => 1, | |
'sms-factory.uml' => 1, | |
'searcher.uml' => 1, | |
'sf-code.class.php' => 1, | |
'stampery.inc.php' => 1, | |
'license.zf' => 1, | |
'cfvalidatorasset.php' => 1, | |
'lockdown-wp-admin.php' => 1, | |
'srozeiosocialsharebundle.php' => 1, | |
'status.sh' => 1, | |
'spiritdevcihubpostbundle.php' => 1, | |
'osteo.yml' => 1, | |
'tokenmanagerbundle.php' => 1, | |
'sncapiloggerbundle.php' => 1, | |
'apiauthenticator.php' => 1, | |
'abstractfixtureloadbundle.php' => 1, | |
'abstractfixtureload.php' => 1, | |
'sample.png' => 1, | |
'mono.png' => 1, | |
'everyblock-php-api.php' => 1, | |
'class-querystring.php' => 1, | |
'spiritdevoauth2clientbundle.php' => 1, | |
'spiritdevoauth2serverbundle.php' => 1, | |
'spiritdevcihubprebundle.php' => 1, | |
'spiritdevcihubcorebundle.php' => 1, | |
'spress.php' => 1, | |
'spiritdevbugreporterbundle.php' => 1, | |
'spiral.bat' => 1, | |
'spiral' => 1, | |
'spiraapplication.php' => 1, | |
'urlentry.php' => 1, | |
'generator' => 1, | |
'filterbuilder.php' => 1, | |
'spiiicyflightstatsbundle.php' => 1, | |
'application.config.php.dist' => 1, | |
'license_vendor' => 1, | |
'future.php' => 1, | |
'apidockert.php' => 1, | |
's4atimeagobundle.php' => 1, | |
'sprainvalidatorbundle.php' => 1, | |
'cerb5_webapi.php' => 1, | |
'sriorestuploadbundle.php' => 1, | |
'websocket_server.php' => 1, | |
'processcollection.php' => 1, | |
'namedchainprocessinterface.php' => 1, | |
'dependentchainprocessinterface.php' => 1, | |
'decoratorfactoryinterface.php' => 1, | |
'decoratorfactory.php' => 1, | |
'chainrunner.php' => 1, | |
'chainprocessinterface.php' => 1, | |
'chainprocessdecorator.php' => 1, | |
'chaincontext.php' => 1, | |
'chainbuilder.php' => 1, | |
'arraychaincontext.php' => 1, | |
'jquery.easypaginate.js' => 1, | |
'easypaginate.jquery.json' => 1, | |
'websocket_client.html' => 1, | |
'cachemanagerinterface.php' => 1, | |
'basicoauth.php' => 1, | |
'docusign.php' => 1, | |
'bookmark.php' => 1, | |
'spyritpropeldatagridbundle.php' => 1, | |
'spyritpropelcrudgeneratorbundle.php' => 1, | |
'tabcollapsex.php' => 1, | |
'tabcollapseasset.php' => 1, | |
'tabcollapse.php' => 1, | |
'collapsebehavior.php' => 1, | |
'sputnikpubsubbundle.php' => 1, | |
'pubsubevents.php' => 1, | |
'sputniknewsletterbundle.php' => 1, | |
'batchsubscriberinterface.php' => 1, | |
'sputnikcachebundle.php' => 1, | |
'renamebranch.sh' => 1, | |
'proxybundle.php' => 1, | |
'sunrise-scenarios.sh' => 1, | |
'stocarultwitterbundle.php' => 1, | |
'elasticbundle.php' => 1, | |
'pff2.iml' => 1, | |
'run_phpunit.sh' => 1, | |
'run_phpmd.sh' => 1, | |
'pre_commit.sh' => 1, | |
'init-pgsql.sql' => 1, | |
'init-mysql.sql' => 1, | |
'doctrine-bootstrap.php' => 1, | |
'config-testing.php' => 1, | |
'ckeditor.css' => 1, | |
'addventurectl.php' => 1, | |
'xlabpchartbundle.php' => 1, | |
'stocarulurbanairshipbundle.php' => 1, | |
'pitechpdodblibbundle.php' => 1, | |
'key.p12.enc' => 1, | |
'stocarulfacebookbundle.php' => 1, | |
'stnwdatepickerbundle.php' => 1, | |
'avatarbundle.php' => 1, | |
'flipclock.php' => 1, | |
'excuseme.php' => 1, | |
'simusanteuserwidgetbundle.php' => 1, | |
'cpasimusantesimutoolsbundle.php' => 1, | |
'cpasimusantesimuresourcebundle.php' => 1, | |
'cpasimusanteghangoutbundle.php' => 1, | |
'simusantepfcbundle.php' => 1, | |
'charcoal.inc.php' => 1, | |
'ditto.sublime-project' => 1, | |
'phpunit.unit.xml' => 1, | |
'issue' => 1, | |
'tech' => 1, | |
'bootstrap.integration.php' => 1, | |
'wp-term-colors.php' => 1, | |
'soapaction.php' => 1, | |
'paynl.php' => 1, | |
'icepay.php' => 1, | |
'servecontroller.php' => 1, | |
'changyanwidget.php' => 1, | |
'stz184captchabundle.php' => 1, | |
'wp-user-profiles.php' => 1, | |
'wp-user-groups.php' => 1, | |
'wp-user-avatars.php' => 1, | |
'wp-user-activity.php' => 1, | |
'wp-term-visibility.php' => 1, | |
'wp-term-meta.php' => 1, | |
'wp-term-families.php' => 1, | |
'wp-spider-cache.php' => 1, | |
'.git_workflow.ini' => 1, | |
'wp-post-publish-ays.php' => 1, | |
'wpmn-loader.php' => 1, | |
'wp-event-calendar.php' => 1, | |
'wp-comment-humility.php' => 1, | |
'wp-article-order.php' => 1, | |
'studiositeapiclientgeneratorbundle.php' => 1, | |
'conventer.php' => 1, | |
'studioartlansyngbundle.php' => 1, | |
'demo_auth.php' => 1, | |
'strsocialsmsqueuebundle.php' => 1, | |
'stormssonmultifetchbundle.php' => 1, | |
'clientside.php' => 1, | |
'deploy-key.enc' => 1, | |
'sagextras.php' => 1, | |
'bootstrap.unit.php' => 1, | |
'pui.php' => 1, | |
'blockprefixtrait.php' => 1, | |
'ssh2bundle.php' => 1, | |
'contentdivider.php' => 1, | |
'advent' => 1, | |
'cloudflare' => 1, | |
'zebra_curl.php' => 1, | |
'zebra_session.php' => 1, | |
'zebra_pagination.php' => 1, | |
'zebra_mptt.php' => 1, | |
'zebra_image.php' => 1, | |
'mimes.json' => 1, | |
'zebra_form.php' => 1, | |
'zebra_database.php' => 1, | |
'sbpushbulletbundle.php' => 1, | |
'versionsbundle.php' => 1, | |
'shortcutsbundle.php' => 1, | |
'facecommanderbundle.php' => 1, | |
'scripts.sh' => 1, | |
'schema.sh' => 1, | |
'pull.sh' => 1, | |
'doctrinemigrations.sh' => 1, | |
'doctrinecache.sh' => 1, | |
'dirs.sh' => 1, | |
'csfixer.sh' => 1, | |
'composerupdate.sh' => 1, | |
'composerinstall.sh' => 1, | |
'cache.sh' => 1, | |
'assetsinstall.sh' => 1, | |
'asseticdump.sh' => 1, | |
'nametrait.php' => 1, | |
'mangojsonapibundle.php' => 1, | |
'modeltrait.php' => 1, | |
'pdb.php' => 1, | |
'changelog.config.php' => 1, | |
'stfalconportfoliobundle.php' => 1, | |
'stfalconpaymentbundle.php' => 1, | |
'stfalconpagebundle.php' => 1, | |
'stfalconnewsbundle.php' => 1, | |
'cron.conf' => 1, | |
'stfalconshippingbundle.php' => 1, | |
'stfalconabtestbundle.php' => 1, | |
'stewejsi18nbundle.php' => 1, | |
'stevninjainvoicebundle.php' => 1, | |
'stevlistafirmebundle.php' => 1, | |
'stevgeonamesbundle.php' => 1, | |
'footestcase.php' => 1, | |
'barsuite.xml' => 1, | |
'process_aweber.php' => 1, | |
'class-php-ico.php' => 1, | |
'aweberclass.php' => 1, | |
'api-guide' => 1, | |
'menubrowser.php' => 1, | |
'phpcs.xml.sample' => 1, | |
'phpcs-vip.xml.sample' => 1, | |
'inventory-banner.jpg' => 1, | |
'calendar-helper-banner.jpg' => 1, | |
'sladbookingbundle.php' => 1, | |
'mustang.engine' => 1, | |
'mustache.engine' => 1, | |
'handlebars.engine' => 1, | |
'forecast' => 1, | |
'newpassword' => 1, | |
'laravelmodelbehavior.php' => 1, | |
'.gitattributes.layout' => 1, | |
'unusedcode.xml' => 1, | |
'francium.log' => 1, | |
'sesshin' => 1, | |
'soerenmartiuswishlistbundle.php' => 1, | |
'digitalshiftmailboxpersistencebundle.php' => 1, | |
'digitalshiftmailboxformbundle.php' => 1, | |
'digitalshiftmailboxconnectionbundle.php' => 1, | |
'date_time_picker-v5.php' => 1, | |
'date_time_picker-v4.php' => 1, | |
'date_time_picker-v3.php' => 1, | |
'acf-date_time_picker.php' => 1, | |
'jupiter' => 1, | |
'requirements-test' => 1, | |
'parallel-phpunit' => 1, | |
'exelreaderinterface.php' => 1, | |
'exel.php' => 1, | |
'hybridauthcomponent.php' => 1, | |
'duallistboxasset.php' => 1, | |
'left-pad.php' => 1, | |
'receive.php' => 1, | |
'config.xsd' => 1, | |
'snowcapyamlfixturesbundle.php' => 1, | |
'snowcapogonebundle.php' => 1, | |
'ogonemanager.php' => 1, | |
'ogoneevents.php' => 1, | |
'snowcapimbundle.php' => 1, | |
'snowcapi18nbundle.php' => 1, | |
'snowcapelasticabundle.php' => 1, | |
'snowcapcorebundle.php' => 1, | |
'snowcapcachebundle.php' => 1, | |
'snowcapbootstrapbundle.php' => 1, | |
'creole.php' => 1, | |
'sample-code' => 1, | |
'whoops.php' => 1, | |
'soilnotificationbundle.php' => 1, | |
'solilokiamsummernotebundle.php' => 1, | |
'httprediscache.php' => 1, | |
'installerwrapper.php' => 1, | |
'disable-comments-mu.php' => 1, | |
'solano.yml' => 1, | |
'solano-phpunit' => 1, | |
'bare-composer.json' => 1, | |
'bare-readme' => 1, | |
'soilusertrackbundle.php' => 1, | |
'soilsmserbundle.php' => 1, | |
'soilrdfpersistencebundle.php' => 1, | |
'soilqueuehttpendpointbundle.php' => 1, | |
'soilonsitenotificationbundle.php' => 1, | |
'soileventbundle.php' => 1, | |
'captchaasset.php' => 1, | |
'soildiscoverbundle.php' => 1, | |
'soilcorsrequesthandlerbundle.php' => 1, | |
'soilcommentsdigestbundle.php' => 1, | |
'soilackservicebundle.php' => 1, | |
'eloquent-command.php' => 1, | |
'softlogouserbundle.php' => 1, | |
'softlogoshopbundle.php' => 1, | |
'softlogoproductbundle.php' => 1, | |
'softlogoportfoliobundle.php' => 1, | |
'softlogonewsbundle.php' => 1, | |
'softlogocustomerbundle.php' => 1, | |
'softlogocmsbundle.php' => 1, | |
'softflygeneratorbundle.php' => 1, | |
'seto-mini.ttf' => 1, | |
'snowcapadminbundle.php' => 1, | |
'twig.class.php' => 1, | |
'moneta-api.ini' => 1, | |
'deliverer.php' => 1, | |
'cache-faculty-journal-menus.sql' => 1, | |
'enrollment-info-ui-tweaks.js' => 1, | |
'embedded-documentation.js' => 1, | |
'discussion-permalinks.js' => 1, | |
'show-rubrics.php' => 1, | |
'cache-rubrics.php' => 1, | |
'cache-and-show-rubrics.js' => 1, | |
'bookmarklet.php' => 1, | |
'bookmarklet.js' => 1, | |
'auto-open-feedback.js' => 1, | |
'wpup' => 1, | |
'intro.gif' => 1, | |
'smsupapibundle.php' => 1, | |
'smoyaomniatabundle.php' => 1, | |
'smcanvaslib' => 1, | |
'makerlabspagerbundle.php' => 1, | |
'smoyacustomchoicebundle.php' => 1, | |
'smoyaassetmanagementbundle.php' => 1, | |
'gnu-gpl' => 1, | |
'installcheck.php' => 1, | |
'aplbundle.php' => 1, | |
'smith981securitybundle.php' => 1, | |
'smith981newsboxbundle.php' => 1, | |
'smith981crudgeneratorbundle.php' => 1, | |
'smiriktaggablebundle.php' => 1, | |
'smirikpropelserializerbundle.php' => 1, | |
'smirikpropeladminbundle.php' => 1, | |
'smirikconfigbundle.php' => 1, | |
'faculty-journal.php' => 1, | |
'student-loader.php' => 1, | |
'monolog.php' => 1, | |
'oauthnegotiator.php' => 1, | |
'hookagent.php' => 1, | |
'dotarrayfilter.php' => 1, | |
'cyberappuploaderbundle.php' => 1, | |
'cyberapptreechoicebundle.php' => 1, | |
'cyberappselect2bundle.php' => 1, | |
'twofactorforeveryone.png' => 1, | |
'snapcmsmodule.php' => 1, | |
'microphp.php' => 1, | |
'microphp.min.php' => 1, | |
'cloud-zoom.js' => 1, | |
'cloud-zoom.css' => 1, | |
'smurfyasseticcssbundleimagesbundle.php' => 1, | |
'asaayerscrowdbundle.php' => 1, | |
'templates.js.php' => 1, | |
'canvas-custom-prefs.sql' => 1, | |
'templates-schema.sql' => 1, | |
'templates-loader.js' => 1, | |
'template-copy.php' => 1, | |
'assignments api.csv' => 1, | |
'color-schedule.js.php' => 1, | |
'color-schedule.css.php' => 1, | |
'stmarks-branding.css' => 1, | |
'organize-user-enrollments.css' => 1, | |
'lock-notifications.js.php' => 1, | |
'lock-notifications.css' => 1, | |
'navigation-menu.js.php' => 1, | |
'navbar.css' => 1, | |
'menu-loader.js' => 1, | |
'click.php' => 1, | |
'solispauwelsthemespackbundle.php' => 1, | |
'meme.phar' => 1, | |
'naming.xml' => 1, | |
'echo-js-lazy-load.php' => 1, | |
'writer.sql' => 1, | |
'commentswidget.php' => 1, | |
'spamjs_book.iml' => 1, | |
'project_structure' => 1, | |
'package_structure' => 1, | |
'libraries' => 1, | |
'isjs' => 1, | |
'foojs' => 1, | |
'definejs' => 1, | |
'glossary' => 1, | |
'super-simple-events.php' => 1, | |
'simple-google-news-sitemap.php' => 1, | |
'wpcom-helper.php' => 1, | |
'disable-xml-rpc-fully.php' => 1, | |
'http-status-check' => 1, | |
'custom-post-type-rss-feed.php' => 1, | |
'built-in-taxos-cpt.php' => 1, | |
'advanced-nav-cache.php' => 1, | |
'repairtags.php' => 1, | |
'soyukaseedbundle.php' => 1, | |
'phpsemver.xml' => 1, | |
'docker-compose-dev.yml' => 1, | |
'svntime.php' => 1, | |
'revisions.csv' => 1, | |
'months.csv' => 1, | |
'example.bat' => 1, | |
'cleaned_blocks.csv' => 1, | |
'blocks.csv' => 1, | |
'php7to5' => 1, | |
'ssl-certificate-chain-resolver' => 1, | |
'html2text.php' => 1, | |
'htmlpurifier.safe-includes.php' => 1, | |
'design.xml' => 1, | |
'controversial.xml' => 1, | |
'codesize.xml' => 1, | |
'cleancode.xml' => 1, | |
'composer-package-update-checker.php' => 1, | |
'composer-package-update-checker' => 1, | |
'composerupdatechecker.php' => 1, | |
'painfreereleases' => 1, | |
'gitpolicy' => 1, | |
'analyser' => 1, | |
'.gitpolicy.yml' => 1, | |
'transipclient.php' => 1, | |
'wideimage.php' => 1, | |
'htmlpurifier.path.php' => 1, | |
'specgenstateworkflowspecgenbundle.php' => 1, | |
'htmlpurifier.kses.php' => 1, | |
'htmlpurifier.includes.php' => 1, | |
'htmlpurifier.func.php' => 1, | |
'htmlpurifier.composer.php' => 1, | |
'htmlpurifier.autoload.php' => 1, | |
'htmlpurifier.auto.php' => 1, | |
'polymerasset.php' => 1, | |
'headerpanel.php' => 1, | |
'static.tpl' => 1, | |
'login.tpl' => 1, | |
'header.tpl' => 1, | |
'footer.tpl' => 1, | |
'component.tpl' => 1, | |
'project.kwi' => 1, | |
'spritify.php' => 1, | |
'global_defines.sample.php' => 1, | |
'pvp_api.php' => 1, | |
'sonatradoctrineextensionsbundle.php' => 1, | |
'sonatrasessionbundle.php' => 1, | |
'sonatrasecuritybundle.php' => 1, | |
'reachableroleevents.php' => 1, | |
'organizationaltypes.php' => 1, | |
'identityretrievalevents.php' => 1, | |
'aclmanipulatorevents.php' => 1, | |
'sonatraresourcebundle.php' => 1, | |
'resourcestatutes.php' => 1, | |
'resourceliststatutes.php' => 1, | |
'sonatramailerbundle.php' => 1, | |
'mailtypes.php' => 1, | |
'sonatragluonbundle.php' => 1, | |
'sonatraformextensionsbundle.php' => 1, | |
'sonatradoctrineconsolebundle.php' => 1, | |
'spoolemailstatus.php' => 1, | |
'sonatradefaultvaluebundle.php' => 1, | |
'sonatrabootstrapbundle.php' => 1, | |
'sonatrablockbundle.php' => 1, | |
'sonatraajaxbundle.php' => 1, | |
'ajaxevents.php' => 1, | |
'missingscmplugin.php' => 1, | |
'sonatajquerybundle.php' => 1, | |
'sonatatranslationbundle.php' => 1, | |
'sonatapropeladminbundle.php' => 1, | |
'sonatamarkitupbundle.php' => 1, | |
'sonataintlbundle.php' => 1, | |
'sonataeasyextendsbundle.php' => 1, | |
'sonataadminsearchbundle.php' => 1, | |
'sonatraswiftmailerdoctrinebundle.php' => 1, | |
'sntoolboxbundle.php' => 1, | |
'fs_directory.php' => 1, | |
'sopinetsimplepointbundle.php' => 1, | |
'fs_dialplan.php' => 1, | |
'fs_curl.php' => 1, | |
'fs_configuration.php' => 1, | |
'fs_chatplan.php' => 1, | |
'fs_cdr.php' => 1, | |
'dialplan_importer.php' => 1, | |
'sopinetchatbundle.php' => 1, | |
'sopinetuserbundle.php' => 1, | |
'sopinetuserpreferencesbundle.php' => 1, | |
'sopinetusernotificationsbundle.php' => 1, | |
'sopinetuploadmagicbundle.php' => 1, | |
'sopinettimelinebundle.php' => 1, | |
'sopinettemplatesbadmin2bundle.php' => 1, | |
'sopinetlogbundle.php' => 1, | |
'regionutils.php' => 1, | |
'help.es' => 1, | |
'sopinetflashmessagesbundle.php' => 1, | |
'sopinetcolorizebundle.php' => 1, | |
'sopinetbootstrapextendbundle.php~' => 1, | |
'sopinetbootstrapextendbundle.php' => 1, | |
'sopinetautologinbundle.php' => 1, | |
'sopinetaboutmagicbundle.php' => 1, | |
'sopinetuploadfilesbundle.php' => 1, | |
'sopinetgcmbundle.php' => 1, | |
'gcmevents.php' => 1, | |
'sopinetapihelperbundle.php' => 1, | |
'sopinetadminbundle.php' => 1, | |
'improverangevalidator.php' => 1, | |
'regionvalidator.php' => 1, | |
'soapservice.php' => 1, | |
'class.logsys.php' => 1, | |
'phpaccess.php' => 1, | |
'propertyaccessextractorinterface.php' => 1, | |
'csrftokenmanager.php' => 1, | |
'authenticationevents.php' => 1, | |
'securitybundle.php' => 1, | |
'routecollectionbuilder.php' => 1, | |
'requestcontextawareinterface.php' => 1, | |
'compiledroute.php' => 1, | |
'httpmessagefactoryinterface.php' => 1, | |
'httpfoundationfactoryinterface.php' => 1, | |
'propertytypeextractorinterface.php' => 1, | |
'propertylistextractorinterface.php' => 1, | |
'propertyinfoextractorinterface.php' => 1, | |
'propertyinfoextractor.php' => 1, | |
'propertydescriptionextractorinterface.php' => 1, | |
'propertypathiteratorinterface.php' => 1, | |
'abstractguardauthenticator.php' => 1, | |
'propertypathiterator.php' => 1, | |
'propertypathinterface.php' => 1, | |
'propertypathbuilder.php' => 1, | |
'propertypath.php' => 1, | |
'propertyaccessorinterface.php' => 1, | |
'propertyaccessorbuilder.php' => 1, | |
'processutils.php' => 1, | |
'processbuilder.php' => 1, | |
'phpprocess.php' => 1, | |
'phpexecutablefinder.php' => 1, | |
'inputstream.php' => 1, | |
'executablefinder.php' => 1, | |
'binaryonfuncoverload.php' => 1, | |
'csrftokenmanagerinterface.php' => 1, | |
'guardauthenticatorhandler.php' => 1, | |
'php70.php' => 1, | |
'templatenameparser.php' => 1, | |
'appvariable.php' => 1, | |
'translatorbaginterface.php' => 1, | |
'pluralizationrules.php' => 1, | |
'metadataawareinterface.php' => 1, | |
'messageselector.php' => 1, | |
'messagecatalogueinterface.php' => 1, | |
'messagecatalogue.php' => 1, | |
'loggingtranslator.php' => 1, | |
'identitytranslator.php' => 1, | |
'datacollectortranslator.php' => 1, | |
'templatereferenceinterface.php' => 1, | |
'templatereference.php' => 1, | |
'templatenameparserinterface.php' => 1, | |
'streamingengineinterface.php' => 1, | |
'guardauthenticatorinterface.php' => 1, | |
'phpengine.php' => 1, | |
'delegatingengine.php' => 1, | |
'.travis.php' => 1, | |
'stopwatchperiod.php' => 1, | |
'stopwatchevent.php' => 1, | |
'stopwatch.php' => 1, | |
'section.php' => 1, | |
'serializerawaretrait.php' => 1, | |
'securityevents.php' => 1, | |
'parameterbagutils.php' => 1, | |
'firewallmapinterface.php' => 1, | |
'firewallmap.php' => 1, | |
'accessmapinterface.php' => 1, | |
'accessmap.php' => 1, | |
'binarynofuncoverload.php' => 1, | |
'php56.php' => 1, | |
'constraint.php' => 1, | |
'formrendererinterface.php' => 1, | |
'reversedtransformer.php' => 1, | |
'resolvedformtypeinterface.php' => 1, | |
'resolvedformtypefactoryinterface.php' => 1, | |
'resolvedformtypefactory.php' => 1, | |
'resolvedformtype.php' => 1, | |
'requesthandlerinterface.php' => 1, | |
'preloadedextension.php' => 1, | |
'nativerequesthandler.php' => 1, | |
'formview.php' => 1, | |
'formtypeinterface.php' => 1, | |
'formtypeguesserinterface.php' => 1, | |
'formtypeguesserchain.php' => 1, | |
'formtypeextensioninterface.php' => 1, | |
'formrendererengineinterface.php' => 1, | |
'submitbuttonbuilder.php' => 1, | |
'formrenderer.php' => 1, | |
'formregistryinterface.php' => 1, | |
'formregistry.php' => 1, | |
'formfactoryinterface.php' => 1, | |
'formfactorybuilderinterface.php' => 1, | |
'formfactorybuilder.php' => 1, | |
'formfactory.php' => 1, | |
'formextensioninterface.php' => 1, | |
'formevents.php' => 1, | |
'formerroriterator.php' => 1, | |
'formerror.php' => 1, | |
'formconfiginterface.php' => 1, | |
'formconfigbuilderinterface.php' => 1, | |
'submitbutton.php' => 1, | |
'submitbuttontypeinterface.php' => 1, | |
'php55arraycolumn.php' => 1, | |
'icudata.php' => 1, | |
'php55.php' => 1, | |
'php54.php' => 1, | |
'mbstring.php' => 1, | |
'grapheme.php' => 1, | |
'iconv.php' => 1, | |
'optionsresolver.php' => 1, | |
'notfoundactivationstrategy.php' => 1, | |
'monologbundle.php' => 1, | |
'ldapclientinterface.php' => 1, | |
'ldapclient.php' => 1, | |
'icuregionbundle.php' => 1, | |
'iculocalebundle.php' => 1, | |
'iculanguagebundle.php' => 1, | |
'icucurrencybundle.php' => 1, | |
'acceptheader.php' => 1, | |
'urisigner.php' => 1, | |
'terminableinterface.php' => 1, | |
'kernelinterface.php' => 1, | |
'serverbag.php' => 1, | |
'responseheaderbag.php' => 1, | |
'requeststack.php' => 1, | |
'requestmatcherinterface.php' => 1, | |
'requestmatcher.php' => 1, | |
'iputils.php' => 1, | |
'headerbag.php' => 1, | |
'expressionrequestmatcher.php' => 1, | |
'binaryfileresponse.php' => 1, | |
'apacherequest.php' => 1, | |
'acceptheaderitem.php' => 1, | |
'templateiterator.php' => 1, | |
'constraintvalidator.php' => 1, | |
'formbuilderinterface.php' => 1, | |
'tadckasitemapbundle.php' => 1, | |
'urls.sql' => 1, | |
'endiciaapi.php' => 1, | |
'tahoecrudbundle.php' => 1, | |
'tahoecredentialbundle.php' => 1, | |
'countries.json' => 1, | |
'out.php' => 1, | |
'outtest.php' => 1, | |
'tadckatreebundle.php' => 1, | |
'textinformation.php' => 1, | |
'tadckatextbundle.php' => 1, | |
'tadckageneratorbundle.php' => 1, | |
'modelmanagerinfo.php' => 1, | |
'tadckasitemapevents.php' => 1, | |
'tadckaroutingbundle.php' => 1, | |
'newscoopgithublatestcommitsbundle.php' => 1, | |
'tadckareporterbundle.php' => 1, | |
'tadckapaginatorbundle.php' => 1, | |
'tadckaobjectratingbundle.php' => 1, | |
'objectratinginfo.php' => 1, | |
'tadckanoticemanagerbundle.php' => 1, | |
'noticetype.php' => 1, | |
'tadckamapperbundle.php' => 1, | |
'tadckajstreebundle.php' => 1, | |
'filedownloader.php' => 1, | |
'tadckaattributesbundle.php' => 1, | |
'tadckaaddressbundle.php' => 1, | |
'psr-police' => 1, | |
'php-cs-fixer.pre-commit.php' => 1, | |
'takeitamphtmlbundle.php' => 1, | |
'newscoopcommunitytickerbundle.php' => 1, | |
'propelwebprofilerserviceprovider.php' => 1, | |
'automate.config' => 1, | |
'finzip.php' => 1, | |
'tconverter.class.php' => 1, | |
'routerintern.interface.php' => 1, | |
'routerintern.class.php' => 1, | |
'routerext.php' => 1, | |
'errors.class.php' => 1, | |
'client.json' => 1, | |
'model.interface.php' => 1, | |
'loadbase.php' => 1, | |
'controller.interface.php' => 1, | |
'controller.class.php' => 1, | |
'automate.php' => 1, | |
'automate.json' => 1, | |
'bdados.php' => 1, | |
'locks.log' => 1, | |
'bdadospdo.php' => 1, | |
'cs' => 1, | |
'tambur.php' => 1, | |
'weather.php' => 1, | |
'toby.php' => 1, | |
'rackem.php' => 1, | |
'tamagotipsmanagerbundle.php' => 1, | |
'tamagofeedrenderbundle.php' => 1, | |
'cccemailtemplatebundle.php' => 1, | |
'install_v8js' => 1, | |
'tab.php' => 1, | |
'materializecustomasset.php' => 1, | |
'fab.php' => 1, | |
'basewidgettrait.php' => 1, | |
'daydream.php' => 1, | |
'propellogger.php' => 1, | |
'constraintvalidatorfactoryinterface.php' => 1, | |
's2bcrawlerbundle.php' => 1, | |
'inputrange.php' => 1, | |
'syselevenpowerdnsbundle.php' => 1, | |
'mysqlmyisamdriver.php' => 1, | |
'syrmawebcontainerbundle.php' => 1, | |
'synoliafullcontactbundle.php' => 1, | |
'readonlybehavior.php' => 1, | |
'synatreeasset.php' => 1, | |
'dynamicrelations.php' => 1, | |
'synaqzasabundle.php' => 1, | |
'synaqcurlbundle.php' => 1, | |
'phpunit.shippable.xml' => 1, | |
'symtoockeditorbundle.php' => 1, | |
'acmesymfonyanbundle.php' => 1, | |
'admingeneratorformextensionsbundle.php' => 1, | |
'fullcalendarbundle.php' => 1, | |
'admingeneratorformbundle.php' => 1, | |
'check_cs' => 1, | |
'unescaper.php' => 1, | |
'inline.php' => 1, | |
'webprofilerbundle.php' => 1, | |
'validatorbuilderinterface.php' => 1, | |
'validatorbuilder.php' => 1, | |
'objectinitializerinterface.php' => 1, | |
'groupsequenceproviderinterface.php' => 1, | |
'constraintviolationlistinterface.php' => 1, | |
'constraintviolationlist.php' => 1, | |
'constraintviolationinterface.php' => 1, | |
'constraintvalidatorinterface.php' => 1, | |
'pagemediasetbundle.php' => 1, | |
'sessao.php' => 1, | |
'propeldatacollector.php' => 1, | |
'wunderliststrategy.php' => 1, | |
'docini' => 1, | |
'edmodostrategy.php' => 1, | |
'tabernicolajukeclouduserbundle.php' => 1, | |
'tabernicolajukecloudbundle.php' => 1, | |
'tabernicolajukecloudadminbundle.php' => 1, | |
'tabernicolablogbundle.php' => 1, | |
'ezreal-0.html' => 1, | |
'tabbi89commanderbundle.php' => 1, | |
'twigextrabundle.php' => 1, | |
'phpunit.xml.coverage' => 1, | |
'tpsolariumextensionsbundle.php' => 1, | |
't73biztranslocationbundle.php' => 1, | |
'changleog' => 1, | |
'wakatimestrategy.php' => 1, | |
'createtable.php' => 1, | |
'ultraregstrategy.php' => 1, | |
'trellostrategy.php' => 1, | |
'timelystrategy.php' => 1, | |
'slackstrategy.php' => 1, | |
'harveststrategy.php' => 1, | |
'frecklestrategy.php' => 1, | |
'dropboxstrategy.php' => 1, | |
'campaignmonitorstrategy.php' => 1, | |
'basecampstrategy.php' => 1, | |
'ignore.gitignore' => 1, | |
'entityexplorerbundle.php' => 1, | |
'szummediauploadbundle.php' => 1, | |
'szumadministrationpanelbundle.php' => 1, | |
'auto-login.php' => 1, | |
'formconfigbuilder.php' => 1, | |
'datatransformerinterface.php' => 1, | |
'tca.php' => 1, | |
'tagcloudall.php' => 1, | |
'keriodirectoryapi.php' => 1, | |
'keriocontrolapi.php' => 1, | |
'kerioconnectapi.php' => 1, | |
'superfeedr.php' => 1, | |
'curl_readme' => 1, | |
'debug-tests.sh' => 1, | |
'.blackfire.yml' => 1, | |
'superreal.png' => 1, | |
'sunraturbosmsbundle.php' => 1, | |
'wishlistmember.php' => 1, | |
'widgetadvertisement.php' => 1, | |
'widgetadvertisement .ss' => 1, | |
'tagcloudall.ss' => 1, | |
'sidetext.png' => 1, | |
'kerioworkspaceapi.php' => 1, | |
'sidetextwidget.ss' => 1, | |
'sidetextwidget.php' => 1, | |
'richadvertisement.ss' => 1, | |
'richadvertisement.php' => 1, | |
'quote.ss' => 1, | |
'quote.php' => 1, | |
'quicklinks.ss' => 1, | |
'quicklinks.php' => 1, | |
'featuredvideowidget.ss' => 1, | |
'featuredvideowidget.php' => 1, | |
'latestpagesvisitedwidget.ss' => 1, | |
'latestpagesvisitedwidget.php' => 1, | |
'latestblogentries.ss' => 1, | |
'keriooperatorapi.php' => 1, | |
'samepageapi.php' => 1, | |
'headlines.ss' => 1, | |
'effect.js' => 1, | |
'ant-crc32.jar' => 1, | |
'ajaxfileuploadcomponent.php' => 1, | |
'graphqlbundle.php' => 1, | |
'graphql.php' => 1, | |
'uploadbutton.js' => 1, | |
'swf.js' => 1, | |
'storage.js' => 1, | |
'sound.js' => 1, | |
'sharedobject.js' => 1, | |
'sb.js' => 1, | |
'js1_5.js' => 1, | |
'ie6.js' => 1, | |
'flashgate.js' => 1, | |
'developer.js' => 1, | |
'supertaggearmanbundle.php' => 1, | |
'cookies.js' => 1, | |
'bookmarklets.js' => 1, | |
'uploadbutton.swf' => 1, | |
'surebert.swf' => 1, | |
'flashgate.swf' => 1, | |
'neostag.php' => 1, | |
'openssltools.php' => 1, | |
'can.php' => 1, | |
'aes.php' => 1, | |
'limp.php' => 1, | |
'shared_host_install' => 1, | |
'recurringsubscription.php' => 1, | |
'paypalrecurring.php' => 1, | |
'workload.php' => 1, | |
'latestblogentries.php' => 1, | |
'headlines.php' => 1, | |
'paginate.standalone.php' => 1, | |
'factr.php' => 1, | |
'mobiledetectbundle.php' => 1, | |
'suncatadminpageboardbundle.php' => 1, | |
'config.ini-dist' => 1, | |
'.htaccess-dist' => 1, | |
'teamleader.php' => 1, | |
'sumoforkclass.php' => 1, | |
'sumocodersframeworkuserbundle.php' => 1, | |
'sumocodersframeworksettingsbundle.php' => 1, | |
'settingsmanager.php' => 1, | |
'sumocodersframeworksearchbundle.php' => 1, | |
'sumocodersframeworkexamplebundle.php' => 1, | |
'sumocodersframeworkerrorbundle.php' => 1, | |
'sumocodersframeworkcorebundle.php' => 1, | |
'.phpbench.dist' => 1, | |
'applicationextra.php' => 1, | |
'suluroutebundle.php' => 1, | |
'suluqrcodebundle.php' => 1, | |
'sululdapbundle.php' => 1, | |
'suludeveloperbundle.php' => 1, | |
'phpffmpegbundle.php' => 1, | |
'gen_keys.php' => 1, | |
'encrypt_cls.php' => 1, | |
'encrypt.php' => 1, | |
'encoding2.php' => 1, | |
'encoding1.php' => 1, | |
'encoded.php' => 1, | |
'worker_script' => 1, | |
'supervisor-suitcoda.conf' => 1, | |
'weatherundergroundbundle.php' => 1, | |
'libravatar-replace.php' => 1, | |
'didyouknow.ss' => 1, | |
'zendaclserviceprovider.php' => 1, | |
'didyouknow.php' => 1, | |
'currencyconverterwidget.ss' => 1, | |
'currencyconverterwidget.php' => 1, | |
'childblogentries.ss' => 1, | |
'childblogentries.php' => 1, | |
'upgradesilverstripe.php' => 1, | |
'replacementdata.php' => 1, | |
'reset.sh' => 1, | |
'index.php.removethispartforwindows' => 1, | |
'_ss_environment.php.example' => 1, | |
'upgradedocs' => 1, | |
'zendsessionserviceprovider.php' => 1, | |
'zendauthenticationserviceprovider.php' => 1, | |
'webprofilercontrollerprovider.php' => 1, | |
'.vendor.png' => 1, | |
'restserviceprovider.php' => 1, | |
'restevents.php' => 1, | |
'restevent.php' => 1, | |
'ormserviceprovider.php' => 1, | |
'managerregistryserviceprovider.php' => 1, | |
'dbalserviceprovider.php' => 1, | |
'crudevents.php' => 1, | |
'crudevent.php' => 1, | |
'pimpleawareinterface.php' => 1, | |
'pimpleawareeventdispatcher.php' => 1, | |
'pimpleaware.php' => 1, | |
'phar-compiler.xsd' => 1, | |
'v.php' => 1, | |
'paginate.php' => 1, | |
'unnoyandexmapsbundle.php' => 1, | |
'block_helper.php' => 1, | |
'clickableinterface.php' => 1, | |
'metadatainterface.php' => 1, | |
'callbackslugifier.php' => 1, | |
'cmfsimplecmsbundle.php' => 1, | |
'suggestionproviderinterface.php' => 1, | |
'sitemapawareinterface.php' => 1, | |
'seoawaretrait.php' => 1, | |
'seoawareinterface.php' => 1, | |
'cmfseobundle.php' => 1, | |
'alternatelocaleproviderinterface.php' => 1, | |
'cmfsearchbundle.php' => 1, | |
'cmfroutingbundle.php' => 1, | |
'cmfroutingautobundle.php' => 1, | |
'quietfactory.php' => 1, | |
'cmfmenubundle.php' => 1, | |
'mediamanagerinterface.php' => 1, | |
'package_template.xml' => 1, | |
'hierarchyinterface.php' => 1, | |
'cmfmediabundle.php' => 1, | |
'binaryinterface.php' => 1, | |
'cmfcorebundle.php' => 1, | |
'cmfcontentbundle.php' => 1, | |
'jack' => 1, | |
'cmfblockbundle.php' => 1, | |
'symfonycmfroutingextrabundle.php' => 1, | |
'urigeneratorinterface.php' => 1, | |
'urigenerator.php' => 1, | |
'uricontextcollectionbuilder.php' => 1, | |
'uricontextcollection.php' => 1, | |
'uricontext.php' => 1, | |
'slugifierinterface.php' => 1, | |
'sl_si.csv' => 1, | |
'routingautoevents.php' => 1, | |
'bufferinglogger.php' => 1, | |
'callbacktransformer.php' => 1, | |
'buttontypeinterface.php' => 1, | |
'buttonbuilder.php' => 1, | |
'abstractrendererengine.php' => 1, | |
'lockhandler.php' => 1, | |
'immutableeventdispatcher.php' => 1, | |
'containerawareeventdispatcher.php' => 1, | |
'abstracturielement.php' => 1, | |
'containerawareeventmanager.php' => 1, | |
'taggedcontainerinterface.php' => 1, | |
'resettablecontainerinterface.php' => 1, | |
'expressionlanguageprovider.php' => 1, | |
'definitiondecorator.php' => 1, | |
'cssselectorconverter.php' => 1, | |
'post' => 1, | |
'consoleevents.php' => 1, | |
'resourcecheckerinterface.php' => 1, | |
'resourcecheckerconfigcachefactory.php' => 1, | |
'resourcecheckerconfigcache.php' => 1, | |
'filelocatorinterface.php' => 1, | |
'configcacheinterface.php' => 1, | |
'configcachefactoryinterface.php' => 1, | |
'configcachefactory.php' => 1, | |
'wincacheclassloader.php' => 1, | |
'doctrineprovider.php' => 1, | |
'urlpackage.php' => 1, | |
'pathpackage.php' => 1, | |
'packages.php' => 1, | |
'packageinterface.php' => 1, | |
'tokenproviderinterface.php' => 1, | |
'defunctroutehandlerinterface.php' => 1, | |
'vellozziurlshortenerbundle.php' => 1, | |
'yellowcube.install' => 1, | |
'syph' => 1, | |
'sycamorepostcodeanywherebundle.php' => 1, | |
'sycamorefreespeebundle.php' => 1, | |
'sycamorecarwebbundle.php' => 1, | |
'dropzoneassets.php' => 1, | |
'ecommerceassets.php' => 1, | |
'wechatshareaddr.php' => 1, | |
'swoopsterobjectmanagerbundle.php' => 1, | |
'gpl-2.0-license' => 1, | |
'yellowcube.rules_defaults.inc' => 1, | |
'yellowcube.rules.inc' => 1, | |
'yellowcube.module' => 1, | |
'yellowcube.jobs.inc' => 1, | |
'yellowcube.info' => 1, | |
'sdstripebundle.php' => 1, | |
'yellowcube.client.inc' => 1, | |
'neo4juserbundle.php' => 1, | |
'swismoonphasebundle.php' => 1, | |
'swisgoogleanalyticsbundle.php' => 1, | |
'swisdatabaseextrabundle.php' => 1, | |
'swisannotationextrabundle.php' => 1, | |
'curlerarray.php' => 1, | |
'license.mb' => 1, | |
'sweikenbredismqbundle.php' => 1, | |
'swarrotbundle.php' => 1, | |
'y.php' => 1, | |
'migrace.php' => 1, | |
'clanky' => 1, | |
'flosytwitterbundle.php' => 1, | |
'symboobootstrapbundle.php' => 1, | |
'conflictresolverinterface.php' => 1, | |
'chainrouterinterface.php' => 1, | |
'autoroutemanager.php' => 1, | |
'versatilegeneratorinterface.php' => 1, | |
'routereferrersreadinterface.php' => 1, | |
'routereferrersinterface.php' => 1, | |
'routeobjectinterface.php' => 1, | |
'redirectrouteinterface.php' => 1, | |
'providerbasedgenerator.php' => 1, | |
'pagedrouteproviderinterface.php' => 1, | |
'pagedroutecollection.php' => 1, | |
'lazyroutecollection.php' => 1, | |
'contentrepositoryinterface.php' => 1, | |
'contentawaregenerator.php' => 1, | |
'chainedrouterinterface.php' => 1, | |
'chainrouter.php' => 1, | |
'symeditblogbundle.php' => 1, | |
'chainroutecollection.php' => 1, | |
'cmfresourcerestbundle.php' => 1, | |
'cmfresourcebundle.php' => 1, | |
'repositoryregistryinterface.php' => 1, | |
'cmfcreatebundle.php' => 1, | |
'cmfblogbundle.php' => 1, | |
'symfoniansadminbundle.php' => 1, | |
'symeditwidgetbundle.php' => 1, | |
'symeditthemebundle.php' => 1, | |
'symeditsitemapbundle.php' => 1, | |
'symeditshortcodebundle.php' => 1, | |
'symeditmenubundle.php' => 1, | |
'symeditmediabundle.php' => 1, | |
'symediteventsbundle.php' => 1, | |
'pingdom.css' => 1, | |
'runbehat' => 1, | |
'smilingplantspagerbundle.php' => 1, | |
'bootstrapfakeasset.php' => 1, | |
'yamilovssypexgeobundle.php' => 1, | |
'yamikocacheadministrationbundle.php' => 1, | |
'yamikobasicpagesbundle.php' => 1, | |
'example2_object.php' => 1, | |
'example1_create.php' => 1, | |
'example0_intro.php' => 1, | |
'samples' => 1, | |
'config.json.example' => 1, | |
'googletagmanagerbundle.php' => 1, | |
'xynnnblacklistedemailvalidatorbundle.php' => 1, | |
'xxtea.php' => 1, | |
'pregfile.php' => 1, | |
'jsxs.php' => 1, | |
'minput.php' => 1, | |
'herosphpv2.0.chm' => 1, | |
'peter.php' => 1, | |
'qqvalidator.php' => 1, | |
'mobilevalidator.php' => 1, | |
'dialog.css' => 1, | |
'customasset.php' => 1, | |
'stflagiconcssbundle.php' => 1, | |
'rbac.sql' => 1, | |
'emoji.php' => 1, | |
'templateserviceprovider.php' => 1, | |
'uncleemptymaintenancebundle.php' => 1, | |
'update-modules.sh' => 1, | |
'tacticianmiddlewarebundle.php' => 1, | |
'aweapp.php' => 1, | |
'constants.enc.yamoney' => 1, | |
'bump_version.sh' => 1, | |
'xthiagoformextrabundle.php' => 1, | |
'lackeyfile.php' => 1, | |
'qtranslate_services.php' => 1, | |
'qtranslate_options.php' => 1, | |
'qtranslate_hooks.php' => 1, | |
'qtranslate_frontend.php' => 1, | |
'qtranslate_core.php' => 1, | |
'qtranslate_compatibility.php' => 1, | |
'qtranslate.php' => 1, | |
'i18n-config.json' => 1, | |
'multilingual-press.php' => 1, | |
'breadcrumbsnode.php' => 1, | |
'breadcrumbsbundle.php' => 1, | |
'breadcrumbsbuilder.php' => 1, | |
'txt.thanks' => 1, | |
'turkish.php' => 1, | |
'enumbundle.php' => 1, | |
'phpunit-local.xml' => 1, | |
'yasiekzrouterbundle.php' => 1, | |
'readme.pl' => 1, | |
'yasiekzformbundle.php' => 1, | |
'yasiekzvideojsbundle.php' => 1, | |
'milight.php' => 1, | |
'jquery.bt.min.js' => 1, | |
'jquery.bt.js' => 1, | |
'jquery.bt.css' => 1, | |
'yanyabosymfonybundle.php' => 1, | |
'edropzone.php' => 1, | |
'dependencyinjection.json' => 1, | |
'yokaiizanamibundle.php' => 1, | |
'izanamievents.php' => 1, | |
'imagemodule.php' => 1, | |
'screen1.jpg' => 1, | |
'qtranslate_widget.php' => 1, | |
'esperantoassetsbundle.php' => 1, | |
'esperantoshopbundle.php' => 1, | |
'esperantosettingbundle.php' => 1, | |
'esperantosearchbundle.php' => 1, | |
'esperantoreferencebundle.php' => 1, | |
'esperantoprojectbundle.php' => 1, | |
'esperantopagebundle.php' => 1, | |
'esperantonewsletterbundle.php' => 1, | |
'esperantonewsbundle.php' => 1, | |
'esperantomediabundle.php' => 1, | |
'esperantodownloadbundle.php' => 1, | |
'esperantocontentbundle.php' => 1, | |
'esperantocategorybundle.php' => 1, | |
'esperantocalendarbundle.php' => 1, | |
'esperantoadminbundle.php' => 1, | |
'esperantotestingbundle.php' => 1, | |
'octoguard.config.dist' => 1, | |
'gpg-mailgate.php' => 1, | |
'grumphp.sh' => 1, | |
'cs-fixer.sh' => 1, | |
'codecept.sh' => 1, | |
'tagbundle.php' => 1, | |
'xphereonetimeaccessbundle.php' => 1, | |
'test.xar' => 1, | |
'boot.pth' => 1, | |
'project.pth' => 1, | |
'integration.ini' => 1, | |
'mysqlcontroller.php' => 1, | |
'xolaelasticsearchproxybundle.php' => 1, | |
'esperantosliderbundle.php' => 1, | |
'esperantouserbundle.php' => 1, | |
'previewasset.php' => 1, | |
'producerchangesv1.patch' => 1, | |
'jquery.fullscreen.js' => 1, | |
'jquery.fullscreen.css' => 1, | |
'xsolveunitskelgenbundle.php' => 1, | |
'xsolvegoogleauthbundle.php' => 1, | |
'xsolvecookieacknowledgementbundle.php' => 1, | |
'wtw.phar' => 1, | |
'wtw-inline.phar' => 1, | |
'box-inline.json' => 1, | |
'shone.phar' => 1, | |
'xpress' => 1, | |
'license_lbp' => 1, | |
'svg-edit-2-6-patch-for-xrowsvg.diff' => 1, | |
'odata.ini' => 1, | |
'config.php.append' => 1, | |
'simplehtmldomnode.php' => 1, | |
'xrowmetadatabundle.php' => 1, | |
'anychart_eula.pdf' => 1, | |
'xrowgisbundle.php' => 1, | |
'xrowsyliusbundle.php' => 1, | |
'xrowrestbundle.php' => 1, | |
'xrowjbpmbundle.php' => 1, | |
'xrowfieldtypesbundle.php' => 1, | |
'xrowezobjectrelationlistplusbundle.php' => 1, | |
'xrowdownloadlibrarybundle.php' => 1, | |
'xrowbootstrapbundle.php' => 1, | |
'xrowgoogletagmanagerbundle.php' => 1, | |
'xrowtwitterimportbundle.php' => 1, | |
'xrowbundleezpublishtoolsbundle.php' => 1, | |
'xrowezpublishsolrdocsbundle.php' => 1, | |
'qtranslate_utils.php' => 1, | |
'content-chat.php' => 1, | |
'xoeorohelperbundle.php' => 1, | |
'eccvalidator.php' => 1, | |
'linkmanybehavior.php' => 1, | |
'transformfilebehavior.php' => 1, | |
'imagefilebehavior.php' => 1, | |
'eagerjointrait.php' => 1, | |
'eagerjoinquerytrait.php' => 1, | |
'templatestoragephp.php' => 1, | |
'templatestoragemongodb.php' => 1, | |
'templatestoragedb.php' => 1, | |
'templatestorageactiverecord.php' => 1, | |
'templatestorage.php' => 1, | |
'templatemodelfinder.php' => 1, | |
'activemessageevent.php' => 1, | |
'activemessage.php' => 1, | |
'timezoneaction.php' => 1, | |
'rolebehavior.php' => 1, | |
'selectize.php' => 1, | |
'pieasset.php' => 1, | |
'pie.php' => 1, | |
'linkpreviewasset.php' => 1, | |
'linkpreview.php' => 1, | |
'ionsliderasset.php' => 1, | |
'ionslider.php' => 1, | |
'imagecomponent.php' => 1, | |
'googlemapsasset.php' => 1, | |
'ftpwrapper.php' => 1, | |
'ftpclient.php' => 1, | |
'datasyncbehavior.php' => 1, | |
'commentasset.php' => 1, | |
'positionbehavior.php' => 1, | |
'variationbehavior.php' => 1, | |
'bxslider.php' => 1, | |
'filemanagerphp.php' => 1, | |
'dbtokenmanager.php' => 1, | |
'emongoquerybuilder.php' => 1, | |
'emongodbref.php' => 1, | |
'hauth.php' => 1, | |
'cepinput.php' => 1, | |
'cepasset.php' => 1, | |
'cepaction.php' => 1, | |
'ceivalidator.php' => 1, | |
'indexfile.php' => 1, | |
'basefile.php' => 1, | |
'localfileplaceholder.php' => 1, | |
'initcontroller.php' => 1, | |
'queryprocessor.php' => 1, | |
'filemanagerjson.php' => 1, | |
'authlogidentitybehavior.php' => 1, | |
'mapping.php' => 1, | |
'containertrait.php' => 1, | |
'storagephp.php' => 1, | |
'storagemongodb.php' => 1, | |
'storagedb.php' => 1, | |
'storageactiverecord.php' => 1, | |
'behaviortrait.php' => 1, | |
'managermongodb.php' => 1, | |
'managerdbtransaction.php' => 1, | |
'managerdb.php' => 1, | |
'managerdataserializetrait.php' => 1, | |
'manageractiverecord.php' => 1, | |
'authlogwebuserbehavior.php' => 1, | |
'authlogloginformbehavior.php' => 1, | |
'bxsliderasset.php' => 1, | |
'purifybehavior.php' => 1, | |
'content-status.php' => 1, | |
'database-repair.php' => 1, | |
'eavbehavior.php' => 1, | |
'yee.php' => 1, | |
'blockmodule.php' => 1, | |
'server.ini' => 1, | |
'wpuf.php' => 1, | |
'wpuf-functions.php' => 1, | |
'wp-pagenavi.php' => 1, | |
'pagenavi-css.css' => 1, | |
'wp-page-numbers.php' => 1, | |
'screenshot-1.gif' => 1, | |
'wp-dbmanager.pot' => 1, | |
'wp-dbmanager.php' => 1, | |
'database-run.php' => 1, | |
'database-optimize.php' => 1, | |
'eavquerytrait.php' => 1, | |
'database-manager.php' => 1, | |
'database-manage.php' => 1, | |
'database-empty.php' => 1, | |
'database-backup.php' => 1, | |
'authkey.sample.php' => 1, | |
'header.blade.php' => 1, | |
'footer.blade.php' => 1, | |
'content.blade.php' => 1, | |
'content-search.php' => 1, | |
'sidebar-content.php' => 1, | |
'featured-content.php' => 1, | |
'content-featured-post.php' => 1, | |
'sidebar-main.php' => 1, | |
'eavmodule.php' => 1, | |
'mediamodule.php' => 1, | |
'selenium-server-standalone-2.45.0.jar' => 1, | |
'ygfacebookbundle.php' => 1, | |
'robo.phar' => 1, | |
'breadcrumbsfilter.php' => 1, | |
'epdffactorydoc.php' => 1, | |
'epdffactory.php' => 1, | |
'multimodelform.php' => 1, | |
'scrolluppager.php' => 1, | |
'fileuploaderwidget.php' => 1, | |
'paymentcomponent.php' => 1, | |
'gatewayabstract.php' => 1, | |
'membershipinterface.php' => 1, | |
'membershipcomponent.php' => 1, | |
'webuploaderaction.php' => 1, | |
'markdown2htmlasset.php' => 1, | |
'idiorm.php.b0922d8719a94e3a0e0e4a0ca3876f4f91475dcf' => 1, | |
'pagemodule.php' => 1, | |
'.yf_version' => 1, | |
'yetheedateformbundle.php' => 1, | |
'biplaneenumbundle.php' => 1, | |
'yitnotificationbundle.php' => 1, | |
'yithelpbundle.php' => 1, | |
'yitgeobridgebundle.php' => 1, | |
'yitpollbundle.php' => 1, | |
'yitmapbundle.php' => 1, | |
'yitadsbundle.php' => 1, | |
'lsnotificationbundle.php' => 1, | |
'avroextrabundle.php' => 1, | |
'tripmodule.php' => 1, | |
'translationmodule.php' => 1, | |
'settingsmodule.php' => 1, | |
'xoeoropicturecutbundle.php' => 1, | |
'xoeorobytehandbundle.php' => 1, | |
'mongodbtokenmanager.php' => 1, | |
'start-8020.sh' => 1, | |
'xabbuhlrsbundle.php' => 1, | |
'xabbuhdiconfigurationbundle.php' => 1, | |
'xaavqueuebundle.php' => 1, | |
'vanityurls.php' => 1, | |
'steamid.php' => 1, | |
'.codeclimate.sh' => 1, | |
'view_serverping.php' => 1, | |
'ocicollections.php' => 1, | |
'stop-8021.sh' => 1, | |
'start-8021.sh' => 1, | |
'stop-8030.sh' => 1, | |
'stop-8020.sh' => 1, | |
'start-8030.sh' => 1, | |
'pssaasbundle.php' => 1, | |
'xabbuhxapiclientbundle.php' => 1, | |
'pspublicwriterbundle.php' => 1, | |
'pspublicreaderbundle.php' => 1, | |
'stop-8010.sh' => 1, | |
'start-8010.sh' => 1, | |
'start-8000.sh' => 1, | |
'cfddns.sample.yml' => 1, | |
'jswidget.php' => 1, | |
'iterable.php' => 1, | |
'functional.php' => 1, | |
'argplaceholder.php' => 1, | |
'xscanner.class.php' => 1, | |
'myscanner.class.php' => 1, | |
'millenniumpaginationbundle.php' => 1, | |
'xabbuhpandabundle.php' => 1, | |
'xabbuhcrapibundle.php' => 1, | |
'view-without-data.png' => 1, | |
'xv-planeta.php' => 1, | |
'employeeattadancemovement.note' => 1, | |
'phorms.php' => 1, | |
'build-pear.sh' => 1, | |
'slug_test.php' => 1, | |
'proctor' => 1, | |
'bandaid.inc' => 1, | |
'bandaid.drush.inc' => 1, | |
'fueluxasset.php' => 1, | |
'combobox.php' => 1, | |
'php_opendkim.h' => 1, | |
'opendkim.c' => 1, | |
'bwork_edit_notes' => 1, | |
'helloword.php' => 1, | |
'types-timber-integration.php' => 1, | |
'xapiclient.php' => 1, | |
'foggitexpertbundle.php' => 1, | |
'entitymodalbundle.php' => 1, | |
'.gitignore.dist' => 1, | |
'exampleenvironment.php' => 1, | |
'tracyshortcuts.php' => 1, | |
'verbfixtures.php' => 1, | |
'statementresultfixtures.php' => 1, | |
'statementfixtures.php' => 1, | |
'documentfixtures.php' => 1, | |
'actorfixtures.php' => 1, | |
'activityfixtures.php' => 1, | |
'xapiclientinterface.php' => 1, | |
'xapiclientbuilderinterface.php' => 1, | |
'xapiclientbuilder.php' => 1, | |
'tree-resources.png' => 1, | |
'view-with-data.png' => 1, | |
'xpressdataloader.php' => 1, | |
'wplib.php' => 1, | |
'admin-content-labels.php' => 1, | |
'wp_pointer.php' => 1, | |
'options-template.php' => 1, | |
'options-framework.php' => 1, | |
'wp_options.php' => 1, | |
'wp_notify.php' => 1, | |
'wp_mvc.php' => 1, | |
'wp_debugbar.php' => 1, | |
'wp_autoupdate.php' => 1, | |
'wizadsettingsbundle.php' => 1, | |
'wizaddoctrinedocbundle.php' => 1, | |
'wizadcrudbundle.php' => 1, | |
'wizadapiblueprintbundle.php' => 1, | |
'defines.php' => 1, | |
'wps_extend_plugin.php' => 1, | |
'update-version.sh' => 1, | |
'json-loader.php' => 1, | |
'fieldsetinterface.php' => 1, | |
'metabox.php' => 1, | |
'boots.php' => 1, | |
'boots.json' => 1, | |
'xu.php' => 1, | |
'wp-sync-db.php' => 1, | |
'wp-sync-db-media-files.php' => 1, | |
'wp-sync-db-cli.php' => 1, | |
'slab' => 1, | |
'class-imagify.php' => 1, | |
'wp-lorem-ipsum.php' => 1, | |
'carelib.php' => 1, | |
'wps-extend-plugin.php' => 1, | |
'panel-transaction-history.png' => 1, | |
'remotedumpbundle.php' => 1, | |
'wysowarchivemytweetsbundle.php' => 1, | |
'parameters.yml.sample' => 1, | |
'bot.png' => 1, | |
'custom_autoload.php' => 1, | |
'zermelo.php' => 1, | |
'video.class.php' => 1, | |
'embed.class.php' => 1, | |
'commandr' => 1, | |
'flyercore' => 1, | |
'routefacade.php' => 1, | |
'facadeserviceprovider.php' => 1, | |
'exceptionizer.php' => 1, | |
'systeminfoexception.php' => 1, | |
'wurstpresscorebundle.php' => 1, | |
'aimb.php' => 1, | |
'wucdbmwucdbmbundle.php' => 1, | |
'wucdbmmenubuilderbundle.php' => 1, | |
'wucdbmlocalebundle.php' => 1, | |
'wucdbmgallerybundle.php' => 1, | |
'wucdbmepaybundle.php' => 1, | |
'wucdbmbannerbundle.php' => 1, | |
'socks.conf.template' => 1, | |
'wssysdtogeneratorbundle.php' => 1, | |
'tabularinput_test.php' => 1, | |
'tabularasset.php' => 1, | |
'inputcolumn.php' => 1, | |
'bfootableasset.php' => 1, | |
'wreptcpdfbundle.php' => 1, | |
'fosuserbundlemandrillmailerbundle.php' => 1, | |
'twigfactory.php' => 1, | |
'xpressgithubmetadataplugin.php' => 1, | |
'bytehandapi.php' => 1, | |
'hashasset.php' => 1, | |
'mosaicasset.php' => 1, | |
'mosaic.php' => 1, | |
'lightbox2asset.php' => 1, | |
'imagehelper.php' => 1, | |
'juxtaposeasset.php' => 1, | |
'zoomasset.php' => 1, | |
'wscratchpadasset.php' => 1, | |
'themefullasset.php' => 1, | |
'structureasset.php' => 1, | |
'scriptasset.php' => 1, | |
'iconsvgasset.php' => 1, | |
'iconpngextasset.php' => 1, | |
'iconpngasset.php' => 1, | |
'eraserasset.php' => 1, | |
'lightboxasset.php' => 1, | |
'jplayerwidget.php' => 1, | |
'commonassets.php' => 1, | |
'circleaudiowidget.php' => 1, | |
'audiowidget.php' => 1, | |
'imgareaselectasset.php' => 1, | |
'imgareaselect.php' => 1, | |
'holderassets.php' => 1, | |
'galleriaassets.php' => 1, | |
'galleria.php' => 1, | |
'orbit.php' => 1, | |
'foundationfullasset.php' => 1, | |
'easingasset.php' => 1, | |
'duckyasset.php' => 1, | |
'defaultthemeasset.php' => 1, | |
'qqexmailauth.php' => 1, | |
'd3asset.php' => 1, | |
'actionsheet.php' => 1, | |
'form.html' => 1, | |
'formerlyplugin.php' => 1, | |
'artvandelayplugin.php' => 1, | |
'xmonsonatamediaprovidervideobundle.php' => 1, | |
'xmoncolorpickertypebundle.php' => 1, | |
'easylogger.php' => 1, | |
'zeptoasset.php' => 1, | |
'xs.php' => 1, | |
'weuijsasset.php' => 1, | |
'weuiasset.php' => 1, | |
'msgpage.php' => 1, | |
'griditem.php' => 1, | |
'actionsheetcell.php' => 1, | |
'timesheetasset.php' => 1, | |
'readme.qqexmail' => 1, | |
'timesheet.php' => 1, | |
'thumbrule.php' => 1, | |
'thumbhelper.php' => 1, | |
'tagitasset.php' => 1, | |
'tagit.php' => 1, | |
'supersizedslideshowasset.php' => 1, | |
'supersizedcoreasset.php' => 1, | |
'supersized.php' => 1, | |
'ratchetiosasset.php' => 1, | |
'ratchetasset.php' => 1, | |
'ratchetandroidasset.php' => 1, | |
'pnotifyhelperassets.php' => 1, | |
'pnotifyassets.php' => 1, | |
'weixinmpauth.php' => 1, | |
'duckieasset.php' => 1, | |
'animoasset.php' => 1, | |
'xpressmoretag.php' => 1, | |
'xgclocalebundle.php' => 1, | |
'c.html' => 1, | |
'a.html' => 1, | |
'rql' => 1, | |
'xierrorbundle.php' => 1, | |
'xitagbundle.php' => 1, | |
'xismsbundle.php' => 1, | |
'xiselectorbundle.php' => 1, | |
'xisearchbundle.php' => 1, | |
'xifilelibbundle.php' => 1, | |
'xifilebrowserbundle.php' => 1, | |
'xidialogbundle.php' => 1, | |
'xibreadcrumbsbundle.php' => 1, | |
'xiarticlebundle.php' => 1, | |
'yuntongxunsmser.php' => 1, | |
'ossmanager.php' => 1, | |
'yunpiansmser.php' => 1, | |
'webchinesesmser.php' => 1, | |
'sxtsmser.php' => 1, | |
'cloudsmser.php' => 1, | |
'bootstraplanguagesasset.php' => 1, | |
'met.php' => 1, | |
'allpositions.php' => 1, | |
'site.php' => 1, | |
'restapi' => 1, | |
'minifyhtml.php' => 1, | |
'elasticsearchrequest.php' => 1, | |
'elasticsearchraw.php' => 1, | |
'smscenter.php' => 1, | |
'read' => 1, | |
'ossupload.php' => 1, | |
'snoopy.php' => 1, | |
'jqueryxasset.php' => 1, | |
'.env.sample.php' => 1, | |
'alauda' => 1, | |
'default.vcl' => 1, | |
'modulegenerateprovider.php' => 1, | |
'php_filter.php' => 1, | |
'ximaicalbundle.php' => 1, | |
'ezrbachook.php' => 1, | |
'xiideaeasymenuaclbundle.php' => 1, | |
'xiideaeasyformbundle.php' => 1, | |
'xiideaeasyauditbundle.php' => 1, | |
'wwwasset.php' => 1, | |
'toptipsasset.php' => 1, | |
'toptips.php' => 1, | |
'jquery2asset.php' => 1, | |
'uploadoss.php' => 1, | |
'fullscreenbackgroundasset.php' => 1, | |
'fullscreenbackground.php' => 1, | |
'backtopasset.php' => 1, | |
'backtop.php' => 1, | |
'statuses.php' => 1, | |
'companies.php' => 1, | |
'timer' => 1, | |
'memory' => 1, | |
'debugger' => 1, | |
'weibolist.php' => 1, | |
'weibo_login.png' => 1, | |
'saetv2.ex.class.php' => 1, | |
'testpackage.php' => 1, | |
'ip2region.php' => 1, | |
'mongodbphp7tokenmanager.php' => 1, | |
'mysqltokenmanager.php' => 1, | |
'vpconfig.defaults.neon' => 1, | |
'contactactionop.php' => 1, | |
'documentactionop.php' => 1, | |
'distributionlistsubscribeop.php' => 1, | |
'distributionlistgranteeby.php' => 1, | |
'distributionlistby.php' => 1, | |
'distributionlistactionop.php' => 1, | |
'directorysearchtype.php' => 1, | |
'deployzimletaction.php' => 1, | |
'dedupaction.php' => 1, | |
'datasourcetype.php' => 1, | |
'datasourceby.php' => 1, | |
'countobjectstype.php' => 1, | |
'cosby.php' => 1, | |
'convactionop.php' => 1, | |
'compactindexaction.php' => 1, | |
'documentpermission.php' => 1, | |
'certtype.php' => 1, | |
'calendarresourceby.php' => 1, | |
'cachetype.php' => 1, | |
'cacheentryby.php' => 1, | |
'csrtype.php' => 1, | |
'csrkeysize.php' => 1, | |
'browseby.php' => 1, | |
'autoprovtaskaction.php' => 1, | |
'autoprovprincipalby.php' => 1, | |
'authscheme.php' => 1, | |
'attrmethod.php' => 1, | |
'alwaysonclusterby.php' => 1, | |
'alarmaction.php' => 1, | |
'documentgranttype.php' => 1, | |
'domainby.php' => 1, | |
'acltype.php' => 1, | |
'iptype.php' => 1, | |
'rangetype.php' => 1, | |
'quotasortby.php' => 1, | |
'queueactionby.php' => 1, | |
'queueaction.php' => 1, | |
'participationstatus.php' => 1, | |
'nameidby.php' => 1, | |
'msgactionop.php' => 1, | |
'membertype.php' => 1, | |
'memberofselector.php' => 1, | |
'mdsconnectiontype.php' => 1, | |
'logginglevel.php' => 1, | |
'lockoutoperation.php' => 1, | |
'itemactionop.php' => 1, | |
'invitestatus.php' => 1, | |
'entrytype.php' => 1, | |
'inviteclass.php' => 1, | |
'invitechange.php' => 1, | |
'interesttype.php' => 1, | |
'importance.php' => 1, | |
'granteetype.php' => 1, | |
'granteeby.php' => 1, | |
'getsessionssortby.php' => 1, | |
'galsearchtype.php' => 1, | |
'galmode.php' => 1, | |
'galconfigaction.php' => 1, | |
'frequency.php' => 1, | |
'freebusystatus.php' => 1, | |
'folderactionop.php' => 1, | |
'filtercondition.php' => 1, | |
'addresstype.php' => 1, | |
'acerighttype.php' => 1, | |
'reindexaction.php' => 1, | |
'zfrmailchimpbundle.php' => 1, | |
'ypsms.php' => 1, | |
'wxtsms.php' => 1, | |
'lsmsms.php' => 1, | |
'main.js' => 1, | |
'udpnotifierbundle.php' => 1, | |
'smaz.php' => 1, | |
'make_phpdoc.sh' => 1, | |
'phpflickr.php' => 1, | |
'development.local.php.dist' => 1, | |
'developmentmodecontrollerfactory.php' => 1, | |
'dockerfile-dev' => 1, | |
'default-configuration.php' => 1, | |
'.scrutinizr.yml' => 1, | |
'zettamenubundle.php' => 1, | |
'compose-laravel.sh' => 1, | |
'review_1.0_cs' => 1, | |
'review_1.0' => 1, | |
'review-1.7-alpha1' => 1, | |
'review-1.7' => 1, | |
'review-1.3.4' => 1, | |
'review-1.6' => 1, | |
'review-1.3-test-failures' => 1, | |
'zesk.inc' => 1, | |
'zesk.application.inc' => 1, | |
'_zesk_loader_.inc' => 1, | |
'steamimportuserstates.sh' => 1, | |
'steamimportuserstates.bat' => 1, | |
'zeroemdeferredrequestbundle.php' => 1, | |
'ytxsms.php' => 1, | |
'yii2debug.php' => 1, | |
'accountby.php' => 1, | |
'zikulajqueryminicolorsbundle.php' => 1, | |
'typedsequence.php' => 1, | |
'typedmap.php' => 1, | |
'simplexml.php' => 1, | |
'admininterface.php' => 1, | |
'adminfactory.php' => 1, | |
'accountinterface.php' => 1, | |
'accountfactory.php' => 1, | |
'zimcertauthbundle.php' => 1, | |
'certificatestorageitem.php' => 1, | |
'certificateitem.php' => 1, | |
'certificategenerator.php' => 1, | |
'certificateexpressionvalidator.php' => 1, | |
'certificateawareuserinterface.php' => 1, | |
'wizard.png' => 1, | |
'yii2debuglogroute.php' => 1, | |
'wizardcompleteinterface.php' => 1, | |
'injectcontainerinterface.php' => 1, | |
'formhandlerinterface.php' => 1, | |
'abortstageexception.php' => 1, | |
'zikulageneratorbundle.php' => 1, | |
'sftp.php' => 1, | |
'local.php' => 1, | |
'_vimrc' => 1, | |
'_viminfo' => 1, | |
'generate-phpstorm-helper.php' => 1, | |
'phpspec-hhvm.yml.dist' => 1, | |
'yii2debugviewrenderer.php' => 1, | |
'yii2debugpanel.php' => 1, | |
'yii2debugmodule.php' => 1, | |
'rankingactionop.php' => 1, | |
'reindextype.php' => 1, | |
'deferevents.php' => 1, | |
'uniprop.php' => 1, | |
'useragent.class.php' => 1, | |
'test-my-useragent.php' => 1, | |
'zacsturgessherokuizemebundle.php' => 1, | |
'zrashwaniarachnidsitemapbundle.php' => 1, | |
'dfd.php' => 1, | |
'gfdsgsdfgdfs.php' => 1, | |
'mylog.php' => 1, | |
'mylog' => 1, | |
'mypol.te' => 1, | |
'mypol.pp' => 1, | |
'deficient' => 1, | |
'datagrid' => 1, | |
'dataform' => 1, | |
'fetcher.php' => 1, | |
'zunienumbundle.php' => 1, | |
'defaultservices.php' => 1, | |
'commandservices.php' => 1, | |
'texput.log' => 1, | |
'mentemformextbundle.php' => 1, | |
'mentemdatagridbundle.php' => 1, | |
'sourceinterface.php' => 1, | |
'rowinterface.php' => 1, | |
'resolvedtypeinterface.php' => 1, | |
'resolvedtype.php' => 1, | |
'gridregistryinterface.php' => 1, | |
'gridregistry.php' => 1, | |
'gridinterface.php' => 1, | |
'gridfactoryinterface.php' => 1, | |
'zunidatatablebundle.php' => 1, | |
'zunilogbundle.php' => 1, | |
'gridevents.php' => 1, | |
'builder-show.php' => 1, | |
'dasherizephp.sublime-project' => 1, | |
'visitor-test.php' => 1, | |
'template-test.php' => 1, | |
'strategy-test.php' => 1, | |
'single-test.php' => 1, | |
'proxy-test.php' => 1, | |
'observer-test.php' => 1, | |
'mediator-test.php' => 1, | |
'interpreter-show.php' => 1, | |
'factory-show.php' => 1, | |
'facade-show.php' => 1, | |
'delegate-show.php' => 1, | |
'decorator-show.php' => 1, | |
'adapter-show.php' => 1, | |
'zunimenubundle.php' => 1, | |
'lsyncd.conf.lua.template' => 1, | |
'twigpath.php' => 1, | |
'requestevent.php' => 1, | |
'discovery-shell.php' => 1, | |
'dummyfilemanager.php' => 1, | |
'imageattachmentasset.php' => 1, | |
'elfinderinput.php' => 1, | |
'imagefileinput.php' => 1, | |
'watch.rb' => 1, | |
'gen' => 1, | |
'gcaljson.php' => 1, | |
'nfephp.css' => 1, | |
'grava_config.php' => 1, | |
'zunimenuevents.php' => 1, | |
'gridfactory.php' => 1, | |
'gridevent.php' => 1, | |
'replytype.php' => 1, | |
'voicemsgactionop.php' => 1, | |
'attributeselector.php' => 1, | |
'attributename.php' => 1, | |
'accountselector.php' => 1, | |
'accountnameselector.php' => 1, | |
'headercontext.php' => 1, | |
'mailinterface.php' => 1, | |
'mailfactory.php' => 1, | |
'zimletstatus.php' => 1, | |
'zimletexcludetype.php' => 1, | |
'xmppcomponentby.php' => 1, | |
'weekday.php' => 1, | |
'volumetype.php' => 1, | |
'voicesortby.php' => 1, | |
'versioncheckaction.php' => 1, | |
'attrsimpltrait.php' => 1, | |
'verbtype.php' => 1, | |
'ucserviceby.php' => 1, | |
'transparency.php' => 1, | |
'targettype.php' => 1, | |
'targetby.php' => 1, | |
'tagactionop.php' => 1, | |
'sortby.php' => 1, | |
'sessiontype.php' => 1, | |
'serverby.php' => 1, | |
'sectiontype.php' => 1, | |
'searchtype.php' => 1, | |
'rightclass.php' => 1, | |
'requestformat.php' => 1, | |
'attributeselectortrait.php' => 1, | |
'cursorinfo.php' => 1, | |
'gridbuilderinterface.php' => 1, | |
'voiceinterface.php' => 1, | |
'gridbuilder.php' => 1, | |
'columninterface.php' => 1, | |
'mentemconfigbundle.php' => 1, | |
'mentembootstrapbundle.php' => 1, | |
'mentemadminbundle.php' => 1, | |
'zk2usefulbundle.php' => 1, | |
'zk2adminpanelbundle.php' => 1, | |
'zk2spsbundle.php' => 1, | |
'generaldigitalpleskbundle.php' => 1, | |
'vi.php' => 1, | |
'ziron-api.php' => 1, | |
'testform.xml' => 1, | |
'floppybundle.php' => 1, | |
'voicefactory.php' => 1, | |
'entrysearchfilterinfo.php' => 1, | |
'attactment.php' => 1, | |
'waitsetspec.php' => 1, | |
'waitsetid.php' => 1, | |
'waitsetaddspec.php' => 1, | |
'tzonsetinfo.php' => 1, | |
'structinterface.php' => 1, | |
'searchfiltercondition.php' => 1, | |
'opvalue.php' => 1, | |
'namedvalue.php' => 1, | |
'namedelement.php' => 1, | |
'keyvaluepair.php' => 1, | |
'granteechooser.php' => 1, | |
'entrysearchfiltersinglecond.php' => 1, | |
'entrysearchfiltermulticond.php' => 1, | |
'deferredrequestinterface.php' => 1, | |
'zeroemapisecuritybundle.php' => 1, | |
'flashbasehelper.php' => 1, | |
'warehouse.class.php' => 1, | |
'jullocationbundle.php' => 1, | |
'新建文本文档' => 1, | |
'rizewaycasbundle.php' => 1, | |
'anchour.php' => 1, | |
'.anchour' => 1, | |
'rizewayjobbundle.php' => 1, | |
'ameblo.php' => 1, | |
'shorton.php' => 1, | |
'spressdataloader.php' => 1, | |
'spressmoretag.php' => 1, | |
'rpsguestbookbundle.php' => 1, | |
'rpscorebundle.php' => 1, | |
'yosmanygadomainparserbundle.php' => 1, | |
'v3warehousetest.php' => 1, | |
'currentsession.php' => 1, | |
'v3warehousemytest.php' => 1, | |
'v3warehouse.class.php' => 1, | |
'v3sdktest.php' => 1, | |
'v3sdk.class.php' => 1, | |
'v3application.class.php' => 1, | |
'mongo.script' => 1, | |
'binbase.sql' => 1, | |
'phpbintestmy.php' => 1, | |
'phpbintestmon.php' => 1, | |
'phpbintest.php' => 1, | |
'phpbin.class.php' => 1, | |
'bin.class.php' => 1, | |
'mysocial.class.php' => 1, | |
'apiconnector.php' => 1, | |
'deletebysaving.php' => 1, | |
'mydbtest.php' => 1, | |
'recurringtemplate.php' => 1, | |
'tpnregionalroutingbundle.php' => 1, | |
'specs' => 1, | |
'httpserver.php' => 1, | |
'cgistream.php' => 1, | |
'xmlmapper.php' => 1, | |
'unabletosettleexception.php' => 1, | |
'taxrate.php' => 1, | |
'syncobject.php' => 1, | |
'syncarray.php' => 1, | |
'storable.php' => 1, | |
'simplexmlelement.php' => 1, | |
'servererrorexception.php' => 1, | |
'sendable.php' => 1, | |
'payable.php' => 1, | |
'dirtyaware.php' => 1, | |
'notvalidexception.php' => 1, | |
'notloggedinexception.php' => 1, | |
'logtransportdecorator.php' => 1, | |
'jsonmapper.php' => 1, | |
'invoiceprofile.php' => 1, | |
'invalidstateexception.php' => 1, | |
'invalidservicetypeexception.php' => 1, | |
'invalidsequencetypeexception.php' => 1, | |
'invalidrequestexception.php' => 1, | |
'invalididexception.php' => 1, | |
'invalidfilterexception.php' => 1, | |
'incominginvoice.php' => 1, | |
'estimate.php' => 1, | |
'disclosure.php' => 1, | |
'mylogin.class.php' => 1, | |
'mydb.class.php' => 1, | |
'yvinviteevents.php' => 1, | |
'mysql.scheme.sql' => 1, | |
'yjvreportrenderingbundle.php' => 1, | |
'html_screenshot.png' => 1, | |
'reportrendering.php' => 1, | |
'filterconstants.php' => 1, | |
'builderinterfaces.php' => 1, | |
'targetmodeltrait.php' => 1, | |
'targetmodel.php' => 1, | |
'viewrendererstaticclassproxy.php' => 1, | |
'optimizer.php' => 1, | |
'yiicaster.php' => 1, | |
'batchqueryresult.php' => 1, | |
'togglebuttongroup.php' => 1, | |
'bootstrapwidgettrait.php' => 1, | |
'mediafile.php' => 1, | |
'abstractnamedbuilder.php' => 1, | |
'etwigviewrenderer.php' => 1, | |
'estatusbehavior.php' => 1, | |
'edbmigration.php' => 1, | |
'efileuploadaction.php' => 1, | |
'basechart.php' => 1, | |
'eactiverecordrelationbehaviortest.php' => 1, | |
'eactiverecordrelationbehavior.php' => 1, | |
'meritbehavior.php' => 1, | |
'forum.sql' => 1, | |
'readme-zh' => 1, | |
'uploadfilebehavior.php' => 1, | |
'jwplayerasset.php' => 1, | |
'jwplayer.php' => 1, | |
'abstractbuilder.php' => 1, | |
'buildernotreturnedexception.php' => 1, | |
'driverdb.class.php' => 1, | |
'typeregistry.php' => 1, | |
'test_xml.php' => 1, | |
'test_timbra.php' => 1, | |
'test_cancela.php' => 1, | |
'foxreferencedataloaderbundle.php' => 1, | |
'yjvvalidatorconstraintgroupbundle.php' => 1, | |
'yamlgrouploader.php' => 1, | |
'grouploaderinterface.php' => 1, | |
'groupfactoryinterface.php' => 1, | |
'groupfactory.php' => 1, | |
'groupcreationfailedexception.php' => 1, | |
'constraintgroup.php' => 1, | |
'typeresolverinterface.php' => 1, | |
'typeregistryinterface.php' => 1, | |
'typenotsupportedexception.php' => 1, | |
'buildernotsupportedexception.php' => 1, | |
'typenotfoundexception.php' => 1, | |
'typefactoryinterface.php' => 1, | |
'typefactorybuilderinterface.php' => 1, | |
'typefactorybuilder.php' => 1, | |
'typefactory.php' => 1, | |
'typeextensionsnotfoundexception.php' => 1, | |
'typechaininterface.php' => 1, | |
'typechain.php' => 1, | |
'registryextensioninterface.php' => 1, | |
'optionsresolvernotreturnedexception.php' => 1, | |
'namedtypefactoryinterface.php' => 1, | |
'namedtypefactory.php' => 1, | |
'namedbuilderinterface.php' => 1, | |
'finalizingtypeinterface.php' => 1, | |
'yvinvitebundle.php' => 1, | |
'yvmulticurrencybundle.php' => 1, | |
'zeroemjsonbundle.php' => 1, | |
'authmobile.php' => 1, | |
'testconfiguration.php.travis' => 1, | |
'testconfiguration.php.dist' => 1, | |
'phpmetrics.html' => 1, | |
'zend-blueprint.json' => 1, | |
'installing-nagios-debian6' => 1, | |
'foundationpluginasset.php' => 1, | |
'pryongoogletranslatorbundle.php' => 1, | |
'zeliard91dynamodbconnectorbundle.php' => 1, | |
'summernotepluginasset.php' => 1, | |
'rssview.php' => 1, | |
'slugifier.php' => 1, | |
'zelenincqrsbundle.php' => 1, | |
'authsites.php' => 1, | |
'authdirect.php' => 1, | |
'.zf-mkdoc-theme-preserve' => 1, | |
'constantcontact.php' => 1, | |
'gitphploy.ini.sample' => 1, | |
'config.ini.sample.php' => 1, | |
'zebbavalidatorbundle.php' => 1, | |
'parameterconverter.php' => 1, | |
'classutility.php' => 1, | |
'zebbasecuritybundle.php' => 1, | |
'config_dist.php' => 1, | |
'entitymodel.php' => 1, | |
'paging.php' => 1, | |
'kcppay.php' => 1, | |
'bestsms.php' => 1, | |
'.htdeployment' => 1, | |
'zf2.bat' => 1, | |
'bookdown.json' => 1, | |
'zapoyoktimelinejsbundle.php' => 1, | |
'kladrbundle.php' => 1, | |
'zeroemdeferredrequestpersisterbundle.php' => 1, | |
'millwrightsemaphorebundle.php' => 1, | |
'codesniffer.sample.conf' => 1, | |
'phputil.php' => 1, | |
'numbertostring.php' => 1, | |
'dateutil.php' => 1, | |
'update-vendors.sh' => 1, | |
'millwrighttwitterbootstrapbundle.php' => 1, | |
'millwrightradbundle.php' => 1, | |
'millwrightmenubundle.php' => 1, | |
'millwrightfilterbundle.php' => 1, | |
'millwrightboilerplatebundle.php' => 1, | |
'millwrightconfigurationbundle.php' => 1, | |
'vbv_learn_more.html' => 1, | |
'my first framework based on composer' => 1, | |
'robots_example' => 1, | |
'page_not_found.php' => 1, | |
'nddbc.html' => 1, | |
'mcs_learn_more.html' => 1, | |
'ipn_main_handler.php' => 1, | |
'init_includes.php' => 1, | |
'ricjloader.php' => 1, | |
'loaderhelper.php' => 1, | |
'cssjsfinder.php' => 1, | |
'outputcache.php' => 1, | |
'datacache.php' => 1, | |
'cachecore.php' => 1, | |
'turbo' => 1, | |
'igabuilderbundle.php' => 1, | |
'zapoyokuserpreferencesbundle.php' => 1, | |
'zapoyokholidaybundle.php' => 1, | |
'yvmulticurrencyevents.php' => 1, | |
'yuccadatabundle.php' => 1, | |
'install-chardet.sh' => 1, | |
'simpleldapbundle.php' => 1, | |
'openvpnmanagementbundle.php' => 1, | |
'ketch' => 1, | |
'svnlog' => 1, | |
'ci.bat' => 1, | |
'adminyii.sublime-workspace' => 1, | |
'adminyii.sublime-project' => 1, | |
'weibo.php' => 1, | |
'qq.php' => 1, | |
'smd.js' => 1, | |
'smd.css' => 1, | |
'yuccafosuseradapterbundle.php' => 1, | |
'setup.bat' => 1, | |
'abstractworkflowexecution.php' => 1, | |
'gardening' => 1, | |
'readme.api' => 1, | |
'dns_record.json' => 1, | |
'apcpanelbundle.php' => 1, | |
'ystoolserlangportbundle.php' => 1, | |
'ystoolsbackurlbundle.php' => 1, | |
'servicesjsonerror.php' => 1, | |
'servicesjson.php' => 1, | |
'rklocalebundle.php' => 1, | |
'betacieovhbundle.php' => 1, | |
'yoyelocalizationbundle.php' => 1, | |
'yvtransactionalemailevents.php' => 1, | |
'yvtransactionalemailbundle.php' => 1, | |
'abstractworkflowdefinition.php' => 1, | |
'abstractworkflowexecutionfactory.php' => 1, | |
'zanstandarduibundle.php' => 1, | |
'pico_oembed.php' => 1, | |
'zanhttpapibundle.php' => 1, | |
'zancorebundle.php' => 1, | |
'zancommandbundle.php' => 1, | |
'tha-theme-hooks.php' => 1, | |
'tha-example-index.php' => 1, | |
'zakharovvihumanstxtbundle.php' => 1, | |
'zz-number.iml' => 1, | |
'zaederlink4mailingbundle.php' => 1, | |
'holmes.php' => 1, | |
'wordnetphp-console' => 1, | |
'pronounce-php' => 1, | |
'petrol' => 1, | |
'pico_scheduled_post.php' => 1, | |
'doctrine.dbal.hooks.php' => 1, | |
'awx' => 1, | |
'ide_helper_mongo.php' => 1, | |
'hydra.phar' => 1, | |
'compile.bat' => 1, | |
'ddns-updater.yml.dist' => 1, | |
'regexes.yml' => 1, | |
'yzsupervisorbundle.php' => 1, | |
'good1' => 1, | |
'good' => 1, | |
'filesrc.php' => 1, | |
'classsrc.php' => 1, | |
'classmapandfile.php' => 1, | |
'release_note' => 1, | |
'jbuild.dist.ini' => 1, | |
'venom.php' => 1, | |
'vpconfig.neon' => 1, | |
'versionpress.php' => 1, | |
'runpostdeploy' => 1, | |
'abstractmultiactioncontroller.php' => 1, | |
'dispatcherawareinterface.php' => 1, | |
'serverhelper.php' => 1, | |
'htmlelements.php' => 1, | |
'htmlelement.php' => 1, | |
'domelements.php' => 1, | |
'domelement.php' => 1, | |
'relationdatamapper.php' => 1, | |
'abstractdatamapper.php' => 1, | |
'databasehelper.php' => 1, | |
'databasefactory.php' => 1, | |
'datasetinterface.php' => 1, | |
'datainterface.php' => 1, | |
'crypthelper.php' => 1, | |
'abstractconsole.php' => 1, | |
'eventtriggerableinterface.php' => 1, | |
'nincompare.php' => 1, | |
'neqcompare.php' => 1, | |
'ltecompare.php' => 1, | |
'ltcompare.php' => 1, | |
'incompare.php' => 1, | |
'gtecompare.php' => 1, | |
'gtcompare.php' => 1, | |
'eqcompare.php' => 1, | |
'comparehelper.php' => 1, | |
'credential.php' => 1, | |
'abstractwebapplication.php' => 1, | |
'abstractdaemonapplication.php' => 1, | |
'abstractcliapplication.php' => 1, | |
'dispatcherawaretrait.php' => 1, | |
'listenermapper.php' => 1, | |
'developmentbundle.php' => 1, | |
'abstractmiddleware.php' => 1, | |
'registryhelper.php' => 1, | |
'nestedrecord.php' => 1, | |
'queryexpression.php' => 1, | |
'queryelement.php' => 1, | |
'connectioncontainer.php' => 1, | |
'abstractquerybuilder.php' => 1, | |
'profilerinterface.php' => 1, | |
'profilerawareinterface.php' => 1, | |
'nullprofiler.php' => 1, | |
'databasemodelinterface.php' => 1, | |
'abstractmodel.php' => 1, | |
'endmiddleware.php' => 1, | |
'callbackmiddleware.php' => 1, | |
'languagenormalize.php' => 1, | |
'listenerpriority.php' => 1, | |
'windwalker.xml' => 1, | |
'jsoninput.php' => 1, | |
'formdatainput.php' => 1, | |
'filesinput.php' => 1, | |
'abstractrequest.php' => 1, | |
'validatorhelper.php' => 1, | |
'formhelper.php' => 1, | |
'fieldhelper.php' => 1, | |
'fielddefinitioninterface.php' => 1, | |
'abstractformelementhelper.php' => 1, | |
'outputfilter.php' => 1, | |
'inputfilter.php' => 1, | |
'htmlcleaner.php' => 1, | |
'listenersqueue.php' => 1, | |
'abstractapplication.php' => 1, | |
'mycomposer.php' => 1, | |
'abstractenginerenderer.php' => 1, | |
'tpl_package' => 1, | |
'varspoolwebsocketbundle.php' => 1, | |
'epub-titlepage.html' => 1, | |
'epub-page.html' => 1, | |
'epub-coverimage.html' => 1, | |
'default.textile' => 1, | |
'default.rtf' => 1, | |
'default.opendocument' => 1, | |
'default.mediawiki' => 1, | |
'default.latex' => 1, | |
'default.html5' => 1, | |
'default.html' => 1, | |
'default.docbook' => 1, | |
'vanilla_logo.png' => 1, | |
'sample_package.php' => 1, | |
'freq.php' => 1, | |
'class.exportmodel.php' => 1, | |
'class.exportcontroller.php' => 1, | |
'valitonshariffbundle.php' => 1, | |
'shariffconfig.php' => 1, | |
'valitonpaymentsaferpaybundle.php' => 1, | |
'valitonmultisitebundle.php' => 1, | |
'currentsite.php' => 1, | |
'valitonpaymentdatatransbundle.php' => 1, | |
'kwtyahoobossbundle.php' => 1, | |
'ot-loader.php' => 1, | |
'macaddressvalidator.php' => 1, | |
'class-phoenix-framework-form-field-type-base.php' => 1, | |
'class-phoenix-framework-form-builder.php' => 1, | |
'diacritic.php' => 1, | |
'parts.php' => 1, | |
'arg.php' => 1, | |
'model.hooks.php' => 1, | |
'doxport' => 1, | |
'bootstrap-tests.php' => 1, | |
'vf_license' => 1, | |
'application.config.local.php.dist' => 1, | |
'netsuite toolkit license agreement.docx' => 1, | |
'vegas.json' => 1, | |
'voting.i18n.php' => 1, | |
'voting.hooks.php' => 1, | |
'voting.class.php' => 1, | |
'activerecordsetup.php' => 1, | |
'activerecordormspecial.php' => 1, | |
'activerecordmediawiki.php' => 1, | |
'model.i18n.php' => 1, | |
'ororedisconfigbundle.php' => 1, | |
'phonetics.php' => 1, | |
'bots.json' => 1, | |
'cheburtwigphpfunctionsbundle.php' => 1, | |
'chebursphinxbundle.php' => 1, | |
'joubjoubnotificationbundle.php' => 1, | |
'multipleappkernelbundle.php' => 1, | |
'w3docslogviewerbundle.php' => 1, | |
'amgangularjsbundle.php' => 1, | |
'curlemu.php' => 1, | |
'vaszevselfadvertbundle.php' => 1, | |
'vaszevcrudbundle.php' => 1, | |
'vaszevcrudltebundle.php' => 1, | |
'vaszevcommonsbundle.php' => 1, | |
'suffixes.php' => 1, | |
'prefixes.php' => 1, | |
'abstractadapterrenderer.php' => 1, | |
'abstractrenderer.php' => 1, | |
'modularapp.php' => 1, | |
'checktypes.php' => 1, | |
'consumer.php' => 1, | |
'phpunit.teamcity.xml' => 1, | |
'phpunit.teamcity.sqlite3.xml' => 1, | |
'phpunit.teamcity.postgresql.xml' => 1, | |
'iframe' => 1, | |
'vincetbasebundle.php' => 1, | |
'vincetadminconfigurationbundle.php' => 1, | |
'vincetadminbundle.php' => 1, | |
'virtualhost.conf' => 1, | |
'vincetypebundle.php' => 1, | |
'vincecmssonataadminbundle.php' => 1, | |
'vincecmsbundle.php' => 1, | |
'vincecoreidelinkbundle.php' => 1, | |
'example.svg' => 1, | |
'signaturemethod.php' => 1, | |
'example.c4ml' => 1, | |
'api-autoloader.php' => 1, | |
'vihuvacrecaptchabundle.php' => 1, | |
'cpt-base.php' => 1, | |
'xmlelementinterface.php' => 1, | |
'xmlelement.php' => 1, | |
'xmlcollectioninterface.php' => 1, | |
'xmlcollection.php' => 1, | |
'xmlattributesinterface.php' => 1, | |
'xmlattributes.php' => 1, | |
'xmlarraycollection.php' => 1, | |
'definitions' => 1, | |
'appendr.php' => 1, | |
'hmacsha1.php' => 1, | |
'behat-client.yml.dist' => 1, | |
'actors.gif' => 1, | |
'iphpfilestorebundle.php' => 1, | |
'abstract_router.php' => 1, | |
'controller_exception.php' => 1, | |
'code' => 1, | |
'squarebitmap.php' => 1, | |
'pixel.php' => 1, | |
'imagebitmap.php' => 1, | |
'ilazybitmap.php' => 1, | |
'colorbitmap.php' => 1, | |
'bitmap.php' => 1, | |
'iphptreebundle.php' => 1, | |
'iphpsearchbundle.php' => 1, | |
'iphpredirectnotfoundbundle.php' => 1, | |
'iphppollbundle.php' => 1, | |
'iphpcorebundle.php' => 1, | |
'behat-worker.yml.dist' => 1, | |
'iphpcontentbundle.php' => 1, | |
'nds.php' => 1, | |
'cnzzwidget.php' => 1, | |
'basegeolocation.php' => 1, | |
'htmlencodeattributebehavior.php' => 1, | |
'basetimezone.php' => 1, | |
'youtubeasset.php' => 1, | |
'cns.php' => 1, | |
'queuemails.php' => 1, | |
'watermark.png' => 1, | |
'result.jpg' => 1, | |
'image.jpg' => 1, | |
'rotor' => 1, | |
'library' => 1, | |
'shooting.gif' => 1, | |
'phpviddler.php' => 1, | |
'bladerenderer.php' => 1, | |
'abstractview.php' => 1, | |
'menu-class-diagram.svg' => 1, | |
'ob_logo_compacto.png' => 1, | |
'ob_logo.png' => 1, | |
'gerar_boleto.php' => 1, | |
'ob_init.php' => 1, | |
'plugin' => 1, | |
'vershsphinxbundle.php' => 1, | |
'coind.php' => 1, | |
'veritrans.php' => 1, | |
'autoload_dist.php' => 1, | |
'viewinterface.php' => 1, | |
'simplehtmlview.php' => 1, | |
'htmlview.php' => 1, | |
'uriinterface.php' => 1, | |
'vespolinacommercebundle.php' => 1, | |
'uriimmutable.php' => 1, | |
'urihelper.php' => 1, | |
'psruri.php' => 1, | |
'abstracturi.php' => 1, | |
'testenvironment.php' => 1, | |
'utf8string.php' => 1, | |
'stringnormalise.php' => 1, | |
'stringinflector.php' => 1, | |
'simpletemplate.php' => 1, | |
'twigrenderer.php' => 1, | |
'platesrenderer.php' => 1, | |
'phprenderer.php' => 1, | |
'mustacherenderer.php' => 1, | |
'vespolinaadminbundle.php' => 1, | |
'storeevents.php' => 1, | |
'mitlicense' => 1, | |
'abstractsocket.php' => 1, | |
'phpdoc-md' => 1, | |
'servedocs.sh' => 1, | |
'publishdocs.sh' => 1, | |
'infinitepager.php' => 1, | |
'vgrelasticsearchhttpfoundationbundle.php' => 1, | |
'vgrelasticsearchbundle.php' => 1, | |
'vgrelasticsearchfosoauthserverbundle.php' => 1, | |
'amazonstoragebundle.php' => 1, | |
'socketinterface.php' => 1, | |
'remotesocket.php' => 1, | |
'localsocket.php' => 1, | |
'httpssocket.php' => 1, | |
'httpsocket.php' => 1, | |
'lxsocketbundle.php' => 1, | |
'vespolinastorebundle.php' => 1, | |
'lxjquerybundle.php' => 1, | |
'jquery-latest.js' => 1, | |
'lxbootstrapbundle.php' => 1, | |
'phpunit.sqlite.xml' => 1, | |
'phpunit.postgresql.xml' => 1, | |
'phpunit.mysqli.xml' => 1, | |
'moodlelib.php' => 1, | |
'class_cloudflare.php' => 1, | |
'config-empty.php' => 1, | |
'.htaccess-template' => 1, | |
'finck.php' => 1, | |
'upgrade-0.6' => 1, | |
'vespolinataxonomybundle.php' => 1, | |
'vespolinataxationbundle.php' => 1, | |
'systemmodule.php' => 1, | |
'swaggermodule.php' => 1, | |
'vivaitauthbundle.php' => 1, | |
'favicongenerator.php' => 1, | |
'eshop.php' => 1, | |
'lazyrouter.php' => 1, | |
'antique.php' => 1, | |
'upfront-theme-manager.php' => 1, | |
'parse' => 1, | |
'uecodeawsclibundle.php' => 1, | |
'titlegenerator.php' => 1, | |
'staticseoitemadapter.php' => 1, | |
'socialmetatagsgenerator.php' => 1, | |
'seositeinterface.php' => 1, | |
'seometatagsgenerator.php' => 1, | |
'seoiteminterface.php' => 1, | |
'linksgenerator.php' => 1, | |
'dynamicseoitem.php' => 1, | |
'realestate.php' => 1, | |
'baseseogenerator.php' => 1, | |
'vagrafonybundle.php' => 1, | |
'udanadminltebundle.php' => 1, | |
'license-kohana' => 1, | |
'ucsfldapormbundle.php' => 1, | |
'ucsfduoormbundle.php' => 1, | |
'ucsdmath-logo.png' => 1, | |
'db.sqlite' => 1, | |
'conucha' => 1, | |
'ubcsisapibundle.php' => 1, | |
'screen 2.png' => 1, | |
'jquery-1.10.2.min.js' => 1, | |
'render.phtml' => 1, | |
'guestbook.php' => 1, | |
'.zf.ini' => 1, | |
'uap-core' => 1, | |
'ldmmodule.php' => 1, | |
'class-zip.php' => 1, | |
'class-updraftplus.php' => 1, | |
'global-hide-brute-force-admin-tool-bar.php' => 1, | |
'global-hide-admin-tool-bar.php' => 1, | |
'reeeed_meeee' => 1, | |
'mockdata' => 1, | |
'umbrellawebmailerbundle.php' => 1, | |
'umbrellawebgooglegeocodingapibundle.php' => 1, | |
'umbrellawebmarkdownbundle.php' => 1, | |
'fileheaderdocblock' => 1, | |
'zendesk_app_controller.php' => 1, | |
'usnnewsletterbundle.php' => 1, | |
'ulffelasticsearchphpclientbundle.php' => 1, | |
'hillmodule.php' => 1, | |
'clean-cache.bat' => 1, | |
'acemodule.php' => 1, | |
'ulaboxrulerbundle.php' => 1, | |
'ulaboxgearmanbundle.php' => 1, | |
'redisphp.png' => 1, | |
'enricher.php' => 1, | |
'emptychildrenexception.php' => 1, | |
'elementtypenotsupportedexception.php' => 1, | |
'arrayconverterinterface.php' => 1, | |
'arrayconverter.php' => 1, | |
'tpnemailtemplatesbundle.php' => 1, | |
'start-update.sh' => 1, | |
'index.css' => 1, | |
'end-update.sh' => 1, | |
'clean-cache.sh' => 1, | |
'update-resources.sh' => 1, | |
'wagner.cson' => 1, | |
'restorer.php' => 1, | |
'dustasset.php' => 1, | |
'tvisionrackspacecloudfilesbundle.php' => 1, | |
'liuggiohelpdeskbundle.php' => 1, | |
'basereflection.php' => 1, | |
'crudassets.php' => 1, | |
'gsearch.php' => 1, | |
'embedwidget.php' => 1, | |
'codevalidator.php' => 1, | |
'yiimaterializeasset.php' => 1, | |
'waves.php' => 1, | |
'materializeiconsasset.php' => 1, | |
'actionbutton.php' => 1, | |
'formbuilderasset.php' => 1, | |
'fieldbehavior.php' => 1, | |
'tuxonevalidationbundle.php' => 1, | |
'wiechertdatatablesbundle.php' => 1, | |
'tuxonesocialmetatagsbundle.php' => 1, | |
'tuxonepostmarkbundle.php' => 1, | |
'bjycompat.classmap.php' => 1, | |
'style.v1.min.css' => 1, | |
'gulp' => 1, | |
'tuskredismqbundle.php' => 1, | |
'schemacollection.php' => 1, | |
'identitymap.php' => 1, | |
'baserecord.php' => 1, | |
'turretio.php' => 1, | |
'css-inliner' => 1, | |
'local-script.sh' => 1, | |
'runpostdeploy.bat' => 1, | |
'ctorsfilesystemcachebundle.php' => 1, | |
'twiftycorebundle.php' => 1, | |
'license_umc' => 1, | |
'multilevelselect.php' => 1, | |
'blaze' => 1, | |
'carbon-breadcrumbs.php' => 1, | |
'wp-hydra.php' => 1, | |
'tystrsendgridbundle.php' => 1, | |
'tystrreactjsbundle.php' => 1, | |
'tystrawsbundle.php' => 1, | |
'thunderbird.jpg' => 1, | |
'ios.jpg' => 1, | |
'websites.json' => 1, | |
'tyhandworkflowbundle.php' => 1, | |
'tyhanddocumentdownloaderbundle.php' => 1, | |
'tyhandbackgroundprocessbundle.php' => 1, | |
'composer-test.php' => 1, | |
'insurancesdk.php' => 1, | |
'twiftyformbundle.php' => 1, | |
'twodudeserrorloggerbundle.php' => 1, | |
'twodudesaclbundle.php' => 1, | |
'sortablecolumn.php' => 1, | |
'compatibility-notice.php' => 1, | |
'ä¸å›½é“¶è”手机支付枧件使用朇å—.pdf' => 1, | |
'财付通银衜普通é™é¢åšç¼–ç (å—æ¯åˆ†è¡¨ï¼‰.xls' => 1, | |
'财付通支付网关商户开å‘朇å—.doc' => 1, | |
'财付通wap支付网关商户开å‘朇å—.doc' => 1, | |
'腾讯公å¸è´¢ä»˜é€šwap支付网关商户开å‘朇å—v2.1.doc' => 1, | |
'更新日志.log' => 1, | |
'手机网页支付枥入丞使用规则.pdf' => 1, | |
'手机网页å³æ—¶åˆ°è´¦æž¥å£.pdf' => 1, | |
'dropdock' => 1, | |
'dropdockrobofile.php' => 1, | |
'example-decrypt.php' => 1, | |
'updraftplus.php' => 1, | |
'cors.php' => 1, | |
'codeprettifyasset.php' => 1, | |
'formattedfilelogroute.php' => 1, | |
'sitechecker' => 1, | |
'textareaautosizeasset.php' => 1, | |
'scrolltotopasset.php' => 1, | |
'scrolltotop.php' => 1, | |
'appscrolltotopasset.php' => 1, | |
'pace.php' => 1, | |
'jqueryscrolltoasset.php' => 1, | |
'jquerymousewheelasset.php' => 1, | |
'jqueryformasset.php' => 1, | |
'jqueryessentialasset.php' => 1, | |
'igrowlasset.php' => 1, | |
'igrowl.php' => 1, | |
'sshot-1.png' => 1, | |
'selectcolumn.php' => 1, | |
'uran1980fancyboxbundle.php' => 1, | |
'game' => 1, | |
'logentriesbundle.php' => 1, | |
'eveonlinesso.php' => 1, | |
'.gitignore.swp' => 1, | |
'unrlabsecuritybundle.php' => 1, | |
'unrlabdomainbundle.php' => 1, | |
'execute-tests.sh' => 1, | |
'builddefault.xml' => 1, | |
'sparrow.php' => 1, | |
'tokenbuffer.php' => 1, | |
'reflectionannotatedproperty.php' => 1, | |
'reflectionannotatedparameter.php' => 1, | |
'jsonfieldsbehavior.php' => 1, | |
'urodoztranslationunitbundle.php' => 1, | |
'reflectionannotatedfunction.php' => 1, | |
'ssh_config.php' => 1, | |
'queuemodule.php' => 1, | |
'develmodule.php' => 1, | |
'preview' => 1, | |
'metatagscomponent.php' => 1, | |
'metatagbehavior.php' => 1, | |
'loopcommandbundle.php' => 1, | |
'oauthstrategy.php' => 1, | |
'iso_codes' => 1, | |
'voelkeldatatablesbundle.php' => 1, | |
'renderparkingbundle.php' => 1, | |
'gfprojectinfobundle.php' => 1, | |
'ushiostumblrbundle.php' => 1, | |
'ushioselasticsearchbundle.php' => 1, | |
'ushiosawsbundle.php' => 1, | |
'urodozcachebundle.php' => 1, | |
'renderableaddressinterface.php' => 1, | |
'geography.php' => 1, | |
'markupwistiabundle.php' => 1, | |
'markupoembedbundle.php' => 1, | |
'markupneedlebundle.php' => 1, | |
'markupjobqueuebundle.php' => 1, | |
'markupfallbackpasswordencoderbundle.php' => 1, | |
'markupbarcodebundle.php' => 1, | |
'markupaddressingbundle.php' => 1, | |
'rfc' => 1, | |
'phpunit_composer.xml' => 1, | |
'phpunit_builtin_autoloader.xml' => 1, | |
'postpone.php' => 1, | |
'urodoztimeexecutionstatsbundle.php' => 1, | |
'reflectionannotatedmethod.php' => 1, | |
'reflectionannotatedclass.php' => 1, | |
'undanetextravalidatorbundle.php' => 1, | |
'shellwrapper.sh' => 1, | |
'entities.php' => 1, | |
'detector.php' => 1, | |
'code.php' => 1, | |
'char.php' => 1, | |
'wp-currencies.php' => 1, | |
'uneaktemplatesmanagerbundle.php' => 1, | |
'uneakroutesmanagerbundle.php' => 1, | |
'uneakformsmanagerbundle.php' => 1, | |
'uneakflatskinbundle.php' => 1, | |
'cktemplatebundle.php' => 1, | |
'uneakblocksmanagerbundle.php' => 1, | |
'uneakassetsmanagerbundle.php' => 1, | |
'uneakadminbundle.php' => 1, | |
'undfzoozpaymentbundle.php' => 1, | |
'specs.php' => 1, | |
'opentransactionhandler.php' => 1, | |
'undfformbundle.php' => 1, | |
'picojade.php' => 1, | |
'translatenotfound.php' => 1, | |
'langiterator.php' => 1, | |
'inlinecss.php' => 1, | |
'cfg.php' => 1, | |
'uecmediavideoproviderbundle.php' => 1, | |
'uecmediapdfbundle.php' => 1, | |
'extractmode.php' => 1, | |
'uecmediaimagebundle.php' => 1, | |
'uecmediaevents.php' => 1, | |
'uecmediabundle.php' => 1, | |
'repr.php' => 1, | |
'cool-faces' => 1, | |
'reflection.php' => 1, | |
'headmodule.php' => 1, | |
'parseexception.php' => 1, | |
'annotation_build.php' => 1, | |
'bootstrap.console.php' => 1, | |
'sqlbuilder.php' => 1, | |
'sessionhandlerserviceprovider.php' => 1, | |
'querylogger.php' => 1, | |
'plugininterface.php' => 1, | |
'pluggable.php' => 1, | |
'permissionmodel.php' => 1, | |
'pagermodule.php' => 1, | |
'mvcserviceprovider.php' => 1, | |
'mutator.php' => 1, | |
'morepagermodule.php' => 1, | |
'customcontrollerresolver.php' => 1, | |
'larathon' => 1, | |
'cookieidentity.php' => 1, | |
'convertutil.php' => 1, | |
'beanmodelformatter.php' => 1, | |
'beanmodel.php' => 1, | |
'configurationserviceprovider.php' => 1, | |
'unknownblisszurbfoundationbundle.php' => 1, | |
'unknownblissbootstrapbundle.php' => 1, | |
'uamuserbundle.php' => 1, | |
'uampropelsessionbundle.php' => 1, | |
'mockerytrait.php' => 1, | |
'spytrait.php' => 1, | |
'watchabletrait.php' => 1, | |
'staticshim.php' => 1, | |
'react-laravel' => 1, | |
'router_ini_factory.php' => 1, | |
'alicecontext.php' => 1, | |
'versionpress-nginx.conf' => 1, | |
'wmcstripebundle.php' => 1, | |
'gfunctions.php' => 1, | |
'gentry.php' => 1, | |
'gdefine.php' => 1, | |
'gconfig.php' => 1, | |
'pot-generator.php' => 1, | |
'required-plugins.php' => 1, | |
'mu-require.php' => 1, | |
'mu-loader.php' => 1, | |
'wmcswiftmailertwigbundle.php' => 1, | |
'wmcmenupartbundle.php' => 1, | |
'wmcdoctrinenamingstrategybundle.php' => 1, | |
'phpunit.xml.coverage.dist' => 1, | |
'wmctemplateinroutebundle.php' => 1, | |
'wmcmangopaybundle.php' => 1, | |
'simplelightncandy.php' => 1, | |
'wmcdirectoryloaderbundle.php' => 1, | |
'gelfmessage.php' => 1, | |
'php-util.phar' => 1, | |
'include.inc.php' => 1, | |
'changelog_generator.php' => 1, | |
'swarm.json' => 1, | |
'wordpress-importer.php' => 1, | |
'parsers.php' => 1, | |
'composer-run-script.gif' => 1, | |
'wcm_lang_switch.class.php' => 1, | |
'dev_tools.class.php' => 1, | |
'create-pot.sh' => 1, | |
'strip-naked-logo.png' => 1, | |
'abstractlightncandytemplate.php' => 1, | |
'dobee.php' => 1, | |
'openpptimelinebundle.php' => 1, | |
'emoji.png' => 1, | |
'whyte624sonataadminextraexportbundle.php' => 1, | |
'auto_prepend.php' => 1, | |
'whybugfile.ini' => 1, | |
'readme-tr' => 1, | |
'bbitbootstrapbundle.php' => 1, | |
'wp-badge-poser.php' => 1, | |
'whisllertechdatabundle.php' => 1, | |
'whisnetircbotbundle.php' => 1, | |
'whatwedoesrbundle.php' => 1, | |
'examples.png' => 1, | |
'nyan.gif' => 1, | |
'fabify-box.json' => 1, | |
'fab-box.json' => 1, | |
'emojis.png' => 1, | |
'wrpinjectabledoctrinebundle.php' => 1, | |
'emojis.php' => 1, | |
'whxeditablebundle.php' => 1, | |
'whuserbundle.php' => 1, | |
'whsmartadminbundle.php' => 1, | |
'whorganisationbundle.php' => 1, | |
'whmainbundle.php' => 1, | |
'whcmsbundle.php' => 1, | |
'whblogbundle.php' => 1, | |
'what3words.class.php' => 1, | |
'sli.php' => 1, | |
'satellizer.php' => 1, | |
'phoneutils.php' => 1, | |
'dddvalidator.php' => 1, | |
'polarbear.php' => 1, | |
'githooksloader.php' => 1, | |
'openpppushnotificationbundle.php' => 1, | |
'widopfixturesbundle.php' => 1, | |
'migrate-1.5.x' => 1, | |
'materializejsasset.php' => 1, | |
'materializecssasset.php' => 1, | |
'helper' => 1, | |
'filemodifier' => 1, | |
'analyzefiles' => 1, | |
'ipdb.dat' => 1, | |
'ip.class.php' => 1, | |
'person.json' => 1, | |
'webgriffepdftotextbundle.php' => 1, | |
'directorynotfoundexception.php' => 1, | |
'migrate-1.8.x' => 1, | |
'migrate-1.7.x' => 1, | |
'migrate-1.6.x' => 1, | |
'migrate-1.10.x' => 1, | |
'webnetssoauthbundle.php' => 1, | |
'view.sublime-project' => 1, | |
'translation.sublime-project' => 1, | |
'testplate.sublime-project' => 1, | |
'webforge-testdata-repository.sublime-project' => 1, | |
'webforge-project-stack.sublime-project' => 1, | |
'migrate-1.2' => 1, | |
'migrate-1.1' => 1, | |
'process.sublime-project' => 1, | |
'persona.sublime-project' => 1, | |
'fatal-error-handler.sublime-project' => 1, | |
'webforge-dom.sublime-project' => 1, | |
'webforge-console.sublime-project' => 1, | |
'webforge-configuration-tester.sublime-project' => 1, | |
'webmiltextlanguagedetectbundle.php' => 1, | |
'price.sublime-project' => 1, | |
'openppoauthserverbundle.php' => 1, | |
'sortercolumn.php' => 1, | |
'openppmapbundle.php' => 1, | |
'yii_production' => 1, | |
'seopanelmodule.php' => 1, | |
'feedbackmodule.php' => 1, | |
'jqtreewidgetasset.php' => 1, | |
'jqtreewidget.php' => 1, | |
'manymanyupdater.php' => 1, | |
'littlebighelper.php' => 1, | |
'gridpagesize.php' => 1, | |
'gridbulkactions.php' => 1, | |
'formfieldsvisibility.php' => 1, | |
'cropperhelper.php' => 1, | |
'statuscolumn.php' => 1, | |
'admindefaultcontroller.php' => 1, | |
'price.sublime-workspace' => 1, | |
'webuniasseticbundle.php' => 1, | |
'servers.yml' => 1, | |
'.gitignore.install' => 1, | |
'onlines.sql' => 1, | |
'paypal_ipn.sql' => 1, | |
'webstronautsreactbundle.php' => 1, | |
'webstronautspusherbundle.php' => 1, | |
'instacontent.class.php' => 1, | |
'.build.xml' => 1, | |
'.build.properties' => 1, | |
'.travis.bash' => 1, | |
'license-gpl-3.0' => 1, | |
'license-bsd-2-clause' => 1, | |
'caq.sh' => 1, | |
'widopfacebookjsbundle.php' => 1, | |
'widopframeworkextrabundle.php' => 1, | |
'migrate-1.8' => 1, | |
'callbackfilteriterator.php' => 1, | |
'wikibasequery.i18n.php' => 1, | |
'wikibasequery.i18n.aliases.php' => 1, | |
'resources.test.php' => 1, | |
'wikibasedatamodel.php' => 1, | |
'serialization.php' => 1, | |
'diff.mw.php' => 1, | |
'datavaluesjavascript.php' => 1, | |
'datatypes.mw.php' => 1, | |
'askserialization.php' => 1, | |
'ask.php' => 1, | |
'ask.mw.php' => 1, | |
'ask.i18n.php' => 1, | |
'hiera.yaml' => 1, | |
'wlfrmtwitterbootstrapbundle.php' => 1, | |
'querycli' => 1, | |
'webglue.php' => 1, | |
'wjzijderveldsculpinrelatedcontentbundle.php' => 1, | |
'smssign.php' => 1, | |
'smscore.php' => 1, | |
'ctmsend.php' => 1, | |
'antglob' => 1, | |
'wizinsimplecmsbundle.php' => 1, | |
'wizingeneratorbundle.php' => 1, | |
'wizinbasebundle.php' => 1, | |
'wizbiipipelinebundle.php' => 1, | |
'savchminkpageobjectbundle.php' => 1, | |
'wizachauniversignbundle.php' => 1, | |
'staging_bootstrap.php' => 1, | |
'wikibasequery.php' => 1, | |
'init.mw.php' => 1, | |
'development_bootstrap.php' => 1, | |
'dataset.yaml' => 1, | |
'versionpress-functions.php' => 1, | |
'wozberedirectbundle.php' => 1, | |
'wowoqueuebundle.php' => 1, | |
'queueimplementationinterface.php' => 1, | |
'wowonewsletterbundle.php' => 1, | |
'serializeattributesbehavior.php' => 1, | |
'symfonyslackbotbundle.php' => 1, | |
'classlist' => 1, | |
'wtkvideobundle.php' => 1, | |
'videofile.php' => 1, | |
'authchoice.php' => 1, | |
'plate.php' => 1, | |
'woppkeyvaluebundle.php' => 1, | |
'woothee' => 1, | |
'resources.tests.php' => 1, | |
'rpcschema.yml' => 1, | |
'rpc.yml' => 1, | |
'wwglobalcontainerbundle.php' => 1, | |
'sessiontable.sql' => 1, | |
'tinymcecontroller.php' => 1, | |
'tinymcecodemirrorasset.php' => 1, | |
'simple-app-task-def.json' => 1, | |
'nginx-site.conf' => 1, | |
'smscounter.php' => 1, | |
'wobblecoderestbundle.php' => 1, | |
'changelong' => 1, | |
'.gitingnore' => 1, | |
'rid.php' => 1, | |
'wmdsmindbodyapibundle.php' => 1, | |
'production_bootstrap.php' => 1, | |
'wispira.php' => 1, | |
'githubhookprovider.php' => 1, | |
'articlefeedbackv5.activity.php' => 1, | |
'specialarticlefeedbackv5.php' => 1, | |
'articlefeedbackv5.utils.php' => 1, | |
'articlefeedbackv5.render.php' => 1, | |
'articlefeedbackv5.php' => 1, | |
'articlefeedbackv5.permissions.php' => 1, | |
'articlefeedbackv5.model.php' => 1, | |
'articlefeedbackv5.mailerjob.php' => 1, | |
'articlefeedbackv5.log.php' => 1, | |
'articlefeedbackv5.i18n.php' => 1, | |
'articlefeedbackv5.hooks.php' => 1, | |
'articlefeedbackv5.flagging.php' => 1, | |
'articlefeedbackv5.backend.lbfactory.php' => 1, | |
'articlefeedbackv5.alias.php' => 1, | |
'xenon-log.yaml' => 1, | |
'semantichighcharts.i18n.php' => 1, | |
'xenon-log.conf' => 1, | |
'xenon-log' => 1, | |
'xenon-generate-svgs' => 1, | |
'arclamp.php' => 1, | |
'wbgisgraphybundle.php' => 1, | |
'gisgraphyaddress.php' => 1, | |
'wbelasticabundle.php' => 1, | |
'elasticaclient.php' => 1, | |
'datatablesassets.php' => 1, | |
'express.class.php' => 1, | |
'gymrss.php' => 1, | |
'widoptwigextensionsbundle.php' => 1, | |
'widopphpbbbundle.php' => 1, | |
'specialarticlefeedbackv5watchlist.php' => 1, | |
'semantichighcharts.php' => 1, | |
'wireshell' => 1, | |
'bazingajstranslationbundle.php' => 1, | |
'winzoutntexpressbundle.php' => 1, | |
'winzoustatemachinebundle.php' => 1, | |
'winzouebaysdkbundle.php' => 1, | |
'winzoucachebundle.php' => 1, | |
'cachefactory.php' => 1, | |
't.bat' => 1, | |
'queryadapter.php' => 1, | |
'phpeffi.cli.php' => 1, | |
'joke.php' => 1, | |
'carminatogooglecsebundle.php' => 1, | |
'hateoas.xsd' => 1, | |
'bazingarestextrabundle.php' => 1, | |
'bazingaoauthserverbundle.php' => 1, | |
'bazingahateoasbundle.php' => 1, | |
'semantichighcharts.settings.php' => 1, | |
'bazingafakerbundle.php' => 1, | |
'amazonproductapi.php' => 1, | |
'blade' => 1, | |
'generic.css' => 1, | |
'infusionsoft.ini.dist' => 1, | |
'test_keys.json.example' => 1, | |
'wikppaymentmtgoxbundle.php' => 1, | |
'formats' => 1, | |
'sidebarmenu.settings.php' => 1, | |
'sidebarmenu.php' => 1, | |
'sidebarmenu.i18n.php' => 1, | |
'semanticsifter.php' => 1, | |
'semanticsifter.i18n.php' => 1, | |
'semanticsifter.i18n.magic.php' => 1, | |
'config.sublime-project' => 1, | |
'migrate-1.7' => 1, | |
'behataliceloader.php' => 1, | |
'kp.php' => 1, | |
'anubis.php' => 1, | |
'jwgl.php' => 1, | |
'libraryajax.php' => 1, | |
'eswis.php' => 1, | |
'vtedpearybundle.php' => 1, | |
'signpass' => 1, | |
'unisender_api.php' => 1, | |
'klbasebundle.php' => 1, | |
'.maintenance.php' => 1, | |
'laravel-translation-manager.wiki' => 1, | |
'generators.wiki' => 1, | |
'patch.php' => 1, | |
'vpxseobundle.php' => 1, | |
'tdnforgebundle.php' => 1, | |
'baseuser.php' => 1, | |
'unit_tests' => 1, | |
'readme_2' => 1, | |
'purifierbehavior.php' => 1, | |
'consolerunner.php' => 1, | |
'xeditableassets.php' => 1, | |
'tinymcefield.php' => 1, | |
'select2field.php' => 1, | |
'select2assets.php' => 1, | |
'customassets.php' => 1, | |
'messagerasset.php' => 1, | |
'messager.php' => 1, | |
'vfgocardlessenterprisebundle.php' => 1, | |
'scrollpagerwrapper.php' => 1, | |
'baseloginform.php' => 1, | |
'baseuserquery.php' => 1, | |
'copyvaluebehavior.php' => 1, | |
'c33smenubundle.php' => 1, | |
'todo-sql-dump' => 1, | |
'todo-customer-repair' => 1, | |
'asapotidybundle.php' => 1, | |
'whatools.inc.php' => 1, | |
'holt45.php' => 1, | |
'simple_test.php' => 1, | |
'gamifyws.php' => 1, | |
'stirling' => 1, | |
'filtertab.php' => 1, | |
'columnstab.php' => 1, | |
'softdelete.php' => 1, | |
'c33ssimplegallerybundle.php' => 1, | |
'c33ssimplecontentbundle.php' => 1, | |
'c33scontactformbundle.php' => 1, | |
'timestampbehavior.php' => 1, | |
'c33ssymfonyconfigmanipulatorbundle.php' => 1, | |
'c33sconstructionkitbundle.php' => 1, | |
'c33sattachmentbundle.php' => 1, | |
'c33sattachmentadminbundle.php' => 1, | |
'daemonexception.php' => 1, | |
'vvgfilterlistbundle.php' => 1, | |
'testing.php' => 1, | |
'markdowncacheexception.php' => 1, | |
'markdowncache.php' => 1, | |
'boxer.php' => 1, | |
'hmvcfilter.php' => 1, | |
'hmvccomponent.php' => 1, | |
'relatedrecordtrait.php' => 1, | |
'relatedrecord.php' => 1, | |
'scrollpagerasset.php' => 1, | |
'numbers.php' => 1, | |
'php-array-kit.php' => 1, | |
'edvfilebundle.php' => 1, | |
'voce-error-logging.php' => 1, | |
'voce-color-setting.php' => 1, | |
'voce-cached-nav.php' => 1, | |
'post-selection-ui.php' => 1, | |
'post-selection-ui.js' => 1, | |
'post-selection-ui.css' => 1, | |
'objects-to-objects.php' => 1, | |
'no-stampede-actions.php' => 1, | |
'nginx-secure-media.php' => 1, | |
'df' => 1, | |
'vmelnikdoctrineencryptbundle.php' => 1, | |
'.psysh.php' => 1, | |
'edvfileevents.php' => 1, | |
'cacert.php' => 1, | |
'voce-image-setting.php' => 1, | |
'.shippable.yml' => 1, | |
'featuretogglebundle.php' => 1, | |
'ladelaslickgridbundle.php' => 1, | |
'ladelarequirejsbundle.php' => 1, | |
'ladelajqueryuibundle.php' => 1, | |
'ladelajquerybundle.php' => 1, | |
'ladelaformbundle.php' => 1, | |
'ladelabootstrapbundle.php' => 1, | |
'phpdocver' => 1, | |
'adduseraction.php' => 1, | |
'vivaittagbundle.php' => 1, | |
'vivaitworkercommandbundle.php' => 1, | |
'vivaitsmsmailerbundle.php' => 1, | |
'voce-featured-posts.php' => 1, | |
'voce-media-setting.php' => 1, | |
'executioner.php' => 1, | |
'wp-media-modal.php' => 1, | |
'editor.php' => 1, | |
'alive.php' => 1, | |
'notifiable.php' => 1, | |
'configregistry.php' => 1, | |
'yandexstrategy.php' => 1, | |
'command.example.php' => 1, | |
'gotopanel.php' => 1, | |
'extensionslist.php' => 1, | |
'gettext-extractor.php' => 1, | |
'wp-twitter-cards.php' => 1, | |
'metabox.js' => 1, | |
'pluginloader.php' => 1, | |
'wp-multisite-sso.php' => 1, | |
'wp-media-modal.js' => 1, | |
'voce-post-expiration.php' => 1, | |
'wp-large-options.php' => 1, | |
'wp-generate-new-image-sizes.php' => 1, | |
'wp-composition.php' => 1, | |
'class-wp-dependency-loader.php' => 1, | |
'wp-contextual-help.php' => 1, | |
'wp-cache-bucket.php' => 1, | |
'voce-widget-cache.php' => 1, | |
'voce-theme-customizer.php' => 1, | |
'voce-post-pdfs.php' => 1, | |
'voce-post-meta.php' => 1, | |
'voce-post-meta-psu.php' => 1, | |
'voce-post-meta-media.php' => 1, | |
'voce-post-meta-colors.php' => 1, | |
'voce-post-meta-colors.js' => 1, | |
'viewerpdf.php' => 1, | |
'uploads.sql' => 1, | |
'migrate-1.4' => 1, | |
'webeithspamassassinbundle.php' => 1, | |
'entity_views.routing.yml' => 1, | |
'entity_views.module' => 1, | |
'entity_views.info.yml' => 1, | |
'circle-checkout.sh' => 1, | |
'webfactorywfdmetabundle.php' => 1, | |
'metaqueryfactory.php' => 1, | |
'metaquery.php' => 1, | |
'webfactorypiwikbundle.php' => 1, | |
'webfactorynavigationbundle.php' => 1, | |
'webfactorylegacyintegrationbundle.php' => 1, | |
'webfactoryicutranslationbundle.php' => 1, | |
'webfactoryexceptionsbundle.php' => 1, | |
'billowrap.php' => 1, | |
'webeithimapbundle.php' => 1, | |
'entity_views.views.inc' => 1, | |
'webeithdnsblbundle.php' => 1, | |
'webdevviepheanstalktaskqueuebundle.php' => 1, | |
'webdevviepushoverbundle.php' => 1, | |
'sanalpos_yapikredi.php' => 1, | |
'sanalpos_denizbank3d.php' => 1, | |
'amazons3bundle.php' => 1, | |
'.conveyor' => 1, | |
'conveyor.yml.dist' => 1, | |
'webburzasyliusgoogleecommercebundle.php' => 1, | |
'webburzasyliusarticlebundle.php' => 1, | |
'新建 文本文档' => 1, | |
'updateassets' => 1, | |
'webdevignformbundle.php' => 1, | |
'entity_views.services.yml' => 1, | |
'micro.info.yml' => 1, | |
'organize' => 1, | |
'fastbill-api.sublime-project' => 1, | |
'webforge-collections.sublime-project' => 1, | |
'webforge-accounting.sublime-project' => 1, | |
'webforge-serializer.sublime-project' => 1, | |
'migrate-1.9.xx' => 1, | |
'migrate-1.8.xx' => 1, | |
'migrate-1.7.xx' => 1, | |
'migrate-1.6.xx' => 1, | |
'migrate-1.5.xx' => 1, | |
'migrate-1.4.xx' => 1, | |
'migrate-1.3.xx' => 1, | |
'migrate-1.2.xx' => 1, | |
'psc-cms-image.sublime-project' => 1, | |
'minimock.sublime-project' => 1, | |
'roboto.scss' => 1, | |
'micro.links.action.yml' => 1, | |
'roboto.min.css' => 1, | |
'roboto.less' => 1, | |
'roboto.css' => 1, | |
'open-sans.scss' => 1, | |
'open-sans.min.css' => 1, | |
'open-sans.less' => 1, | |
'open-sans.css' => 1, | |
'micro.services.yml' => 1, | |
'micro.routing.yml' => 1, | |
'micro.permissions.yml' => 1, | |
'micro.module' => 1, | |
'micro.links.task.yml' => 1, | |
'micro.links.menu.yml' => 1, | |
'micro.links.contextual.yml' => 1, | |
'geobundle.php' => 1, | |
'blazy-documentation.html' => 1, | |
'wnetouseragentbundle.php' => 1, | |
'function.imagecreatefrombmp.php' => 1, | |
'options.ru_ru.ini' => 1, | |
'morphy.php' => 1, | |
'russianplurality.php' => 1, | |
'russiannamesdeclension.php' => 1, | |
'russiangeneraldeclension.php' => 1, | |
'russiancases.php' => 1, | |
'russian.php' => 1, | |
'englishplurality.php' => 1, | |
'cases.php' => 1, | |
'basicplurality.php' => 1, | |
'basicnamesdeclension.php' => 1, | |
'basicdeclension.php' => 1, | |
'multithreading.png' => 1, | |
'imageeditortools.php' => 1, | |
'serverstat.conf' => 1, | |
'imageeditor.php' => 1, | |
'ccomponent.php' => 1, | |
'fork' => 1, | |
'wanupsmlrabbitmqbundle.php' => 1, | |
'mysqldb.class.php' => 1, | |
'wanadevseobundle.php' => 1, | |
'walterraj4p5bundle.php' => 1, | |
'suite.sh' => 1, | |
'suite.php' => 1, | |
'elasticsearch-indexer.php' => 1, | |
'next_version' => 1, | |
'.phppm.yml' => 1, | |
'waldodatatablebundle.php' => 1, | |
'onecloudapi.php' => 1, | |
'archive.bat' => 1, | |
'background-size.min.htc' => 1, | |
'jpusher.php' => 1, | |
'webridgeoauth2accessbundle.php' => 1, | |
'eg.yml' => 1, | |
'bench' => 1, | |
'corleyrc4bundle.php' => 1, | |
'corleyversionbundle.php' => 1, | |
'corleymaintenancebundle.php' => 1, | |
'configloader.php' => 1, | |
'nestedsetquerybehavior.php' => 1, | |
'tradeoffers.php' => 1, | |
'steamexception.php' => 1, | |
'steamcommunity.php' => 1, | |
'market.php' => 1, | |
'sqlqueue.php' => 1, | |
'asynctaskasset.php' => 1, | |
'configurationerror.php' => 1, | |
'nativepay.php' => 1, | |
'micropay.php' => 1, | |
'googleauthenticator.php' => 1, | |
'igtbatch.php' => 1, | |
'igetui.php' => 1, | |
'wasp.class.php' => 1, | |
'wa72simplelogger.php' => 1, | |
'prettymin.php' => 1, | |
'errbit.php' => 1, | |
'citrix.php' => 1, | |
'flatasset.php' => 1, | |
'code-report' => 1, | |
'networkerror.php' => 1, | |
'filesystemerror.php' => 1, | |
'smirikbootstrapbundle.php' => 1, | |
'pipelineparserbundle.php' => 1, | |
'bow' => 1, | |
'falgunphantombundle.php' => 1, | |
'instancedecoderinterface.php' => 1, | |
'instancedecoder.php' => 1, | |
'wixframeworkbundle.php' => 1, | |
'sampleranjeet.php' => 1, | |
'rdvmigrationbundle.php' => 1, | |
'ramseysculpincodeblockbundle.php' => 1, | |
'convertlistener.php' => 1, | |
'rampforumbundle.php' => 1, | |
'raml2html' => 1, | |
'ramiropdosybasebundle.php' => 1, | |
'mime.types.php' => 1, | |
'phpstorm.yml' => 1, | |
'raksuldoctrinesettypebundle.php' => 1, | |
'imagetool.php' => 1, | |
'dumbo.bat' => 1, | |
'example-webpage.php' => 1, | |
'example-webpage-new.php' => 1, | |
'example-plugin-img-resize.php' => 1, | |
'example-plugin-compress.php' => 1, | |
'example-nested-loop.php' => 1, | |
'example-multiple-template-directories.php' => 1, | |
'example-extend-class.php' => 1, | |
'example-draw-string.php' => 1, | |
'example-bootstrap.php' => 1, | |
'example-all.php' => 1, | |
'raindropuploadbundle.php' => 1, | |
'raindroptwigloaderbundle.php' => 1, | |
'raindroptranslationbundle.php' => 1, | |
'dumbo' => 1, | |
'dumbophp.php' => 1, | |
'raindropsoapbundle.php' => 1, | |
'fastlivefilterasset.php' => 1, | |
'authorise-application.php' => 1, | |
'.config_blank.json' => 1, | |
'albopenidserverbundle.php' => 1, | |
'quickstart.sh' => 1, | |
'baffordelasticaextrabundle.php' => 1, | |
'twbsmaxlength.php' => 1, | |
'sidrasset.php' => 1, | |
'sidr.php' => 1, | |
'jpanelmenuasset.php' => 1, | |
'jpanelmenu.php' => 1, | |
'html5sortable.php' => 1, | |
'guidersasset.php' => 1, | |
'guiders.php' => 1, | |
'fastlivefilter.php' => 1, | |
'swactiverecord.php' => 1, | |
'bgswitcherasset.php' => 1, | |
'bgswitcher.php' => 1, | |
'scenario' => 1, | |
'swyedconverterdom.php' => 1, | |
'swyedconverter.php' => 1, | |
'swworkflowsource.php' => 1, | |
'swvalidator.php' => 1, | |
'swphpworkflowsource.php' => 1, | |
'swnode.php' => 1, | |
'swhelper.php' => 1, | |
'swexception.php' => 1, | |
'swevent.php' => 1, | |
'swcomponent.php' => 1, | |
'swactiverecordbehavior.php' => 1, | |
'raindropsyntaxhighlightbundle.php' => 1, | |
'raindroppagebundle.php' => 1, | |
'test_individual.php' => 1, | |
'driverfactory.php' => 1, | |
'tssautomailerbundle.php' => 1, | |
'tssassetsinstallwindowsbundle.php' => 1, | |
'contributing.mb' => 1, | |
'changelog.mb' => 1, | |
'inflection.php' => 1, | |
'providerinterface.php' => 1, | |
'oauthproviderfactory.php' => 1, | |
'abstractoauthprovider.php' => 1, | |
'abstractformatter.php' => 1, | |
'abstractadapter.php' => 1, | |
'handlerinterface.php' => 1, | |
'abstracthandler.php' => 1, | |
'definitionresolver.php' => 1, | |
'bundles.php' => 1, | |
'example_hook2.php' => 1, | |
'categoriesbundle.php' => 1, | |
'cakeormbundle.php' => 1, | |
'rbac.php' => 1, | |
'userdetails.php' => 1, | |
'authenticationproviderinterface.php' => 1, | |
'abstractrepository.php' => 1, | |
'abstractauthenticationprovider.php' => 1, | |
'radmasvichjmsintegrationbundle.php' => 1, | |
'caramel.php' => 1, | |
'licenca' => 1, | |
'update_1.1.sql' => 1, | |
'handlebars.php' => 1, | |
'standardize' => 1, | |
'example_hook.php' => 1, | |
'sari.php' => 1, | |
'raindropmobiledetectbundle.php' => 1, | |
'virtalimplixapibundle.php' => 1, | |
'activedevice.php' => 1, | |
'raindroplocalebundleevents.php' => 1, | |
'raindroplocalebundle.php' => 1, | |
'raindropimportbundle.php' => 1, | |
'raindropgeoipbundle.php' => 1, | |
'pangulize' => 1, | |
'pangulizer.php' => 1, | |
'tweech.php' => 1, | |
'amazonstrategy.php' => 1, | |
'jsonrpcresponse.php' => 1, | |
'jsonrpcrequest.php' => 1, | |
'jsonrpccall.php' => 1, | |
'virtalgoogleapibundle.php' => 1, | |
'settingstrait.php' => 1, | |
'rcdualloginwpfosbundle.php' => 1, | |
'settingsform.php' => 1, | |
'materialdesignliteasset.php' => 1, | |
'subconta.php' => 1, | |
'basic' => 1, | |
'rgoubootstrapbundle.php' => 1, | |
'rcphpcrseobundle.php' => 1, | |
'rcphpcrreordernodesbundle.php' => 1, | |
'rcopensslcryptobundle.php' => 1, | |
'rcphpcrrouteeventsbundle.php' => 1, | |
'rcphpcrmenunodefromroutesbundle.php' => 1, | |
'rcphpcrfileattachinlinebundle.php' => 1, | |
'rcphpcrautositemapbundle.php' => 1, | |
'rcgooglebundle.php' => 1, | |
'rcelasticsearchphpcrproviderbundle.php' => 1, | |
'redirect-handler.php' => 1, | |
'sidebarasset.php' => 1, | |
'beanstalkexception.php' => 1, | |
'smallgraph.php' => 1, | |
'tocgen.php' => 1, | |
'.tocgen' => 1, | |
'ribcage.php' => 1, | |
'donate.php' => 1, | |
'buy.php' => 1, | |
'complete.php' => 1, | |
'checker.yml.dist' => 1, | |
'checker.yml' => 1, | |
'check-tool' => 1, | |
'realtyhubinvoicepainterbundle.php' => 1, | |
'realtyhubbootstrapbundle.php' => 1, | |
'buildall.cmd' => 1, | |
'smallstacked.php' => 1, | |
'naked.php' => 1, | |
'bases.php' => 1, | |
'homepage3.php' => 1, | |
'example9.php' => 1, | |
'example8.php' => 1, | |
'example7.php' => 1, | |
'example6.php' => 1, | |
'example5.php' => 1, | |
'example26.php' => 1, | |
'example25.php' => 1, | |
'example24.php' => 1, | |
'example23.php' => 1, | |
'example22.php' => 1, | |
'example21.php' => 1, | |
'example20.php' => 1, | |
'tocgen.sh' => 1, | |
'chrono.php' => 1, | |
'example18.php' => 1, | |
'beautifyhtml.php' => 1, | |
'love redkitecms (powered by link)' => 1, | |
'redkitelabselfinderbundle.php' => 1, | |
'redkitelabsbootstrapbundle.php' => 1, | |
'.twigjs.yml.dist' => 1, | |
'.pre-commit.yaml' => 1, | |
'redcodecurrencyratebundle.php' => 1, | |
'templixexception.php' => 1, | |
'templix.php' => 1, | |
'markupexception.php' => 1, | |
'doctype.php' => 1, | |
'cssselector.php' => 1, | |
'callermarkup.php' => 1, | |
'cdata.php' => 1, | |
'abstraction.php' => 1, | |
'clicolors.php' => 1, | |
'matchinterface.php' => 1, | |
'frontcontroller.php' => 1, | |
'robots_ssl' => 1, | |
'robots_cdn' => 1, | |
'redcat.php' => 1, | |
'artist' => 1, | |
'.config.php' => 1, | |
'gettext_reader.php' => 1, | |
'__.php' => 1, | |
'gettextemulator.php' => 1, | |
'acceptlanguage.php' => 1, | |
'password-compat.inc.php' => 1, | |
'expanderinterface.php' => 1, | |
'calltrait.php' => 1, | |
'example19.php' => 1, | |
'example17.php' => 1, | |
'sidebarnav.php' => 1, | |
'jeazyuserbundle.php' => 1, | |
'r.js' => 1, | |
'razorpay.php' => 1, | |
'razmomediabundle.php' => 1, | |
'string-buffer.php' => 1, | |
'nan.php' => 1, | |
'leon.php' => 1, | |
'infinity.php' => 1, | |
'raynetcrm.php' => 1, | |
'license.symfony' => 1, | |
'license.slim' => 1, | |
'license.phly' => 1, | |
'jasmini.phar' => 1, | |
'guzzlejsonauth.php' => 1, | |
'moderntheme.php' => 1, | |
'markdownforms.php' => 1, | |
'symfony2plugin.php' => 1, | |
'extraplugin.php' => 1, | |
'ints.php' => 1, | |
'samples.sh' => 1, | |
'distill-cli' => 1, | |
'clashofclansbundle.php' => 1, | |
'ratepaypaymentbundle.php' => 1, | |
'ratchetio.php' => 1, | |
'papprika.php' => 1, | |
'custom-admin-language.php' => 1, | |
'rasflashalertbundle.php' => 1, | |
'basic_functions.php' => 1, | |
'raplbundle.php' => 1, | |
'init_autoload.php' => 1, | |
'phpthumb.config.php' => 1, | |
'example16.php' => 1, | |
'reactorcodersymfony2nodesocketbundle.php' => 1, | |
'example15.php' => 1, | |
'example14.php' => 1, | |
'example13.php' => 1, | |
'example12.php' => 1, | |
'example11.php' => 1, | |
'example10.php' => 1, | |
'markdownify_extra.php' => 1, | |
'markdownify_cli.php' => 1, | |
'markdownify.php' => 1, | |
'license_lgpl' => 1, | |
'realestatesolrbundle.php' => 1, | |
'realestateconzapiclientbundle.php' => 1, | |
'upgrade-0.3' => 1, | |
'reactjs.php' => 1, | |
'pico_load_plugins_composer.php' => 1, | |
'rdrenthtwigextensionbundle.php' => 1, | |
'rdrenthtvragebundle.php' => 1, | |
'dmstwigextensionbundle.php' => 1, | |
'dmsmeetupapibundle.php' => 1, | |
'asgi' => 1, | |
'redeyestormpathbundle.php' => 1, | |
'applicationfinder.php' => 1, | |
'variations_default.php' => 1, | |
'rcamchartsbundle.php' => 1, | |
'rcccsimplepagebundle.php' => 1, | |
'rcccjqueryautocompletebundle.php' => 1, | |
'rc2cthecallrbundle.php' => 1, | |
'rc2cformtwitterbundle.php' => 1, | |
'pico_markdown_forms.php' => 1, | |
'consolecontroller.php' => 1, | |
'beanstalk.php' => 1, | |
'migrate-an-alphalemon-cms-theme-to-redkite-cms' => 1, | |
'provisioner_license' => 1, | |
'psamattservicebuslitebundle.php' => 1, | |
'withmagicmethodtrait.php' => 1, | |
'mailfacade.php' => 1, | |
'langserviceprovider.php' => 1, | |
'langfacade.php' => 1, | |
'kerneltrait.php' => 1, | |
'viewfilenotfoundexception.php' => 1, | |
'servicealiasnotfoundexception.php' => 1, | |
'controllernotfoundexception.php' => 1, | |
'accessnotallowedexception.php' => 1, | |
'slayercommand.php' => 1, | |
'proyecto404utilbundle.php' => 1, | |
'merge_data.php' => 1, | |
'mixpanelextended.php' => 1, | |
'jparser.komodoproject' => 1, | |
'errorlog.html' => 1, | |
'wai-aria.js' => 1, | |
'aria-walker-nav-menu.php' => 1, | |
'protectimus_otp_authentication.php' => 1, | |
'example.pot.json' => 1, | |
'prepare_tests.sh' => 1, | |
'license.phing' => 1, | |
'license.propel' => 1, | |
'propelaclbundle.php' => 1, | |
'pqsdk.php' => 1, | |
'bz_category_sticky.php' => 1, | |
'feature_lock.module' => 1, | |
'feature_lock.info' => 1, | |
'psamattyamlexportbundle.php' => 1, | |
'migrate-2.2' => 1, | |
'prolixmailchimpbundle.php' => 1, | |
'metatitle.php' => 1, | |
'pspdfbundle.php' => 1, | |
'tagswidget.php' => 1, | |
'tinytable4ward.php' => 1, | |
'tablewizard4ward.php' => 1, | |
'settingshelper.php' => 1, | |
'modulesettings.php' => 1, | |
'pageerror404_redirect4ward.php' => 1, | |
'htaccessredirect4ward.php' => 1, | |
'quickjump4ward.php' => 1, | |
'tagshelper.php' => 1, | |
'relatedhelper.php' => 1, | |
'multicategorieshelper.php' => 1, | |
'mostreadhelper.php' => 1, | |
'commentshelper.php' => 1, | |
'migrate-2.3' => 1, | |
'categorieshelper.php' => 1, | |
'authormenuhelper.php' => 1, | |
'archivemenuhelper.php' => 1, | |
'contentjslidegallery.php' => 1, | |
'contaolivereload.php' => 1, | |
'lesscssmod.php' => 1, | |
'contentcegroupstop.php' => 1, | |
'contentcegroup.php' => 1, | |
'modulelightbox4wardautoopen.php' => 1, | |
'contentlightbox4ward.php' => 1, | |
'policytemplateserviceprovider.php' => 1, | |
'serien-loader-client.sublime-project' => 1, | |
'psc-cms-word.sublime-project' => 1, | |
'psc-cms-boot.sublime-project' => 1, | |
'feature_lock.api.php' => 1, | |
'restmodelcontroller.php' => 1, | |
'vagrant.json' => 1, | |
'config-advanced.ini' => 1, | |
'datacollectioninterface.php' => 1, | |
'assetinterface.php' => 1, | |
'assetcomposerinterface.php' => 1, | |
'assetcomposer.php' => 1, | |
'routemanagerinterface.php' => 1, | |
'routeabstract.php' => 1, | |
'chainmanagerinterface.php' => 1, | |
'chainmanager.php' => 1, | |
'chaineventinterface.php' => 1, | |
'chaineventabstract.php' => 1, | |
'stage.php' => 1, | |
'pecl-manager.php' => 1, | |
'pear-manager.php' => 1, | |
'gearmanpeclmanager.php' => 1, | |
'priorityqueue.php' => 1, | |
'gearmanpearmanager.php' => 1, | |
'gearmanmanager.php' => 1, | |
'extactiverecord.php' => 1, | |
'extarcontroller.php' => 1, | |
'privacyidea.json' => 1, | |
'prismicbundle.php' => 1, | |
'none_composer_loader.php' => 1, | |
'prime' => 1, | |
'devlog' => 1, | |
'.gitmergetool' => 1, | |
'.docpx' => 1, | |
'snapshottablebehaviorobjectbuildermodifier.php' => 1, | |
'snapshottablebehavior.php' => 1, | |
'datacollectiontrait.php' => 1, | |
'mathphp.php' => 1, | |
'mongodataconnection.php' => 1, | |
'env' => 1, | |
'modelloader.php' => 1, | |
'modelcontroller.php' => 1, | |
'iosmodelinterpreter.php' => 1, | |
'generatedrestmodelcontrollerloader.php' => 1, | |
'errorresponsedictionary.php' => 1, | |
'errorresponse.php' => 1, | |
'directorymodelloader.php' => 1, | |
'directorycontrollerloader.php' => 1, | |
'defaultapplicationmodel.php' => 1, | |
'defaultapperrors.php' => 1, | |
'dataconnection.php' => 1, | |
'controllerloader.php' => 1, | |
'pmdocumentationbundle.php' => 1, | |
'srbacmodule.php' => 1, | |
'example.vcf' => 1, | |
'progrupasmsbundle.php' => 1, | |
'progrupaedifactbundle.php' => 1, | |
'valuemenu.php' => 1, | |
'menuoption.php' => 1, | |
'menuabstract.php' => 1, | |
'actionmenu.php' => 1, | |
'uploadurlresponse.php' => 1, | |
'b2file.php' => 1, | |
'b2.php' => 1, | |
'tabledumper.php' => 1, | |
'databasedumper.php' => 1, | |
'write-test.php' => 1, | |
'example3.0.vcf' => 1, | |
'example2.1.vcf' => 1, | |
'.env.defaults' => 1, | |
'easyrequest.php' => 1, | |
'lazycoding.php' => 1, | |
'quan-lang.js' => 1, | |
'quartetpaymentwebpaybundle.php' => 1, | |
'quartetpaymentmanuallybundle.php' => 1, | |
'tendo' => 1, | |
'exemplecli.php' => 1, | |
'brodevvietipsumbundle.php' => 1, | |
'user-profile.php' => 1, | |
'quan-userdata.php' => 1, | |
'userdata.php' => 1, | |
'profilepage.php' => 1, | |
'twitter.png' => 1, | |
'quan-tweet-to-post.php' => 1, | |
'postmeta.php' => 1, | |
'quan-language.php' => 1, | |
'landing-page.php' => 1, | |
'configureexception.php' => 1, | |
'landing-page.js' => 1, | |
'landingpage.php' => 1, | |
'quan-jobs.php' => 1, | |
'quan-jobs.js' => 1, | |
'opgoogleanalytics.php' => 1, | |
'quan-image-caption.php' => 1, | |
'quan-blockquote.php' => 1, | |
'createcpt.php' => 1, | |
'boilerplate.php' => 1, | |
'mage_modman_generator.sh' => 1, | |
'quaderno_webhook.php' => 1, | |
'quaderno_tax.php' => 1, | |
'quaderno_recurring.php' => 1, | |
'.bump-version.php' => 1, | |
'mockfunction.php' => 1, | |
'quaderno_model.php' => 1, | |
'jpgraph.php' => 1, | |
'schemando' => 1, | |
'autoloadforphpunit.php' => 1, | |
'ingest.php' => 1, | |
'r1pp3rj4ckgooglebundle.php' => 1, | |
'ridpagebundle.php' => 1, | |
'ridimagetestcase.php' => 1, | |
'ridimagebundle.php' => 1, | |
'how to create templates' => 1, | |
'rithisaddthisbundle.php' => 1, | |
'phpword.php' => 1, | |
'cloudsearchsearch.php' => 1, | |
'cloudsearchclient.php' => 1, | |
'modulenotfoundexception.php' => 1, | |
'rtmpstream.class.php' => 1, | |
'mockfunctiontest.php' => 1, | |
'rtmpsocket.class.php' => 1, | |
'rtmppacket.class.php' => 1, | |
'rtmpoperation.class.php' => 1, | |
'rtmpmessage.class.php' => 1, | |
'rtmpclient.class.php' => 1, | |
'language.config.php' => 1, | |
'wikparser.php' => 1, | |
'idlabtoolboxbundle.php' => 1, | |
'quiubas.php' => 1, | |
' .gitattributes' => 1, | |
'readme.cmd' => 1, | |
'ztest.php' => 1, | |
'splitter.php' => 1, | |
'qlfontawesomebundle.php' => 1, | |
'quaderno_payment.php' => 1, | |
'quaderno_load.php' => 1, | |
'urlrule.php' => 1, | |
'keeper.php' => 1, | |
'introjs.php' => 1, | |
'pvesseltableconverterbundle.php' => 1, | |
'opc.php' => 1, | |
'dns.inc.php' => 1, | |
'probesysvalidateschemabundle.php' => 1, | |
'godcodesbundle.php' => 1, | |
'vcloudsdkforphp-license.docx' => 1, | |
'license-cc-by' => 1, | |
'phpunit-stubs.xml' => 1, | |
'servicefactoryinterface.php' => 1, | |
'globalcontainer.php' => 1, | |
'punic.php' => 1, | |
'wmxml.php' => 1, | |
'contract.php' => 1, | |
'parseargs.php' => 1, | |
'streamer.php' => 1, | |
'useragents.php' => 1, | |
'nagios.phar' => 1, | |
'check_load' => 1, | |
'dubtureffmpegbundle.php' => 1, | |
'dubturecustomeriobundle.php' => 1, | |
'dubtureasyncbundle.php' => 1, | |
'git-s3' => 1, | |
'pulibundle.php' => 1, | |
'pug' => 1, | |
'pubnub.com.pem' => 1, | |
'storage.json' => 1, | |
'charmap.php' => 1, | |
'commandline.php' => 1, | |
'dynamodbsession.php' => 1, | |
'quaderno_json.php' => 1, | |
'qimnetupdatetrackerbundle.php' => 1, | |
'quaderno_item.php' => 1, | |
'quaderno_invoice.php' => 1, | |
'quaderno_expense.php' => 1, | |
'quaderno_estimate.php' => 1, | |
'quaderno_document_item.php' => 1, | |
'quaderno_document.php' => 1, | |
'quaderno_credit.php' => 1, | |
'quaderno_contact.php' => 1, | |
'quaderno_class.php' => 1, | |
'quaderno_base.php' => 1, | |
'vextextension.aux' => 1, | |
'rifilemanagerbundle.php' => 1, | |
'qimnetupdatetrackertestbundle.php' => 1, | |
'qimnettablebundle.php' => 1, | |
'entityhiddentypebundle.php' => 1, | |
'qimnetsolrclienttestbundle.php' => 1, | |
'qimnetsolrclientbundle.php' => 1, | |
'qimnetpaginatorbundle.php' => 1, | |
'qimnetcrudbundle.php' => 1, | |
'videomatacmsimperaviredactorpluginasset.php' => 1, | |
'tablematacmsimperaviredactorpluginasset.php' => 1, | |
'linkmatacmsimperaviredactorpluginasset.php' => 1, | |
'imagematacmsimperaviredactorpluginasset.php' => 1, | |
'tita.php' => 1, | |
'cview.php' => 1, | |
'ccontroller.php' => 1, | |
'capplication.php' => 1, | |
'autocomplete2.jquery.json' => 1, | |
'qckraydibundle.php' => 1, | |
'migrate-an-alphalemon-cms-block-to-redkite-cms' => 1, | |
'migrate-from-alphalemon-cms-to-redkite-cms' => 1, | |
'basecrm.php' => 1, | |
'run_test.bat' => 1, | |
'jsr_server.h' => 1, | |
'jsr_server.c' => 1, | |
'jsr_list.h' => 1, | |
'jsr_list.c' => 1, | |
'jsr_epoll.h' => 1, | |
'jsr_epoll.c' => 1, | |
'jsr_curl.h' => 1, | |
'jsr_curl.c' => 1, | |
'jsr_client.h' => 1, | |
'jsr_client.c' => 1, | |
'jsonrpc.c' => 1, | |
'boot-sqlite.php' => 1, | |
'boot-mysql.php' => 1, | |
'digitalframedatetimepickerbundle.php' => 1, | |
'jsr_utils.h' => 1, | |
'delete-branches.sh' => 1, | |
'ghuntihighchartsphpbundle.php' => 1, | |
'fly.yaml' => 1, | |
'get-composer.sh' => 1, | |
'library.tpl' => 1, | |
'lib.uuid.php' => 1, | |
'changelog-prefork' => 1, | |
'rouffjhowtobundle.php' => 1, | |
'rotvulpixtransbankbundle.php' => 1, | |
'productvalidator.class.php' => 1, | |
'tuckconverterbundle.php' => 1, | |
'configformatconverter.php' => 1, | |
'phrocco' => 1, | |
'jsr_utils.c' => 1, | |
'jsr_yajl.c' => 1, | |
'root.extensions.composer.json' => 1, | |
'bcmath.php' => 1, | |
'dutchnumbers.php' => 1, | |
'rubenrubiobsimpleapicallerbundle.php' => 1, | |
'php_serial.class.php' => 1, | |
'postalcode.php' => 1, | |
'ostmanytoonebundle.php' => 1, | |
'examplecsv.png' => 1, | |
'happen.php' => 1, | |
'_.todo' => 1, | |
'redis-purger.php' => 1, | |
'purger.php' => 1, | |
'nginx-helper.php' => 1, | |
'travis_install_dependencies.sh' => 1, | |
'timers.class.php' => 1, | |
'voucherifyclient.php' => 1, | |
'jsr_yajl.h' => 1, | |
'voucherbuilder.php' => 1, | |
'clientexception.php' => 1, | |
'fuelcell.gemspec' => 1, | |
'sample.eecli.php' => 1, | |
'sample.craft-cli.php' => 1, | |
'github-release.sh' => 1, | |
'bootstrap-ee3.php' => 1, | |
'bootstrap-ee2.php' => 1, | |
'yajl.php' => 1, | |
'yajl.c' => 1, | |
'php_yajl.h' => 1, | |
'php_cjson.h' => 1, | |
'cjson.c' => 1, | |
'php_jsonrpc.h' => 1, | |
'root.workbench.composer.json' => 1, | |
'pluginable.json' => 1, | |
'rudakcontactbundle.php' => 1, | |
'global-smtp.php' => 1, | |
'document.html' => 1, | |
'jsajaxfileuploaderasset.php' => 1, | |
'jsajaxfileuploader.php' => 1, | |
'jqueryupoadfilepluginasset.php' => 1, | |
'jqueryupoadfileplugin.php' => 1, | |
'dropzonefileuploaderasset.php' => 1, | |
'dropzonefileuploader.php' => 1, | |
'rfc2397' => 1, | |
'queryable' => 1, | |
'rcpaiementcmcicbundle.php' => 1, | |
'containerinjector.php' => 1, | |
'rresqueautoloader.php' => 1, | |
'confighandler.php' => 1, | |
'readme_pt_br' => 1, | |
'eauthmodule.php' => 1, | |
'uberloader.php' => 1, | |
'php-excel.class.php' => 1, | |
'jquery.zclip.js' => 1, | |
'zeroclipboard.swf' => 1, | |
'box-calculator.js' => 1, | |
'box-calculator-test.js' => 1, | |
'tsangularjsbundle.php' => 1, | |
'rofilsecurityserviceprovider.php' => 1, | |
'rofilbootstraptemplateserviceprovider.php' => 1, | |
'rofilcontentserviceprovider.php' => 1, | |
'rofilcontentrouteserviceprovider.php' => 1, | |
'class.smarty.php' => 1, | |
'class.login.php' => 1, | |
'bookmarksmodule.php' => 1, | |
'filesmodule.php' => 1, | |
'rthnotificationbundle.php' => 1, | |
'findmodeltrait.php' => 1, | |
'rthmotorbikebundle.php' => 1, | |
'wp-h5bp-htaccess.php' => 1, | |
'h5bp-htaccess.conf' => 1, | |
'soil.php' => 1, | |
'markdown-on-save.php' => 1, | |
'telegrambotapi.class.php' => 1, | |
'ltredisbundle.php' => 1, | |
'screenshot.jpeg' => 1, | |
'example-post.php' => 1, | |
'wp-rocket-cli.php' => 1, | |
'blinkertest.php' => 1, | |
'blinker' => 1, | |
'observe.php' => 1, | |
'php_56' => 1, | |
'likesmodule.php' => 1, | |
'php_55' => 1, | |
'php_54' => 1, | |
'snackbarjsnomatasset.php' => 1, | |
'snackbarjsasset.php' => 1, | |
'bootmaterialjsasset.php' => 1, | |
'bootmaterialcssasset.php' => 1, | |
'romaricdrigonorchestrabundle.php' => 1, | |
'ainnomixredisbundle.php' => 1, | |
'ainnomiximagebundle.php' => 1, | |
'mpr.php' => 1, | |
'belousovchatbundle.php' => 1, | |
'urijsasset.php' => 1, | |
'usersmodule.php' => 1, | |
'pagesmodule.php' => 1, | |
'rudakblogbundle.php' => 1, | |
'rudakdisclaimerbundle.php' => 1, | |
'.projections.json' => 1, | |
'datetimei18nbehavior.php' => 1, | |
'example-proxy-class.php' => 1, | |
'unsavedformwidget.php' => 1, | |
'yiismart.php' => 1, | |
'smartwebmodule.php' => 1, | |
'smartformmodel.php' => 1, | |
'smartdbcriteria.php' => 1, | |
'smartcontroller.php' => 1, | |
'smartconsolecommand.php' => 1, | |
'smartactiverecord.php' => 1, | |
'qtip2.php' => 1, | |
'yiiphpthumb.php' => 1, | |
'fullcalendareventgroup.php' => 1, | |
'i18nbehavior.php' => 1, | |
'viewaction.php' => 1, | |
'campfire.php' => 1, | |
'updateaction.php' => 1, | |
'deleteaction.php' => 1, | |
'createaction.php' => 1, | |
'vcode.php' => 1, | |
'sysinfo.php' => 1, | |
'russellkutilsbundle.php' => 1, | |
'gofsalesbundle.php' => 1, | |
'gofproductsbundle.php' => 1, | |
'russellkgallerybundle.php' => 1, | |
'russellkcategorybundle.php' => 1, | |
'gofcartbundle.php' => 1, | |
'countdownasset.php' => 1, | |
'countdown.php' => 1, | |
'sparklingadyenbundle.php' => 1, | |
'ruudkcampfireexceptionbundle.php' => 1, | |
'stripehelper.php' => 1, | |
'oauth2-readme' => 1, | |
'schemadump' => 1, | |
'db_config_example.json' => 1, | |
'phpbench' => 1, | |
'docmd' => 1, | |
'pupbundle.php' => 1, | |
'rybakitnavigationbundle.php' => 1, | |
'dandelion.sample.yml' => 1, | |
'mixin.php' => 1, | |
'emitter.php' => 1, | |
'aware.php' => 1, | |
'loci.php' => 1, | |
'chromosome.php' => 1, | |
'razorviewrenderer.php' => 1, | |
'eventbrite.php' => 1, | |
'ruudkmolliebundle.php' => 1, | |
'simplegeneticalgorithm.php' => 1, | |
'_mgc-event.php' => 1, | |
'markupgooglecalendar.module' => 1, | |
'googleclientapi.module' => 1, | |
'vocabularybundle.php' => 1, | |
'atomcmsbundle.php' => 1, | |
'deployable' => 1, | |
'test-console' => 1, | |
'jsonxml.xsd' => 1, | |
'framework.json' => 1, | |
'ruudymetroniccrudgeneratorbundle.php' => 1, | |
'sparklingvatbundle.php' => 1, | |
'ruudkpostmarkbundle.php' => 1, | |
'ruudkmoneybirdbundle.php' => 1, | |
'buttonsgroupinput.php' => 1, | |
'stripeform.php' => 1, | |
'layout_exemple' => 1, | |
'probability.php' => 1, | |
'test.11nk5.php' => 1, | |
'env.php.orig' => 1, | |
'test.vehicles.php' => 1, | |
'test.session.php' => 1, | |
'test.fuelups.php' => 1, | |
'test.fuelup.php' => 1, | |
'test.edit.php' => 1, | |
'env.php.original' => 1, | |
'kakubundle.php' => 1, | |
'htmlsectionfield.php' => 1, | |
'rudakpartnerbundle.php' => 1, | |
'urlmaker.php' => 1, | |
'syllabeur.php' => 1, | |
'namer.php' => 1, | |
'test.br-bounces.php' => 1, | |
'fakecontentgenerator.php' => 1, | |
'customcanonicalizer.php' => 1, | |
'cityhelper.php' => 1, | |
'baconipsum.php' => 1, | |
'rudakslugbundle.php' => 1, | |
'rudakrssbundle.php' => 1, | |
'rudakresizerbundle.php' => 1, | |
'rudakownloggerbundle.php' => 1, | |
'rudakmenubundle.php' => 1, | |
'rudakmaintenancebundle.php' => 1, | |
'rudakgallerybundle.php' => 1, | |
'fakedatageneratorbundle.php' => 1, | |
'rudakfacturebundle.php' => 1, | |
'test.br-autohelpdesk.php' => 1, | |
'test.gherkin.feature.php' => 1, | |
'stripecheckoutcustom.php' => 1, | |
'ruianseobundle.php' => 1, | |
'stripecheckout.php' => 1, | |
'ipbehavior.php' => 1, | |
'csvexporter.php' => 1, | |
'multipleimportstrategy.php' => 1, | |
'csvreader.php' => 1, | |
'csvimporter.php' => 1, | |
'baseimportstrategy.php' => 1, | |
'arimportstrategy.php' => 1, | |
'runcomeanvalidationbundle.php' => 1, | |
'smsproxy.php' => 1, | |
'portal.php' => 1, | |
'appserviceprovider.php' => 1, | |
'daplar' => 1, | |
'threema-msgapi-tool.php' => 1, | |
'test.gherkin.tablenode.php' => 1, | |
'resourceutil.php' => 1, | |
'moduleutil.php' => 1, | |
'old.composer.json' => 1, | |
'readme-jshrink' => 1, | |
'magicminifier.php' => 1, | |
'defaultcontroller.php' => 1, | |
'robo.php' => 1, | |
'rubiuscontentfulbundle.php' => 1, | |
'rubiusdatatablesbundle.php' => 1, | |
'locaload' => 1, | |
'autoload-dev.php' => 1, | |
'test.volume.php' => 1, | |
'test.temperature.php' => 1, | |
'test.mileage.php' => 1, | |
'class.geoip.php' => 1, | |
'symfonycontainerwithzffallback.php' => 1, | |
'redkitecmsbundle.php' => 1, | |
'rezzzasecuritybundle.php' => 1, | |
'rguservoicebundle.php' => 1, | |
'rgolarkbundle.php' => 1, | |
'rgmusculabundle.php' => 1, | |
'guibundle.php' => 1, | |
'awtbundle.php' => 1, | |
'guzzleservicedesc2to3.php' => 1, | |
'exportexcelbundle.php' => 1, | |
'functionaltests.xml' => 1, | |
'rfedmundsbundle.php' => 1, | |
'imagemagick.php' => 1, | |
'rezzzacommandbusbundle.php' => 1, | |
'rezzzashortybundle.php' => 1, | |
'rezzzasepabundle.php' => 1, | |
'rezzzarulerbundle.php' => 1, | |
'rhapsodyblogbundle.php' => 1, | |
'rezzzaprocessonebundle.php' => 1, | |
'rezzzapaymentbe2billbundle.php' => 1, | |
'rezzzamodelviolationloggerbundle.php' => 1, | |
'rezzzamailextrabundle.php' => 1, | |
'rezzzamailchimpbundle.php' => 1, | |
'rezzzalocalevoterbundle.php' => 1, | |
'rezzzajobflowbundle.php' => 1, | |
'rezzzaflickrbundle.php' => 1, | |
'slirconfig-sample.class.php' => 1, | |
'phpunit-debug.sh' => 1, | |
'wiki' => 1, | |
'example_simple.php' => 1, | |
'revinatesequencebundle.php' => 1, | |
'uservoicehelper.php' => 1, | |
'rhapsodybootstrapbundle.php' => 1, | |
'polygonalgraph.jquery.json' => 1, | |
'gnu-agpl-3.0' => 1, | |
'extendedcontroller.php' => 1, | |
'adaptiveview.php' => 1, | |
'wp-oo-nonces-plugin.php' => 1, | |
'pluggable-functions.php' => 1, | |
'rofil-2.php' => 1, | |
'rofi' => 1, | |
'rofiltemplatemasterbundle.php' => 1, | |
'instruction' => 1, | |
'oauth2client.php' => 1, | |
'rhosocial_test.bat' => 1, | |
'rhosocial_test' => 1, | |
'rhosocial.bat' => 1, | |
'rhosocial' => 1, | |
'index.phtml' => 1, | |
'rhapsodycommonsbundle.php' => 1, | |
'toaster.php' => 1, | |
'bitbucket.php' => 1, | |
'mozart.php' => 1, | |
'rheckmp3bundle.php' => 1, | |
'rheckdatatablebundle.php' => 1, | |
'rheckaccesscontrolbundle.php' => 1, | |
'rhapsodywikibundle.php' => 1, | |
'rhapsodysocialevents.php' => 1, | |
'rhapsodysocialbundle.php' => 1, | |
'rhapsodysetupbundle.php' => 1, | |
'rhapsodyphingbundle.php' => 1, | |
'rhapsodyforumevents.php' => 1, | |
'rhapsodyforumbundle.php' => 1, | |
'rhapsodycryptobundle.php' => 1, | |
'polygonalgraphwidget.js' => 1, | |
'compy.yml' => 1, | |
'pixelavengersextravalidatorbundle.php' => 1, | |
'jquery.checkboxes.js' => 1, | |
'dapsldapbundle.php' => 1, | |
'replication.services.yml' => 1, | |
'replication.info.yml' => 1, | |
'replication.drush.inc' => 1, | |
'replicator' => 1, | |
'git-deployer.sublime-project' => 1, | |
'najidevjavascriptdatabundle.php' => 1, | |
'sql23-09-15.sql' => 1, | |
'.build.yaml' => 1, | |
'seo_generator.php' => 1, | |
'docker-laravel.sublime-project' => 1, | |
'dashboard.css' => 1, | |
'jquery.timestamper.js' => 1, | |
'redsuns-timeline.php' => 1, | |
'easysysconnectormanager.php' => 1, | |
'quickfaq.php' => 1, | |
'email-config-sample.php' => 1, | |
'html_diff.php' => 1, | |
'nodes.php' => 1, | |
'rednoseyuibundle.php' => 1, | |
'rednosekerberosbundle.php' => 1, | |
'rednosecombohandlerbundle.php' => 1, | |
'rednoseapidocbundle.php' => 1, | |
'redmonsterannouncementbundle.php' => 1, | |
'redkitelabsthemeenginebundle.php' => 1, | |
'upgrade-to-symfony-2.3' => 1, | |
'upgrade-from-redkite-cms-1-1-1' => 1, | |
'update-from-redkite-cms-beta-1' => 1, | |
'serverloadbundle.php' => 1, | |
'remdaneasysysconnectorbundle.php' => 1, | |
'emysqlmutex.php' => 1, | |
'config.sample.json' => 1, | |
'efilemutex.php' => 1, | |
'edbmutex.php' => 1, | |
'ruleset.xml.dist' => 1, | |
'pharse_xml2array.php' => 1, | |
'pharse_tokenizer.php' => 1, | |
'pharse_selector_html.php' => 1, | |
'pharse_parser_html.php' => 1, | |
'pharse_node_html.php' => 1, | |
'pharse_formatter.php' => 1, | |
'pharse.php' => 1, | |
'filetableparser.php' => 1, | |
'researchsquarestrategy.php' => 1, | |
'phpnsc' => 1, | |
'reoringimagebundle.php' => 1, | |
'remedgeyandextranslatebundle.php' => 1, | |
'renusmediabundle.php' => 1, | |
'renuslasttweetbundle.php' => 1, | |
'themebootstrapbundle.php' => 1, | |
'phpexcelformatter.php' => 1, | |
'phpdoc.bat' => 1, | |
'depipe.yml.dist' => 1, | |
'configen' => 1, | |
'routeros_api.class.php' => 1, | |
'maremetlbundle.php' => 1, | |
'.qualitychecker.yml.dist' => 1, | |
'.qualitychecker.yml' => 1, | |
'bootstrapdatepicker.php' => 1, | |
'smartloader.php' => 1, | |
'riakbundle.php' => 1, | |
'restfulrouter.php' => 1, | |
'ricbradiscogsbundle.php' => 1, | |
'containerbridge.php' => 1, | |
'license.newbsd' => 1, | |
'rbadminbundle.php' => 1, | |
'doyoubuzzstrategy.php' => 1, | |
'ext-neptune.js' => 1, | |
'ext-neptune-debug.js' => 1, | |
'ext-neptune-debug-w-comments.js' => 1, | |
'timecircles.jquery.json' => 1, | |
'soap-wsa.php' => 1, | |
'soap-server-wsse.php' => 1, | |
'wp_import.php' => 1, | |
'html_to_markdown.php' => 1, | |
'slim.concept-class' => 1, | |
'r47twitter.php' => 1, | |
'r47sensioconnect.php' => 1, | |
'phpunittests.xml.dist' => 1, | |
'rbblogbundle.php' => 1, | |
'phpmanipulator.xml' => 1, | |
'checker.sh' => 1, | |
'git_contributor-activity.png' => 1, | |
'frontend.png' => 1, | |
'test.dat' => 1, | |
'project.sh' => 1, | |
'bcrypt_generator.php' => 1, | |
'xf' => 1, | |
'tinymceelfinderpopupaction.php' => 1, | |
'serverfileinputelfinderpopupaction.php' => 1, | |
'elfinderhelper.php' => 1, | |
'themoneyconverterexchangerates.php' => 1, | |
'redimlive.php' => 1, | |
'rbadminbundle___.php' => 1, | |
'rbbowerbundle.php' => 1, | |
'rnijveldsf2codebundle.php' => 1, | |
'parser.y' => 1, | |
'rodgermdstravaclientbundle.php' => 1, | |
'sofortbundle.php' => 1, | |
'contestnominationsbundle.php' => 1, | |
'rodgermduniquenotnullentitybundle.php' => 1, | |
'rodgermdsftoolsbundle.php' => 1, | |
'rodgermdmailchimpwrapperbundle.php' => 1, | |
'rodgermdibanapidebundle.php' => 1, | |
'rodgermdcompassbundle.php' => 1, | |
'pwgen.php' => 1, | |
'stc.php' => 1, | |
'short-tag-converter' => 1, | |
'growlnotifier.php' => 1, | |
'dbusnotifier.php' => 1, | |
'rodchynelephantbundle.php' => 1, | |
'rbcorebundle.php' => 1, | |
'tecbotamfbundle.php' => 1, | |
'rbuserbundle.php' => 1, | |
'rbtransbundle.php' => 1, | |
'rbshopbundle.php' => 1, | |
'rbproductbundle.php' => 1, | |
'rbproductadminbundle.php' => 1, | |
'rborderbundle.php' => 1, | |
'rborderadminbundle.php' => 1, | |
'rbnotebundle.php' => 1, | |
'rbmenubundle.php' => 1, | |
'rbfrontbundle.php' => 1, | |
'rbfixbundle.php' => 1, | |
'rbfixadminbundle.php' => 1, | |
'rbdevbundle.php' => 1, | |
'giftvoucher.php' => 1, | |
'steamstrategy.php' => 1, | |
'ricbrakissmetricsbundle.php' => 1, | |
'liveui.php' => 1, | |
'rithiswebsiteindexbundle.php' => 1, | |
'rithisbootstrapbundle.php' => 1, | |
'rutkaifeatureflipperbundle.php' => 1, | |
'sphinx-tool.php' => 1, | |
'help-img.png' => 1, | |
'banhmi-framework.php' => 1, | |
'ringophpredmonbundle.php' => 1, | |
'gh-pages_deploy.sh' => 1, | |
'oz.sql' => 1, | |
'bootstrap-paginator.latte' => 1, | |
'riki34symfonyangularentitiesbundle.php' => 1, | |
'sail-theme.yaml' => 1, | |
'liveui_html_page.php' => 1, | |
'class.liveui.php' => 1, | |
'yahoojpstrategy.php' => 1, | |
'magentoconnect.html' => 1, | |
'numbers2wordsbundle.php' => 1, | |
'notificatobundle.php' => 1, | |
'wiki.php' => 1, | |
'socialsecuritynumbervalidator.php' => 1, | |
'socialsecuritynumber.php' => 1, | |
'test-extensions.php' => 1, | |
'sassloader.php' => 1, | |
'tokenizerasset.php' => 1, | |
'box.json.sample' => 1, | |
'rdfjobdefinitionformatbundle.php' => 1, | |
'defaultautoload.php' => 1, | |
'ricbrarobotstxtbundle.php' => 1, | |
'mixistrategy.php' => 1, | |
'helper_functions.php' => 1, | |
'redditstrategy.php' => 1, | |
'letterexception.php' => 1, | |
'rmzamoraoauthbundle.php' => 1, | |
'rmzamorajquerybundle.php' => 1, | |
'rmzamoraformextensionbundle.php' => 1, | |
'rmzamorabootstrapbundle.php' => 1, | |
'cryptxxtea.php' => 1, | |
'ulogin.php' => 1, | |
'socicon.php' => 1, | |
'si.php' => 1, | |
'rbacmigration.php' => 1, | |
'rbacfactory.php' => 1, | |
'powermigration.php' => 1, | |
'viewletter.php' => 1, | |
'rawletter.php' => 1, | |
'letter.php' => 1, | |
'yuccainsituupdaterbundle.php' => 1, | |
'ionicon.php' => 1, | |
'fa.php' => 1, | |
'cdnassetbundle.php' => 1, | |
'imagewrapper.php' => 1, | |
'favicon.php' => 1, | |
'nmadflybundle.php' => 1, | |
'.travis.database.yml' => 1, | |
'saxfactory.php' => 1, | |
'raisenowsaxbundle.php' => 1, | |
'randomkeybehavior.php' => 1, | |
'data-sample.php' => 1, | |
'ip.lib.php' => 1, | |
'combine.sh' => 1, | |
'readme_without_lines' => 1, | |
'errorhandlerbundle.php' => 1, | |
'build.views.xml' => 1, | |
'rzblockbundle.php' => 1, | |
'mopabarcodebundle.php' => 1, | |
'localasset.php' => 1, | |
'backboneasset.php' => 1, | |
'philippeaelliguikitbundle.php' => 1, | |
'kitpagesgooglemapsbundle.php' => 1, | |
'wp-ajax-helper.php' => 1, | |
'widget-output-filters.php' => 1, | |
'vagrant_transient.phar' => 1, | |
'sanitize.phar' => 1, | |
'sanitize.json' => 1, | |
'mnsqueue.php' => 1, | |
'readme-symfony-standard' => 1, | |
'mopawsseauthenticationbundle.php' => 1, | |
'moparemoteupdatebundle.php' => 1, | |
'i18nurlmanager.php' => 1, | |
'jqmobileasset.php' => 1, | |
'geophp.inc' => 1, | |
'widgetfy.php' => 1, | |
'tman.example' => 1, | |
'pharmonic' => 1, | |
'imageprocessing.php' => 1, | |
'fileprocessing.php' => 1, | |
'footerwidget.php' => 1, | |
'headerwidget.php' => 1, | |
'brood' => 1, | |
'install-nosudo' => 1, | |
'windows' => 1, | |
'db_model.erm' => 1, | |
'sansiscorebasebundle.php' => 1, | |
'yii2dynatable.php' => 1, | |
'yiijquerytoc.php' => 1, | |
'philgeolocationbundle.php' => 1, | |
'yii2pinitasset.php' => 1, | |
'p2bootstrapbundle.php' => 1, | |
'core-builder.xml' => 1, | |
'yiiwymeditor.php' => 1, | |
'yii2visjs.php' => 1, | |
'yii2tooltipsterasset.php' => 1, | |
'yii2tooltipster.php' => 1, | |
'yii2toolbarbuttonasset.php' => 1, | |
'yii2toolbarbutton.php' => 1, | |
'yii2snapsvg.php' => 1, | |
'yii2sly.php' => 1, | |
'slyasset.php' => 1, | |
'yii2slidebars.php' => 1, | |
'slidebarsasset.php' => 1, | |
'yii2pinit.php' => 1, | |
'yii2textareaautosize.php' => 1, | |
'yii2masonryasset.php' => 1, | |
'yii2masonry.php' => 1, | |
'yii2imagesloadedasset.php' => 1, | |
'yii2instafeedasset.php' => 1, | |
'yii2instafeed.php' => 1, | |
'yii2imagesliderasset.php' => 1, | |
'yii2imageslider.php' => 1, | |
'yii2fullpagejsasset.php' => 1, | |
'yii2fullpagejs.php' => 1, | |
'yii2fullcalendarscheduler.php' => 1, | |
'yii2feedback.php' => 1, | |
'yii2extblocksitasset.php' => 1, | |
'yii2extblocksit.php' => 1, | |
'yii2elfinder.php' => 1, | |
'philguzzlebundle.php' => 1, | |
'philbasebundle.php' => 1, | |
'mediastorageinterface.php' => 1, | |
'phpdoctor.html' => 1, | |
'performervagrantbundle.php' => 1, | |
'performerreruserbundle.php' => 1, | |
'perficocorebundle.php' => 1, | |
'domcreator.php' => 1, | |
'google-places.png' => 1, | |
'beet' => 1, | |
'yiidebugcacheproxy.php' => 1, | |
'yiicsol.php' => 1, | |
'sagesignerbundle.php' => 1, | |
'peg.php' => 1, | |
'peg.bat' => 1, | |
'peg' => 1, | |
'phpdoc.php' => 1, | |
'phpdoctor.tags.html' => 1, | |
'message.png' => 1, | |
'pkj-page-source.pot' => 1, | |
'pkj-page-source-nb_no.po' => 1, | |
'pkj-page-source-nb_no.mo' => 1, | |
'linuxbackups' => 1, | |
'siterfrontendeditingbundle.php' => 1, | |
'loaddatabase.php' => 1, | |
'limp' => 1, | |
'appcache.manifest' => 1, | |
'assets-database.sspak' => 1, | |
'api-0.1.0' => 1, | |
'release-1.0.0a5' => 1, | |
'release-1.0.0a4' => 1, | |
'release-1.0.0a3' => 1, | |
'leo.png' => 1, | |
'concurrent.png' => 1, | |
'qrcode2.png' => 1, | |
'pagevisibilityasset.php' => 1, | |
'qrcode.png' => 1, | |
'ruiantwitterbootstrapbundle.php' => 1, | |
'prgportabledocumentbundle.php' => 1, | |
'ineatconseildynamicbundle.php' => 1, | |
'commandexception.php' => 1, | |
'pfhomesteadbundle.php' => 1, | |
'webfinger.php' => 1, | |
'bondoraapi.php' => 1, | |
'statsd-console' => 1, | |
'starcraftconnectionlayerbundle.php' => 1, | |
'cargallerycorebundle.php' => 1, | |
'blizzardapibundle.php' => 1, | |
'petitpflotbundle.php' => 1, | |
'goreblogbundle.php' => 1, | |
'dot.png' => 1, | |
'paginationpagerbundle.php' => 1, | |
'clipcloptest.php' => 1, | |
'clipclop.php' => 1, | |
'credittransfer.php' => 1, | |
'yii2getid3.php' => 1, | |
'scorchasset.php' => 1, | |
'cities' => 1, | |
'cidr_optim' => 1, | |
'arraytransformer.php' => 1, | |
'perimetercachebundle.php' => 1, | |
'vhost.dist.conf' => 1, | |
'output-sample.png' => 1, | |
'watcher.gif' => 1, | |
'usage.png' => 1, | |
'googlegeocoding.php' => 1, | |
'p2ratchetbundle.php' => 1, | |
'release-1.0.0a1' => 1, | |
'file.source.txt.twig' => 1, | |
'update-components.php' => 1, | |
'stree.sh' => 1, | |
'page_header.xsl' => 1, | |
'package.html.twig' => 1, | |
'method.html.twig' => 1, | |
'search.xsl' => 1, | |
'parse_markers.xsl' => 1, | |
'menu.xsl' => 1, | |
'markers.xsl' => 1, | |
'file.xsl' => 1, | |
'classgraph.xsl' => 1, | |
'ajax_search.php' => 1, | |
'interface.html.twig' => 1, | |
'file.html.twig' => 1, | |
'phpassert' => 1, | |
'report_parse_markers.xsl' => 1, | |
'report_markers.xsl' => 1, | |
'report_deprecated.xsl' => 1, | |
'helpers.xsl' => 1, | |
'graph_class.xsl' => 1, | |
'api-doc.xsl' => 1, | |
'vcrvcrbundle.php' => 1, | |
'main.sh' => 1, | |
'php_riak_stub.iml' => 1, | |
'resquebundle.php' => 1, | |
'.alias' => 1, | |
'pletnevprojectmanagerbundle.php' => 1, | |
'jautoload.php' => 1, | |
'run_examples.php' => 1, | |
'subscriptions.php' => 1, | |
'luguibundle.php' => 1, | |
'phpbrew.asc' => 1, | |
'namiadminbundle.php' => 1, | |
'entityrepository.php' => 1, | |
'doctrinehelper.php' => 1, | |
'gearsdoc' => 1, | |
'flags.png' => 1, | |
'flags.css' => 1, | |
'fixer.bat' => 1, | |
'bootstrap.dist.php' => 1, | |
'update-constants.php' => 1, | |
'sonarqube-ant-task-2.4.jar' => 1, | |
'phpcq.main.xml' => 1, | |
'license.bsd-3-clause' => 1, | |
'revert.php' => 1, | |
'phpbrew' => 1, | |
'tracking.php' => 1, | |
'readme.pt-br' => 1, | |
'viewonline_helper.php' => 1, | |
'version_helper.php' => 1, | |
'user_loader.php' => 1, | |
'symfony_request.php' => 1, | |
'recursive_dot_prefix_filter_iterator.php' => 1, | |
'path_helper.php' => 1, | |
'file_downloader.php' => 1, | |
'error_collector.php' => 1, | |
'content_visibility.php' => 1, | |
'config_php_file.php' => 1, | |
'class_loader.php' => 1, | |
'phpbbsessionsauthbundle.php' => 1, | |
'versions.php' => 1, | |
'curl.xml' => 1, | |
'lugstoragebundle.php' => 1, | |
'p2securitybundle.php' => 1, | |
'phoxy.js' => 1, | |
'singletone.ejs' => 1, | |
'require.ejs' => 1, | |
'head.ejs' => 1, | |
'empty.ejs' => 1, | |
'echo.ejs' => 1, | |
'each.ejs' => 1, | |
'delay.ejs' => 1, | |
'data_download.ejs' => 1, | |
'chain.ejs' => 1, | |
'virtual_namespace_helper.php' => 1, | |
'rpc_string_parser.php' => 1, | |
'phoxy_return_worker.php' => 1, | |
'phoxy.php' => 1, | |
'enjs.php' => 1, | |
'abstractcachepool.php' => 1, | |
'coldstart.php' => 1, | |
'enjs.js' => 1, | |
'repositoryserviceprovider.php' => 1, | |
'whmhypebundle.php' => 1, | |
'namedparameters.php' => 1, | |
'cqchecks.json' => 1, | |
'settings.dist.yml' => 1, | |
'phillip' => 1, | |
'.phillip.yml' => 1, | |
'voterinterface.php' => 1, | |
'voteableinterface.php' => 1, | |
'voteinterface.php' => 1, | |
'votealgorithminterface.php' => 1, | |
'php-doc notes' => 1, | |
'hasexpirationdateinterface.php' => 1, | |
'lugregistrybundle.php' => 1, | |
'taggableiteminterface.php' => 1, | |
'lugadminbundle.php' => 1, | |
'httplugfactory.php' => 1, | |
'httplugbundle.php' => 1, | |
'helix' => 1, | |
'documenting' => 1, | |
'.php_cs_psr2r' => 1, | |
'commonvalueobjectbundle.php' => 1, | |
'generate_messages.sh' => 1, | |
'voidcachepool.php' => 1, | |
'taggablepooltrait.php' => 1, | |
'taggablepoolinterface.php' => 1, | |
'taggablepsr6pooladapter.php' => 1, | |
'taggablepsr6itemadapter.php' => 1, | |
'psr6sessionhandler.php' => 1, | |
'apccachepool.php' => 1, | |
'rediscachepool.php' => 1, | |
'prediscachepool.php' => 1, | |
'namespacedcachepool.php' => 1, | |
'mongodbcachepool.php' => 1, | |
'memcachedcachepool.php' => 1, | |
'memcachecachepool.php' => 1, | |
'hierarchicalpoolinterface.php' => 1, | |
'hierarchicalcachepooltrait.php' => 1, | |
'filesystemcachepool.php' => 1, | |
'doctrinecachebridge.php' => 1, | |
'doctrinecachepool.php' => 1, | |
'cachepoolchain.php' => 1, | |
'arraycachepool.php' => 1, | |
'apcucachepool.php' => 1, | |
'release-1.0.0a2' => 1, | |
'release-1.0.0b5' => 1, | |
'nami.postman_collection' => 1, | |
'how-to-test' => 1, | |
'openpayudomain.php' => 1, | |
'openpayubase.php' => 1, | |
'palapimagetagbundle.php' => 1, | |
'test.properties' => 1, | |
'serviceinjection.php' => 1, | |
'functionaltestcase.php' => 1, | |
'imap.php' => 1, | |
'remotefileloaderinterface.php' => 1, | |
'remotefileloaderfactory.php' => 1, | |
'partkeeprremotefileloaderbundle.php' => 1, | |
'nousableremotefileloaderexception.php' => 1, | |
'curlloader.php' => 1, | |
'mailobfuscator.php' => 1, | |
'persiandatepickerasset.php' => 1, | |
'openpayuoauth.php' => 1, | |
'persiandatepicker.php' => 1, | |
'sendloop.php' => 1, | |
'exam.php' => 1, | |
'twuzzleclient.php' => 1, | |
'parkjitwitterloginbundle.php' => 1, | |
'bundle-readme' => 1, | |
'parasyslogreaderbundle.php' => 1, | |
'cs-ruleset.xml' => 1, | |
'paramonovavspresshtmlcompress.php' => 1, | |
'errata' => 1, | |
'pharaoh' => 1, | |
'phpbuiltinwebserver.php' => 1, | |
'presenterexception.php' => 1, | |
'openpayunetwork.php' => 1, | |
'pasintercmsbundle.php' => 1, | |
'noticeserviceprovider.php' => 1, | |
'page_example.info.yml' => 1, | |
'signrequestinterface.php' => 1, | |
'signrequest.php' => 1, | |
'registerresponseinterface.php' => 1, | |
'registerresponse.php' => 1, | |
'registerrequestinterface.php' => 1, | |
'registerrequest.php' => 1, | |
'authenticationresponseinterface.php' => 1, | |
'authenticationresponse.php' => 1, | |
'travis.bootstrap.php' => 1, | |
'page_example.routing.yml' => 1, | |
'page_example.permissions.yml' => 1, | |
'page_example.module' => 1, | |
'page_example.links.menu.yml' => 1, | |
'mcgroovinmultivariatetestsbundle.php' => 1, | |
'pasinterredisohmbundle.php' => 1, | |
'postinstall.php' => 1, | |
'exacttargetlaravelconfig.php' => 1, | |
'flatline' => 1, | |
'requests.php' => 1, | |
'oca.php' => 1, | |
'patlenaingasjqueryuibundle.php' => 1, | |
'patlenaingasjquerybundle.php' => 1, | |
'phpdoc2rst.php' => 1, | |
'patgod85phpdoc2rstbundle.php' => 1, | |
'bgpersonabundle.php' => 1, | |
'license.tcpdf' => 1, | |
'base2dbarcode.php' => 1, | |
'base1dbarcode.php' => 1, | |
'barcodebundle.php' => 1, | |
'presentable.php' => 1, | |
'noticefacade.php' => 1, | |
'u2f_interface.php' => 1, | |
'mediadb.php' => 1, | |
'box_catalog_navigation.css' => 1, | |
'box_catalog_limited_content.css' => 1, | |
'box_catalog_azlist.css' => 1, | |
'box_calendar.css' => 1, | |
'basic.css' => 1, | |
'dist.papaya.php' => 1, | |
'dist.build.properties' => 1, | |
'xmltree.php' => 1, | |
'phrases.php' => 1, | |
'msgbox.php' => 1, | |
'modglyph.php' => 1, | |
'mediamime.php' => 1, | |
'mediafilebrw.php' => 1, | |
'log_auth.php' => 1, | |
'box_categteaser.css' => 1, | |
'linktypes.php' => 1, | |
'inc.version.php' => 1, | |
'inc.glyphs.php' => 1, | |
'inc.func.php' => 1, | |
'inc.footer.php' => 1, | |
'inc.conf.php' => 1, | |
'inc.auth.php' => 1, | |
'inc.application.php' => 1, | |
'imggen.php' => 1, | |
'glyphview.php' => 1, | |
'end.php' => 1, | |
'cronexec.php' => 1, | |
'boxes.php' => 1, | |
'box_catalog_related_list.css' => 1, | |
'box_contact_list.css' => 1, | |
'mailableinterface.php' => 1, | |
'page_faq.css' => 1, | |
'global.css' => 1, | |
'tinymce.css' => 1, | |
'page_wiki.css' => 1, | |
'page_thumbs.css' => 1, | |
'page_stickers.css' => 1, | |
'page_sitemap.css' => 1, | |
'page_quiz.css' => 1, | |
'page_poll.css' => 1, | |
'page_mnogo.css' => 1, | |
'page_include.css' => 1, | |
'page_forum.css' => 1, | |
'page_files.css' => 1, | |
'page_feedback.css' => 1, | |
'page_community.css' => 1, | |
'box_contact_online.css' => 1, | |
'page_catalog.css' => 1, | |
'page_calendar.css' => 1, | |
'ie7.css' => 1, | |
'ie6win.css' => 1, | |
'default48.jpg' => 1, | |
'default100.jpg' => 1, | |
'colors.css' => 1, | |
'box_stickers.css' => 1, | |
'box_quiz.css' => 1, | |
'box_poll.css' => 1, | |
'box_navigation.css' => 1, | |
'box_mnogo.css' => 1, | |
'box_linkdb.css' => 1, | |
'box_forum.css' => 1, | |
'u2f.php' => 1, | |
'index.dist.php' => 1, | |
'release-1.0.0b4' => 1, | |
'amqp_exchange.h' => 1, | |
'build-phing.xml' => 1, | |
'combinatorics.php' => 1, | |
'sync-php4' => 1, | |
'logon.php' => 1, | |
'live_phpunit.sh.example' => 1, | |
'example_subset_ruleset.xml' => 1, | |
'samlbundle.php' => 1, | |
'test-report.sh' => 1, | |
'php_amqp.h' => 1, | |
'php7_support.h' => 1, | |
'php5_support.h' => 1, | |
'amqp_queue.h' => 1, | |
'amqp_queue.c' => 1, | |
'amqp_exchange.c' => 1, | |
'local.win.properties' => 1, | |
'amqp_envelope.h' => 1, | |
'amqp_envelope.c' => 1, | |
'amqp_connection_resource.h' => 1, | |
'amqp_connection_resource.c' => 1, | |
'amqp_connection.h' => 1, | |
'amqp_connection.c' => 1, | |
'amqp_channel.h' => 1, | |
'amqp_channel.c' => 1, | |
'amqp.c' => 1, | |
'snidetravisbundle.php' => 1, | |
'snidetravinizerbundle.php' => 1, | |
'snidescrutinizerbundle.php' => 1, | |
'snidemonitorbundle.php' => 1, | |
'fo-custom.xsl' => 1, | |
'license_plugins' => 1, | |
'pcaws4authbundle.php' => 1, | |
'make-pear-bundle.php' => 1, | |
'release-1.0.0b3' => 1, | |
'release-1.0.0b2' => 1, | |
'release-1.0.0b1' => 1, | |
'release-0.2.1' => 1, | |
'release-0.2.0' => 1, | |
'release-0.1.3' => 1, | |
'release-0.1.2' => 1, | |
'release-0.1.1' => 1, | |
'test-modified.php' => 1, | |
'template.spec' => 1, | |
'package.dtd' => 1, | |
'package-manpages.xml' => 1, | |
'package-errorstack.xml' => 1, | |
'make-installpear-nozlib-phar.php' => 1, | |
'package_pfm1.php' => 1, | |
'make-gopear-phar.php' => 1, | |
'make-command-xml.php' => 1, | |
'install-pear' => 1, | |
'install-pear.php' => 1, | |
'go-pear-phar.php' => 1, | |
'go-pear-list.php' => 1, | |
'catalog' => 1, | |
'readme.contributing' => 1, | |
'makefile.frag' => 1, | |
'copy-from-pear-core.sh' => 1, | |
'license-bsd' => 1, | |
'package_plugins.xml' => 1, | |
'package_plugins.php' => 1, | |
'package_pfm1.xml' => 1, | |
'snideextraformbundle.php' => 1, | |
'vars.less' => 1, | |
'rest-api-plugin-endpoints.php' => 1, | |
'select2adminlteasset.php' => 1, | |
'paynet_processor_aggregate.php' => 1, | |
'paynet.xml' => 1, | |
'paynet.php' => 1, | |
'guzzleclient.php' => 1, | |
'requestexample' => 1, | |
'tk_tm.csv' => 1, | |
'listingview.php' => 1, | |
'listingfactory.php' => 1, | |
'listing.php' => 1, | |
'datatableslistingbundle.php' => 1, | |
'run_specs' => 1, | |
'enviromenteavbundle.php' => 1, | |
'selector.png' => 1, | |
'modelselectorasset.php' => 1, | |
'php_loc' => 1, | |
'modelselector.php' => 1, | |
'kuceramonologextensionsbundle.php' => 1, | |
'dgisapibundle.php' => 1, | |
'dgsphinxsearch.php' => 1, | |
'nestedsetsquerytrait.php' => 1, | |
'nestedintervalsquerytrait.php' => 1, | |
'nestedintervalsbehavior.php' => 1, | |
'materializedpathquerytrait.php' => 1, | |
'autotreetrait.php' => 1, | |
'adjacencylistquerytrait.php' => 1, | |
'wikicreole.php' => 1, | |
'badasstubeexample.php' => 1, | |
'sql_for_db_creation.sql' => 1, | |
'update.sql' => 1, | |
'run-server.bat' => 1, | |
'padding.less' => 1, | |
'menufy.jquery.js' => 1, | |
'objects.less' => 1, | |
'margin.less' => 1, | |
'list.less' => 1, | |
'font.less' => 1, | |
'common.less' => 1, | |
'clear.less' => 1, | |
'animation.less' => 1, | |
'vhax.jquery.js' => 1, | |
'vha.jquery.js' => 1, | |
'responsify.jquery.js' => 1, | |
'openify.jquery.js' => 1, | |
'navigateto.jquery.js' => 1, | |
'movify.jquery.js' => 1, | |
'httpify.js' => 1, | |
'pbebasebundle.php' => 1, | |
'heighten.jquery.js' => 1, | |
'devicify.js' => 1, | |
'developify.jquery.js' => 1, | |
'pcdummyajaxcompletebundle.php' => 1, | |
'mbtuserbundle.php' => 1, | |
'pcastrotigretsecuritybundle.php' => 1, | |
'whatsappresponse.php' => 1, | |
'whatsappapi.php' => 1, | |
'userserviceplugin.php' => 1, | |
'pbhtechnocommunicatorbundle.php' => 1, | |
'fork.php' => 1, | |
'users.example.yml' => 1, | |
'screenshot-top-menu.png' => 1, | |
'screenshot-top-menu-with-directly-loaded-locations.png' => 1, | |
'namicorebundle.php' => 1, | |
'link_header.php' => 1, | |
'build.securepages.xml' => 1, | |
'pmapasswordencoderbundle.php' => 1, | |
'jquery.countdown-ca.js' => 1, | |
'jquery.countdown-bs.js' => 1, | |
'jquery.countdown-bn.js' => 1, | |
'jquery.countdown-bg.js' => 1, | |
'jquery.countdown-ar.js' => 1, | |
'countdownled.png' => 1, | |
'countdownglowing.gif' => 1, | |
'countdownbasic.html' => 1, | |
'pmzeroclipboardbundle.php' => 1, | |
'pmyubikeyotpbundle.php' => 1, | |
'pmtoolbundle.php' => 1, | |
'pmmonitoringbundle.php' => 1, | |
'pmgoogleauthenticatorbundle.php' => 1, | |
'keypadbasic.html' => 1, | |
'jquery.countdown-cy.js' => 1, | |
'keypad.png' => 1, | |
'jquery.keypad.min.js' => 1, | |
'jquery.keypad.js' => 1, | |
'jquery.keypad.css' => 1, | |
'jquery.keypad.alt.css' => 1, | |
'jquery.keypad-tr.js' => 1, | |
'jquery.keypad-pt-br.js' => 1, | |
'jquery.keypad-nl.js' => 1, | |
'jquery.keypad-it.js' => 1, | |
'jquery.keypad-fr.js' => 1, | |
'jquery.keypad-es.js' => 1, | |
'jquery.keypad-de.js' => 1, | |
'jquery.keypad-cs.js' => 1, | |
'jquery.countdown-cs.js' => 1, | |
'jquery.countdown-da.js' => 1, | |
'ppvbasebundle.php' => 1, | |
'jquery.countdown-kn.js' => 1, | |
'jquery.countdown-sk.js' => 1, | |
'jquery.countdown-ru.js' => 1, | |
'jquery.countdown-ro.js' => 1, | |
'jquery.countdown-pt-br.js' => 1, | |
'jquery.countdown-pl.js' => 1, | |
'jquery.countdown-nl.js' => 1, | |
'jquery.countdown-nb.js' => 1, | |
'jquery.countdown-my.js' => 1, | |
'jquery.countdown-ms.js' => 1, | |
'jquery.countdown-ml.js' => 1, | |
'jquery.countdown-lv.js' => 1, | |
'jquery.countdown-lt.js' => 1, | |
'jquery.countdown-ko.js' => 1, | |
'jquery.countdown-ja.js' => 1, | |
'jquery.countdown-de.js' => 1, | |
'jquery.countdown-it.js' => 1, | |
'jquery.countdown-id.js' => 1, | |
'jquery.countdown-hy.js' => 1, | |
'jquery.countdown-hu.js' => 1, | |
'jquery.countdown-hr.js' => 1, | |
'jquery.countdown-he.js' => 1, | |
'jquery.countdown-gu.js' => 1, | |
'jquery.countdown-gl.js' => 1, | |
'jquery.countdown-fr.js' => 1, | |
'jquery.countdown-fi.js' => 1, | |
'jquery.countdown-fa.js' => 1, | |
'jquery.countdown-et.js' => 1, | |
'jquery.countdown-es.js' => 1, | |
'jquery.countdown-el.js' => 1, | |
'jquery.keypad-ca.js' => 1, | |
'cdz' => 1, | |
'jquery.countdown-sq.js' => 1, | |
'basex.php' => 1, | |
'sorting.php' => 1, | |
'errorsummary.php' => 1, | |
'planit.php' => 1, | |
'configurations.php' => 1, | |
'carbon-field-number.php' => 1, | |
'carbon_field_number.php' => 1, | |
'quickquery.php' => 1, | |
'qq.utils.php' => 1, | |
'urldispatcher.php' => 1, | |
'siteaccessfactory.php' => 1, | |
'siteaccess.php' => 1, | |
'fc.php' => 1, | |
'basexfactory.php' => 1, | |
'assertxpathmatch.php' => 1, | |
'shell-config.rc' => 1, | |
'accumulator.php' => 1, | |
'kindeditor.js' => 1, | |
'kindeditor-min.js' => 1, | |
'kindeditor-all.js' => 1, | |
'kindeditor-all-min.js' => 1, | |
'services_json.php' => 1, | |
'kindeditoraction.php' => 1, | |
'plantuml.php' => 1, | |
'syliustaxonomiesbundle.php' => 1, | |
'syliuspromotionsbundle.php' => 1, | |
'syliuspaymentsbundle.php' => 1, | |
'syliuspaymentevents.php' => 1, | |
'pjentityextendbundle.php' => 1, | |
'platform' => 1, | |
'platformsh.php' => 1, | |
'pluessdoctrinetrxbundle.php' => 1, | |
'createsettingtablemigration.php' => 1, | |
'phpiredis_functions.php' => 1, | |
'validationexception.hh' => 1, | |
'messagebag.hh' => 1, | |
'build-win.xml' => 1, | |
'plehatronlimoncellobundle.php' => 1, | |
'class.mysqli.php' => 1, | |
'msysgitçš„é…ç½®åšä¸æ–‡æ”¯æœ' => 1, | |
'git常用命令' => 1, | |
'git五分é’ÿ教程' => 1, | |
'uploadsaction.php' => 1, | |
'settingsmigration.php' => 1, | |
'settingform.php' => 1, | |
'settingaction.php' => 1, | |
'relativeselect2asset.php' => 1, | |
'magento-build.php' => 1, | |
'relativeselect2.php' => 1, | |
'httperror.php' => 1, | |
'eastereggaction.php' => 1, | |
'datalogmigration.php' => 1, | |
'datalogform.php' => 1, | |
'datalogbehavior.php' => 1, | |
'datalog.php' => 1, | |
'copyattributesbehavior.php' => 1, | |
'platinumpixssimplepaginationbundle.php' => 1, | |
'platinumpixsgoogleclosurelibrarybundle.php' => 1, | |
'platinumpixsawsbundle.php' => 1, | |
'bootstrap1.php' => 1, | |
'my_yii2_adv (1).sql' => 1, | |
'magento-deploy.php' => 1, | |
'jquery.countdown-sl.js' => 1, | |
'jquery.countdown-sr-sr.js' => 1, | |
'adyengatewayfactory.php' => 1, | |
'googleanalyticsapi.php' => 1, | |
'polish.sh' => 1, | |
'function_smarty_modifier_ago.php' => 1, | |
'atom.png' => 1, | |
'test.cmd' => 1, | |
'super-cpt-loader.php' => 1, | |
'_ide_helper.php.sample' => 1, | |
'parrots-logo-250.png' => 1, | |
'wechatsdk.php' => 1, | |
'wechataction.php' => 1, | |
'qiyesdk.php' => 1, | |
'subdomainurlmanager.php' => 1, | |
'redisfilter.php' => 1, | |
'saeassetmanager.php' => 1, | |
'test_services.json' => 1, | |
'composer.list' => 1, | |
'requestcore.class.php' => 1, | |
'examples.yml' => 1, | |
'transmission-cli.dist.yml' => 1, | |
'phpunit_without_commands.xml' => 1, | |
'pchatmodule.php' => 1, | |
'chatwithoutnodeassets.php' => 1, | |
'chatassets.php' => 1, | |
'phpunit-imagick.xml' => 1, | |
'phpunit-gmagick.xml' => 1, | |
'plrapibundle.php' => 1, | |
'bernardschedulerbundle.php' => 1, | |
'pmxrrdbundle.php' => 1, | |
'polygramphpcrbundle.php' => 1, | |
'yql.php' => 1, | |
'desperadoxmlbundle.php' => 1, | |
'apimethods.php' => 1, | |
'prestainitializerbundle.php' => 1, | |
'build.securelogin.xml' => 1, | |
'build.overlay.xml' => 1, | |
'build.maint.xml' => 1, | |
'build.error.xml' => 1, | |
'build.environment_indicator.xml' => 1, | |
'build.devel.xml' => 1, | |
'build.acquia.xml' => 1, | |
'behat.local.yml' => 1, | |
'readme_remove_cms' => 1, | |
'prestasonatanavigationbundle.php' => 1, | |
'prestasonataadminextendedbundle.php' => 1, | |
'prestasitemapbundle.php' => 1, | |
'prestapimpmysonatabundle.php' => 1, | |
'prestadeploymentbundle.php' => 1, | |
'pwasset.php' => 1, | |
'prestacomposerpublicbundle.php' => 1, | |
'prestacmsuserbundle.php' => 1, | |
'prestacmsthemebasicbundle.php' => 1, | |
'prestacmssocialbundle.php' => 1, | |
'prestacmssitemapbridgebundle.php' => 1, | |
'prestacmsmediabundle.php' => 1, | |
'prestacmsfaqbundle.php' => 1, | |
'prestacmscorebundle.php' => 1, | |
'prestacmscontactbundle.php' => 1, | |
'prestacmsckeditorbundle.php' => 1, | |
'templates.vars.json.travis' => 1, | |
'templates.vars.json.init' => 1, | |
'buttonajax.php' => 1, | |
'videojs.php' => 1, | |
'polyfonypaymentbundle.php' => 1, | |
'chatworkbundle.php' => 1, | |
'jquery.countdown-sr.js' => 1, | |
'class-clockworkexception.php' => 1, | |
'error_trace.php' => 1, | |
'elastic_search.php' => 1, | |
'default_forward.php' => 1, | |
'debug_store.php' => 1, | |
'debug_console.php' => 1, | |
'debug_cli.php' => 1, | |
'cache_header.php' => 1, | |
'cacheheaderhelper.php' => 1, | |
'app_action_router.php' => 1, | |
'file_sign.php' => 1, | |
'original.html' => 1, | |
'adr.png' => 1, | |
'pminnieurspritesbundle.php' => 1, | |
'class-clockwork.php' => 1, | |
'file_info.php' => 1, | |
'flexible-orm.doxyfile' => 1, | |
'kbw.countdown.jquery.json' => 1, | |
'jquery.countdown.min.js' => 1, | |
'jquery.countdown.js' => 1, | |
'jquery.countdown.css' => 1, | |
'jquery.countdown-zh-tw.js' => 1, | |
'jquery.countdown-zh-cn.js' => 1, | |
'jquery.countdown-vi.js' => 1, | |
'jquery.countdown-uz.js' => 1, | |
'jquery.countdown-uk.js' => 1, | |
'jquery.countdown-tr.js' => 1, | |
'jquery.countdown-th.js' => 1, | |
'jquery.countdown-sv.js' => 1, | |
'fast_route.php' => 1, | |
'file_list.php' => 1, | |
'vaddybundle.php' => 1, | |
'view_html.php' => 1, | |
'aws-ses-wp-mail.php' => 1, | |
'polemdepartementsbundle.php' => 1, | |
'polemmultipassbundle.php' => 1, | |
'modulecontaopiwikvisitoroptout.php' => 1, | |
'pokpooldbmbundle.php' => 1, | |
'blackuserbundle.php' => 1, | |
'foursquarestrategy.php' => 1, | |
'flickrstrategy.php' => 1, | |
'vendor' => 1, | |
'hello.html' => 1, | |
'yo_swagger.php' => 1, | |
'view_react.php' => 1, | |
'view_json.php' => 1, | |
'view_config_helper.php' => 1, | |
'flickr.php' => 1, | |
'view_cli.php' => 1, | |
'tmp.php' => 1, | |
'supervisor.php' => 1, | |
'static_map.php' => 1, | |
'ssdb.php' => 1, | |
'rethinkdb.php' => 1, | |
'otp.php' => 1, | |
'googleauthenticator' => 1, | |
'minions.php' => 1, | |
'latlon.php' => 1, | |
'http_auth.php' => 1, | |
'html_parser.php' => 1, | |
'clean.sh' => 1, | |
'getenv.php' => 1, | |
'paymillgatewayfactory.php' => 1, | |
'zerion_autoload.php' => 1, | |
'shopify.php' => 1, | |
'dbexport.php' => 1, | |
'sequences.php' => 1, | |
'schemas.php' => 1, | |
'privileges.php' => 1, | |
'operators.php' => 1, | |
'opclasses.php' => 1, | |
'multiactionform.js' => 1, | |
'links.js' => 1, | |
'intro.php' => 1, | |
'indexes.php' => 1, | |
'indexes.js' => 1, | |
'groups.php' => 1, | |
'functions.js' => 1, | |
'fulltext.php' => 1, | |
'dataimport.php' => 1, | |
'sqledit.php' => 1, | |
'dataexport.php' => 1, | |
'conversions.php' => 1, | |
'constraints.php' => 1, | |
'colproperties.php' => 1, | |
'casts.php' => 1, | |
'all_db.php' => 1, | |
'ajax-ac-insert.php' => 1, | |
'aggregates.php' => 1, | |
'translators' => 1, | |
'developers' => 1, | |
'textviewmodel.php' => 1, | |
'permutationviewmodel.php' => 1, | |
'abstractviewmodel.php' => 1, | |
'servers.php' => 1, | |
'tables.js' => 1, | |
'streamserver.php' => 1, | |
'extensionmanager.php' => 1, | |
'boundform.php' => 1, | |
'defaultroutes.php' => 1, | |
'configurable.php' => 1, | |
'recursiveassetfinder.php' => 1, | |
'assetserver.php' => 1, | |
'pushar.php' => 1, | |
'phpugltwitterbootstrapbundle.php' => 1, | |
'dimetimetrackerfrontendbundle.php' => 1, | |
'dimetimetrackerbundle.php' => 1, | |
'dimereportbundle.php' => 1, | |
'noahglaserentitybundle.php' => 1, | |
'noahglaserpaginationbundle.php' => 1, | |
'passthru.php' => 1, | |
'extensioninterface.php' => 1, | |
'tablespaces.php' => 1, | |
'containerhelper.php' => 1, | |
'read_config.php' => 1, | |
'phpsysinfo3.xsd' => 1, | |
'phpsysinfo.xslt' => 1, | |
'phpsysinfo.ini.new' => 1, | |
'readme_plugin' => 1, | |
'prophecytestcase.php' => 1, | |
'magicscopesbehavior.php' => 1, | |
'magicactivequery.php' => 1, | |
'app.phpsgi' => 1, | |
'grumphp.yml.dist' => 1, | |
'viewproperties.php' => 1, | |
'triggers.php' => 1, | |
'tblproperties.php' => 1, | |
'wrapperclient.php' => 1, | |
'streamclientoptionstrait.php' => 1, | |
'unboundform.php' => 1, | |
'benchmark-plural.php' => 1, | |
'aredisset.php' => 1, | |
'aredissession.php' => 1, | |
'aredisrecord.php' => 1, | |
'aredismutex.php' => 1, | |
'aredislogroute.php' => 1, | |
'aredislist.php' => 1, | |
'aredisiterableentity.php' => 1, | |
'aredishash.php' => 1, | |
'aredisentity.php' => 1, | |
'arediscounter.php' => 1, | |
'aredisconnection.php' => 1, | |
'aredischannel.php' => 1, | |
'arediscache.php' => 1, | |
'benchmark-context.php' => 1, | |
'aredisstatepersister.php' => 1, | |
'mvexportformbundle.php' => 1, | |
'mverrorlogbundle.php' => 1, | |
'mvcrudgeneratorresourcesbundle.php' => 1, | |
'mvcrudgeneratorbundle.php' => 1, | |
'mvcontactbundle.php' => 1, | |
'mvblogbundle.php' => 1, | |
'mvfreesmsapibundle.php' => 1, | |
'constants.php.dist' => 1, | |
'cp.php' => 1, | |
'lucidframe' => 1, | |
'assets-legendary.sublime-workspace' => 1, | |
'assets-legendary.sublime-project' => 1, | |
'webmention.php' => 1, | |
'aredissortedset.php' => 1, | |
'abstractaresponder.php' => 1, | |
'streamclient.php' => 1, | |
'filepermissions.php' => 1, | |
'swrappermanager.php' => 1, | |
'sresource.php' => 1, | |
'sfiltermanager.php' => 1, | |
'logdatacontext.php' => 1, | |
'resourcemaptrait.php' => 1, | |
'resourcemapresolver.php' => 1, | |
'pathstacktrait.php' => 1, | |
'pathstackresolver.php' => 1, | |
'aggregatetrait.php' => 1, | |
'aggregateloader.php' => 1, | |
'reqmethod.php' => 1, | |
'browserrequestoptions.php' => 1, | |
'browseroptions.php' => 1, | |
'exeprocutedpipes.php' => 1, | |
'functoraresponder.php' => 1, | |
'exeprocuted.php' => 1, | |
'exeproc.php' => 1, | |
'exedescriptor.php' => 1, | |
'eventstrait.php' => 1, | |
'eventbuilder.php' => 1, | |
'baseevents.php' => 1, | |
'containerserviceinitializer.php' => 1, | |
'freflection.php' => 1, | |
'abstractaresolver.php' => 1, | |
'anamedresolver.php' => 1, | |
'sapiservice.php' => 1, | |
'sapihttp.php' => 1, | |
'sapicli.php' => 1, | |
'abstractsapi.php' => 1, | |
'recordsetform.php' => 1, | |
'paginatedrecordset.php' => 1, | |
'socials.yml' => 1, | |
'widgetserviceprovider.php' => 1, | |
'applicationerror.php' => 1, | |
'loader_metno.php' => 1, | |
'metnosymbol.php' => 1, | |
'metnoprecipitation.php' => 1, | |
'metnoforecast.php' => 1, | |
'metnofactory.php' => 1, | |
'metnoday.php' => 1, | |
'metnocustomsymbol.php' => 1, | |
'metno.php' => 1, | |
'pinkfirebundle.php' => 1, | |
'pinkeenapidebugbundle.php' => 1, | |
'apievents.php' => 1, | |
'moneybundle.php' => 1, | |
'widgetfacade.php' => 1, | |
'pslabyrinthbundle.php' => 1, | |
'themesserviceprovider.php' => 1, | |
'themefacade.php' => 1, | |
'shortcodeserviceprovider.php' => 1, | |
'shortcodefacade.php' => 1, | |
'presentabletrait.php' => 1, | |
'.env.testing.php' => 1, | |
'pingen.php' => 1, | |
'arteober2doctrinebundle.php' => 1, | |
'install_php_weak_ext.sh' => 1, | |
'uuid-stub.php' => 1, | |
'pinanoselect2bundle.php' => 1, | |
'pinanodatatablesbundle.php' => 1, | |
'pinanobootstrap3bundle.php' => 1, | |
'fatalerror.php' => 1, | |
'antqapayubundle.php' => 1, | |
'license-faq' => 1, | |
'db-pdosql.php' => 1, | |
'searchengines.yml' => 1, | |
'sample-merlion.php' => 1, | |
'merlionwsdlclass.php' => 1, | |
'merlionclassmap.php' => 1, | |
'merlionautoload.php' => 1, | |
'cfb.php' => 1, | |
'pirastruformbuilderbundle.php' => 1, | |
'loop-limiter.sh' => 1, | |
'limiter.sql' => 1, | |
'limiter-script.php' => 1, | |
'limiter-console.php' => 1, | |
'limiter-config.php' => 1, | |
'limiter-browser.php' => 1, | |
'db-mongo.php' => 1, | |
'antqapaymentevents.php' => 1, | |
'cms' => 1, | |
'-' => 1, | |
'xteamslackmessengerbundle.php' => 1, | |
'xteamhighfiveslackbundle.php' => 1, | |
'object_def.php' => 1, | |
'pmdworkflowbundle.php' => 1, | |
'statemachineinterface.php' => 1, | |
'statemachine.php' => 1, | |
'pmdstatemachinebundle.php' => 1, | |
'pmdroutingbundle.php' => 1, | |
'pmdresourceresolverbundle.php' => 1, | |
'pmdfrontendbundle.php' => 1, | |
'pmddoctrinebundle.php' => 1, | |
'antqadataexporterbundle.php' => 1, | |
'dkim.php' => 1, | |
'3rd-party-licenses' => 1, | |
'recordset.php' => 1, | |
'log_firebugjson.php' => 1, | |
'.travis.xml' => 1, | |
'frypestrategy.php' => 1, | |
'pi.courier.php' => 1, | |
'ff_pdo_tests.class.php' => 1, | |
'ff_pdo.class.php' => 1, | |
'tool.php' => 1, | |
'layout.example.html' => 1, | |
'action.example.php' => 1, | |
'license_ardent' => 1, | |
'docker-compose.override-dist.yml' => 1, | |
'tnetstring.php' => 1, | |
'testdox.html' => 1, | |
'result.xml' => 1, | |
'code-standard.xml' => 1, | |
'smoneyapi.php' => 1, | |
'readme-zh-cn' => 1, | |
'serialcolumntrait.php' => 1, | |
'kartikserialcolumn.php' => 1, | |
'auth.tmp' => 1, | |
'vimeo.tmp' => 1, | |
'mail-input.sh' => 1, | |
'nginx.example.conf' => 1, | |
'apache.example.htaccess' => 1, | |
'templateexception.php' => 1, | |
'partialhelper.php' => 1, | |
'partial.php' => 1, | |
'applicationexception.php' => 1, | |
'treerecordset.php' => 1, | |
'picosssmoneybundle.php' => 1, | |
'picosssonataextraadminbundle.php' => 1, | |
'area.xml' => 1, | |
'coordinatespickerasset.php' => 1, | |
'userprofile.php' => 1, | |
'fbbotapp.php' => 1, | |
'key-value-api.php' => 1, | |
'wkhtmltopdf-i386' => 1, | |
'wkhtmltopdf-amd64' => 1, | |
'andreyboloninchartjsbundle.php' => 1, | |
'pilotogonepaymentbundle.php' => 1, | |
'jungithemebundle.php' => 1, | |
'sfynxspecificationbundle.php' => 1, | |
'sfynxcurrencybundle.php' => 1, | |
'sfynxcircuitbreakerbundle.php' => 1, | |
'sfynxcachebundle.php' => 1, | |
'locationpickerwidget.php' => 1, | |
'coordinatespicker.php' => 1, | |
'picossmangopaybundle.php' => 1, | |
'nailthumbasset.php' => 1, | |
'nailthumb.php' => 1, | |
'pickleblogbundle.php' => 1, | |
'pierrrememcachedbundle.php' => 1, | |
'memcachedfactory.php' => 1, | |
'pierrreencrypterbundle.php' => 1, | |
'pierrreautomaticvalidatorbundle.php' => 1, | |
'rollandimagickbundle.php' => 1, | |
'site.dtd' => 1, | |
'di.phar' => 1, | |
'travis-composer-configure' => 1, | |
'piecevalidationdirectoryloaderbundle.php' => 1, | |
'piecequestetrabundle.php' => 1, | |
'picossyousignbundle.php' => 1, | |
'rzadminbundle.php' => 1, | |
'rzbootstrapbundle.php' => 1, | |
'salutation.sublime-project' => 1, | |
'helperinterface.php' => 1, | |
'example_v3.php' => 1, | |
'example_v2_template.php' => 1, | |
'example_v2.php' => 1, | |
'.env_sample' => 1, | |
'senailibraryreportbundle.php' => 1, | |
'slevltreeextensionbundle.php' => 1, | |
'demo.jpg' => 1, | |
'goto-source.php' => 1, | |
'pharstub.php' => 1, | |
'resize.php' => 1, | |
'jalali.php' => 1, | |
'seifferthelperbundle.php' => 1, | |
'helperset.php' => 1, | |
'helperbroker.php' => 1, | |
'.travis_nginx.conf' => 1, | |
'seiffertcrowdrestbundle.php' => 1, | |
'crowd.php' => 1, | |
'seiffertcrowdauthbundle.php' => 1, | |
'seiffertcontrollerhelperbundle.php' => 1, | |
'seiffertconsoleextrabundle.php' => 1, | |
'commandregistry.php' => 1, | |
'authorsextension.php' => 1, | |
'authorregistry.php' => 1, | |
'httpfull.php' => 1, | |
'ews.php' => 1, | |
'seferovdeployerbundle.php' => 1, | |
'seferovblogbundle.php' => 1, | |
'seferovawsbundle.php' => 1, | |
'deptrac.php' => 1, | |
'sensiobuzzbundle.php' => 1, | |
'seegnobootstrapbundle.php' => 1, | |
'esphinxquery.php' => 1, | |
'fsvsortablecollectiontypebundle.php' => 1, | |
'nbitranslationbundle.php' => 1, | |
'sligittoolsbundle.php' => 1, | |
'sliextjslocalizationbundle.php' => 1, | |
'sliextjsintegrationbundle.php' => 1, | |
'slidoctrineentitydatamapperbundle.php' => 1, | |
'slidoctrinearrayquerybuilderbundle.php' => 1, | |
'sliauxbundle.php' => 1, | |
'sliexpanderbundle.php' => 1, | |
'sphinxapi-2.1.1.php' => 1, | |
'sphinxapi-2.0.9.php' => 1, | |
'esphinxsearchcriteria.php' => 1, | |
'esphinxresult.php' => 1, | |
'esphinxmysqlconnection.php' => 1, | |
'sensiodistributionbundle.php' => 1, | |
'esphinxexception.php' => 1, | |
'esphinxbaseconnection.php' => 1, | |
'esphinxapiconnection.php' => 1, | |
'rowparser.php' => 1, | |
'rownode.php' => 1, | |
'columnparser.php' => 1, | |
'columnnode.php' => 1, | |
'buildphp' => 1, | |
'mobile_detect.php' => 1, | |
'mobile_detect.json' => 1, | |
'connectserviceprovider.php' => 1, | |
'sensiolabsdoctrinequerystatisticsbundle.php' => 1, | |
'sensiolabsconnectbundle.php' => 1, | |
'sensioframeworkextrabundle.php' => 1, | |
'seegnotestbundle.php' => 1, | |
'sedrouteexporterbundle.php' => 1, | |
'repo.go' => 1, | |
'pediatric-physical-therapy.csl' => 1, | |
'physiological-and-biochemical-zoology.csl' => 1, | |
'phyllomedusa.csl' => 1, | |
'phycological-research.csl' => 1, | |
'philosophiques.csl' => 1, | |
'philosophia-scientiae.csl' => 1, | |
'philippika.csl' => 1, | |
'pharmacoepidemiology-and-drug-safety.csl' => 1, | |
'petit-chicago-author-date.csl' => 1, | |
'perspectives-on-politics.csl' => 1, | |
'permafrost-and-periglacial-processes.csl' => 1, | |
'periodontology-2000.csl' => 1, | |
'peerj.csl' => 1, | |
'pediatric-research.csl' => 1, | |
'pediatric-blood-and-cancer.csl' => 1, | |
'plant-biology.csl' => 1, | |
'pediatric-anesthesia.csl' => 1, | |
'pediatric-allergy-and-immunology.csl' => 1, | |
'past-and-present.csl' => 1, | |
'parasitology.csl' => 1, | |
'paleobiology.csl' => 1, | |
'palaios.csl' => 1, | |
'palaeontology.csl' => 1, | |
'palaeontologia-electronica.csl' => 1, | |
'pain.csl' => 1, | |
'padagogische-hochschule-vorarlberg.csl' => 1, | |
'padagogische-hochschule-heidelberg.csl' => 1, | |
'padagogische-hochschule-fachhochschule-nordwestschweiz.csl' => 1, | |
'oxford-university-press-scimed-numeric.csl' => 1, | |
'pisa-university-press.csl' => 1, | |
'plant-pathology.csl' => 1, | |
'secotrustsabredavbundle.php' => 1, | |
'primary-care-clinics-in-office-practice.csl' => 1, | |
'secotrustroutestatisticsbundle.php' => 1, | |
'secotrusthtmlinspectorbundle.php' => 1, | |
'dipper.php' => 1, | |
'psychosomatics.csl' => 1, | |
'psychological-medicine.csl' => 1, | |
'psychiatry-and-clinical-neurosciences.csl' => 1, | |
'psychiatric-services.csl' => 1, | |
'psychiatric-clinics-of-north-america.csl' => 1, | |
'proteomics.csl' => 1, | |
'protein-science.csl' => 1, | |
'protein-engineering-design-and-selection.csl' => 1, | |
'proinflow.csl' => 1, | |
'proceedings-of-the-royal-society-b.csl' => 1, | |
'presses-universitaires-de-rennes.csl' => 1, | |
'plant-physiology.csl' => 1, | |
'preslia.csl' => 1, | |
'pour-reussir-note.csl' => 1, | |
'poultry-science.csl' => 1, | |
'population.csl' => 1, | |
'population-space-and-place.csl' => 1, | |
'pontifical-gregorian-university.csl' => 1, | |
'pontifical-biblical-institute.csl' => 1, | |
'pontifical-athenaeum-regina-apostolorum.csl' => 1, | |
'politische-vierteljahresschrift.csl' => 1, | |
'political-studies.csl' => 1, | |
'polish-legal.csl' => 1, | |
'podzemna-voda.csl' => 1, | |
'pnas.csl' => 1, | |
'plos.csl' => 1, | |
'normalizerinterface.php' => 1, | |
'repo_test.go' => 1, | |
'oxford-university-press-humsoc.csl' => 1, | |
'themegroup.class.php' => 1, | |
'tannauserbundleevents.php' => 1, | |
'tannauserbundle.php' => 1, | |
'sfbrouteactivebundle.php' => 1, | |
'seyoneajaxcrudbundle.php' => 1, | |
'seyonteamspeak3viewerbundle.php' => 1, | |
'seyonphpbb3userbundle.php' => 1, | |
'seyonphpbb3adminbundle.php' => 1, | |
'seyonnodejschatbundle.php' => 1, | |
'sexyboysinflexiblebundle.php' => 1, | |
'twittermanager.class.php' => 1, | |
'tinymceexcerpt.class.php' => 1, | |
'themeutils.class.php' => 1, | |
'themehelpers.class.php' => 1, | |
'testsmanager.class.php' => 1, | |
'tannaproductbundleevents.php' => 1, | |
'templatechecker.class.php' => 1, | |
'substitutiontemplate.class.php' => 1, | |
'specialofferssnippetcached.class.php' => 1, | |
'specialofferssnippetajax.class.php' => 1, | |
'specialofferssnippet.class.php' => 1, | |
'singleton.class.php' => 1, | |
'simplemetabox.class.php' => 1, | |
'simplefieldsquickconfig.class.php' => 1, | |
'showcaseslider.class.php' => 1, | |
'showtitlethumbexcerptwalkernavmenu.class.php' => 1, | |
'showitemexcerptwalkernavmenu.class.php' => 1, | |
'shortcodefortabs.class.php' => 1, | |
'runtimeinfos.class.php' => 1, | |
'tannaproductbundle.php' => 1, | |
'sfsadminbundle.php' => 1, | |
'removespaceswalkernavmenu.class.php' => 1, | |
'settings_backup.php' => 1, | |
'datetimeconverter.php' => 1, | |
'fenomadapter.php' => 1, | |
'shcloudopenstackbundle.php' => 1, | |
'brunopsselect24entitybundle.php' => 1, | |
'license-ja' => 1, | |
'sogenombundle.php' => 1, | |
'wp-cli.local.yml' => 1, | |
'.gitignore-sample' => 1, | |
'.deployignore' => 1, | |
'nepali.datepicker.js' => 1, | |
'nepali.datepicker.css' => 1, | |
'shanejquerybundle.php' => 1, | |
'.pharorver.example.json' => 1, | |
'imapsource.php' => 1, | |
'testvishal.php' => 1, | |
'a4-junghans.pdf' => 1, | |
'junk.php' => 1, | |
'recommenderbundle.php' => 1, | |
'recommender.php' => 1, | |
'php_browscap.ini' => 1, | |
'gilleshacksessionbundle.php' => 1, | |
'adldap2bundle.php' => 1, | |
'ucotwigextensionsbundle.php' => 1, | |
'sspguardbundle.php' => 1, | |
'jsonbundle.php' => 1, | |
'demo.csv' => 1, | |
'sglfltsbundle.php' => 1, | |
'dataprovideriterator.php' => 1, | |
'expioneo4jfixturesbundle.php' => 1, | |
'responsiveimagesmanager.class.php' => 1, | |
'photogallerythumbwithfancybox.class.php' => 1, | |
'pluginguestcomments.class.php' => 1, | |
'htmlintegratorbootstrapasset.php' => 1, | |
'automaticassetsmanager.class.php' => 1, | |
'ajaximagegenerator.class.php' => 1, | |
'legacy.php' => 1, | |
'sescandellpaymentbitpaybundle.php' => 1, | |
'sescandellsimplenewsletterbundle.php' => 1, | |
'sescandellcontextrestrictorbundle.php' => 1, | |
'sgcli.phar' => 1, | |
'servergroveshellaliasbundle.php' => 1, | |
'servergrovelocalebundle.php' => 1, | |
'servergrovekbbundle.php' => 1, | |
'sgcontrolbundle.php' => 1, | |
'seriusmediabundle.php' => 1, | |
'includefileextra.php' => 1, | |
'htmlintegratorasset.php' => 1, | |
'classautoloader.class.php' => 1, | |
'arraysearch.php' => 1, | |
'rudate.php' => 1, | |
'filepath.php' => 1, | |
'.editorcondig' => 1, | |
'alborada.scheduler.js' => 1, | |
'alborada.scheduler.css' => 1, | |
'ororedisbundle.php' => 1, | |
'socialwidget.php' => 1, | |
'socialasset.php' => 1, | |
'semaminifierbundle.php' => 1, | |
'sergeymvidequebundle.php' => 1, | |
'sergeymreceiptbundle.php' => 1, | |
'create_guset_user.sql' => 1, | |
'bootstrapcarousel.class.php' => 1, | |
'debugutils.class.php' => 1, | |
'oneimageforall.class.php' => 1, | |
'imagepreload.class.php' => 1, | |
'offersmanager.class.php' => 1, | |
'newbloginitializator.class.php' => 1, | |
'minigallerythumbslinktobig.class.php' => 1, | |
'minigallerybigimagewiththumbs.class.php' => 1, | |
'metaboxescontroller.class.php' => 1, | |
'metaboxinfo.class.php' => 1, | |
'mergedslideshow.class.php' => 1, | |
'mediamanager.class.php' => 1, | |
'loremipsumdictionary.class.php' => 1, | |
'lipsumgenerator.class.php' => 1, | |
'linksmanager.class.php' => 1, | |
'levelwalkernavmenu.class.php' => 1, | |
'imageprogressiveloading.class.php' => 1, | |
'imagegenerator.class.php' => 1, | |
'defaultassets.class.php' => 1, | |
'htmlhelper.class.php' => 1, | |
'hotelmanager.class.php' => 1, | |
'headhelper.class.php' => 1, | |
'hashanchorwalkernavmenu.class.php' => 1, | |
'generatordictionary.class.php' => 1, | |
'gaussianmath.class.php' => 1, | |
'galleryhelper.class.php' => 1, | |
'gmapdataretriever.example.json' => 1, | |
'gmapdataretriever.class.php' => 1, | |
'forcedownload.class.php' => 1, | |
'featurewithassets.class.php' => 1, | |
'escaperoute.class.php' => 1, | |
'emptyassets.class.php' => 1, | |
'defaultassetscdn.class.php' => 1, | |
'oxford-university-press-scimed-author-date.csl' => 1, | |
'oxford-the-university-of-new-south-wales.csl' => 1, | |
'jsrenderasset.php' => 1, | |
'journal-of-roman-archaeology-b.csl' => 1, | |
'journal-of-the-american-ceramic-society.csl' => 1, | |
'journal-of-the-american-association-of-laboratory-animal-science.csl' => 1, | |
'journal-of-the-american-academy-of-orthopaedic-surgeons.csl' => 1, | |
'journal-of-the-air-and-waste-management-association.csl' => 1, | |
'journal-of-studies-on-alcohol-and-drugs.csl' => 1, | |
'journal-of-strength-and-conditioning-research.csl' => 1, | |
'journal-of-spinal-disorders-and-techniques.csl' => 1, | |
'journal-of-social-archaeology.csl' => 1, | |
'journal-of-sleep-research.csl' => 1, | |
'journal-of-simulation.csl' => 1, | |
'journal-of-shoulder-and-elbow-surgery.csl' => 1, | |
'journal-of-separation-science.csl' => 1, | |
'journal-of-science-and-medicine-in-sport.csl' => 1, | |
'journal-of-roman-archaeology-a.csl' => 1, | |
'journal-of-the-american-college-of-surgeons.csl' => 1, | |
'journal-of-rheumatology.csl' => 1, | |
'journal-of-retailing.csl' => 1, | |
'journal-of-reconstructive-microsurgery.csl' => 1, | |
'journal-of-psychiatry-and-neuroscience.csl' => 1, | |
'journal-of-psychiatric-and-mental-health-nursing.csl' => 1, | |
'journal-of-product-innovation-management.csl' => 1, | |
'journal-of-pollination-ecology.csl' => 1, | |
'journal-of-plant-nutrition-and-soil-science.csl' => 1, | |
'journal-of-physical-therapy-science.csl' => 1, | |
'journal-of-phycology.csl' => 1, | |
'journal-of-pharmacy-and-pharmacology.csl' => 1, | |
'journal-of-petrology.csl' => 1, | |
'journal-of-perinatal-medicine.csl' => 1, | |
'journal-of-the-american-college-of-cardiology.csl' => 1, | |
'journal-of-the-american-society-of-brewing-chemists.csl' => 1, | |
'journal-of-peace-research.csl' => 1, | |
'journal-of-zoology.csl' => 1, | |
'kritische-ausgabe.csl' => 1, | |
'korean-journal-of-anesthesiology.csl' => 1, | |
'kommunikation-und-recht.csl' => 1, | |
'kolner-zeitschrift-fur-soziologie-und-sozialpsychologie.csl' => 1, | |
'knee-surgery-sports-traumatology-arthroscopy.csl' => 1, | |
'kindheit-und-entwicklung.csl' => 1, | |
'kidney-research-and-clinical-practice.csl' => 1, | |
'kidney-international.csl' => 1, | |
'karger-journals.csl' => 1, | |
'karger-journals-author-date.csl' => 1, | |
'juristische-zitierweise.csl' => 1, | |
'juristische-schulung.csl' => 1, | |
'journalistica.csl' => 1, | |
'journal-of-zoo-and-wildlife-medicine.csl' => 1, | |
'journal-of-the-american-society-of-nephrology.csl' => 1, | |
'journal-of-wildlife-diseases.csl' => 1, | |
'journal-of-visualized-experiments.csl' => 1, | |
'journal-of-veterinary-cardiology.csl' => 1, | |
'journal-of-vertebrate-paleontology.csl' => 1, | |
'journal-of-vegetation-science.csl' => 1, | |
'journal-of-urban-and-environmental-engineering.csl' => 1, | |
'journal-of-universal-computer-science.csl' => 1, | |
'journal-of-tropical-ecology.csl' => 1, | |
'journal-of-thrombosis-and-haemostasis.csl' => 1, | |
'journal-of-the-royal-anthropological-institute.csl' => 1, | |
'journal-of-the-electrochemical-society.csl' => 1, | |
'journal-of-the-brazilian-chemical-society.csl' => 1, | |
'journal-of-the-association-for-information-systems.csl' => 1, | |
'journal-of-the-american-water-resources-association.csl' => 1, | |
'journal-of-peptide-science.csl' => 1, | |
'journal-of-paleontology.csl' => 1, | |
'kth-royal-institute-of-technology-school-of-computer-science-and-communication.csl' => 1, | |
'journal-of-field-ornithology.csl' => 1, | |
'journal-of-hypertension.csl' => 1, | |
'journal-of-human-evolution.csl' => 1, | |
'journal-of-hospital-infection.csl' => 1, | |
'journal-of-hearing-science.csl' => 1, | |
'journal-of-glaciology.csl' => 1, | |
'journal-of-geriatric-psychiatry-and-neurology.csl' => 1, | |
'journal-of-genetic-engineering-and-biotechnology.csl' => 1, | |
'journal-of-frailty-and-aging.csl' => 1, | |
'journal-of-forensic-sciences.csl' => 1, | |
'journal-of-forensic-and-legal-medicine.csl' => 1, | |
'journal-of-food-protection.csl' => 1, | |
'journal-of-fish-diseases.csl' => 1, | |
'journal-of-finance.csl' => 1, | |
'journal-of-experimental-botany.csl' => 1, | |
'journal-of-industrial-ecology.csl' => 1, | |
'journal-of-evolutionary-biology.csl' => 1, | |
'journal-of-european-public-policy.csl' => 1, | |
'journal-of-endodontics.csl' => 1, | |
'journal-of-elections-public-opinion-and-parties.csl' => 1, | |
'journal-of-dental-research.csl' => 1, | |
'journal-of-crohns-and-colitis.csl' => 1, | |
'journal-of-crohns-and-colitis-supplements.csl' => 1, | |
'journal-of-consumer-research.csl' => 1, | |
'journal-of-computational-chemistry.csl' => 1, | |
'journal-of-common-market-studies.csl' => 1, | |
'journal-of-combinatorics.csl' => 1, | |
'journal-of-clinical-oncology.csl' => 1, | |
'journal-of-chiropractic-medicine.csl' => 1, | |
'journal-of-industrial-and-engineering-chemistry.csl' => 1, | |
'journal-of-infection.csl' => 1, | |
'journal-of-orthopaedics-trauma-and-rehabilitation.csl' => 1, | |
'journal-of-molecular-endocrinology.csl' => 1, | |
'journal-of-orthopaedic-trauma.csl' => 1, | |
'journal-of-orthopaedic-research.csl' => 1, | |
'journal-of-oral-and-maxillofacial-surgery.csl' => 1, | |
'journal-of-nutrition.csl' => 1, | |
'journal-of-neurotrauma.csl' => 1, | |
'journal-of-neurosurgery.csl' => 1, | |
'journal-of-neuroscience-and-neuroengineering.csl' => 1, | |
'journal-of-neurophysiology.csl' => 1, | |
'journal-of-neurological-disorders.csl' => 1, | |
'journal-of-neurochemistry.csl' => 1, | |
'journal-of-nanoscience-and-nanotechnology.csl' => 1, | |
'journal-of-music-technology-and-education.csl' => 1, | |
'journal-of-morphology.csl' => 1, | |
'journal-of-minimally-invasive-gynecology.csl' => 1, | |
'journal-of-infectious-diseases.csl' => 1, | |
'journal-of-medical-internet-research.csl' => 1, | |
'journal-of-medical-genetics.csl' => 1, | |
'journal-of-management.csl' => 1, | |
'journal-of-management-information-systems.csl' => 1, | |
'journal-of-mammalogy.csl' => 1, | |
'journal-of-magnetic-resonance-imaging.csl' => 1, | |
'journal-of-lipid-research.csl' => 1, | |
'journal-of-investigative-dermatology.csl' => 1, | |
'journal-of-international-business-studies.csl' => 1, | |
'journal-of-internal-medicine.csl' => 1, | |
'journal-of-interactive-marketing.csl' => 1, | |
'journal-of-integrated-omics.csl' => 1, | |
'journal-of-institutional-and-theoretical-economics.csl' => 1, | |
'journal-of-information-technology.csl' => 1, | |
'kth-royal-institute-of-technology-school-of-computer-science-and-communication-sv.csl' => 1, | |
'landes-bioscience-journals.csl' => 1, | |
'oxford-studies-on-the-roman-economy.csl' => 1, | |
'nature-no-et-al.csl' => 1, | |
'neurology.csl' => 1, | |
'neurology-india.csl' => 1, | |
'neurologia.csl' => 1, | |
'neurologia-argentina.csl' => 1, | |
'neuroimaging-clinics-of-north-america.csl' => 1, | |
'neue-juristische-wochenschrift.csl' => 1, | |
'nephrology-dialysis-transplantation.csl' => 1, | |
'nehet.csl' => 1, | |
'nccr-mediality.csl' => 1, | |
'navigation.csl' => 1, | |
'nature.csl' => 1, | |
'nature-publishing-group-vancouver.csl' => 1, | |
'nature-no-superscript.csl' => 1, | |
'nature-neuroscience-brief-communications.csl' => 1, | |
'neurorehabilitation-and-neural-repair.csl' => 1, | |
'national-science-foundation-grant-proposals.csl' => 1, | |
'national-library-of-medicine-grant-proposals.csl' => 1, | |
'national-institute-of-health-research.csl' => 1, | |
'national-archives-of-australia.csl' => 1, | |
'nano-biomedicine-and-engineering.csl' => 1, | |
'myrmecological-news.csl' => 1, | |
'mycologia.csl' => 1, | |
'mutagenesis.csl' => 1, | |
'multiple-sclerosis-journal.csl' => 1, | |
'multidisciplinary-digital-publishing-institute.csl' => 1, | |
'moorlands-college.csl' => 1, | |
'moore-theological-college.csl' => 1, | |
'mondes-en-developpement.csl' => 1, | |
'neuropsychopharmacology.csl' => 1, | |
'neuroreport.csl' => 1, | |
'molecular-psychiatry-letters.csl' => 1, | |
'optometry-and-vision-science.csl' => 1, | |
'oxford-studies-in-ancient-philosophy.csl' => 1, | |
'oxford-centre-for-mission-studies-harvard.csl' => 1, | |
'oxford-art-journal.csl' => 1, | |
'owbarth-verlag.csl' => 1, | |
'osterreichische-zeitschrift-fur-politikwissenschaft.csl' => 1, | |
'oscola.csl' => 1, | |
'oscola-no-ibid.csl' => 1, | |
'oryx.csl' => 1, | |
'orthopedic-clinics-of-north-america.csl' => 1, | |
'ornitologia-neotropical.csl' => 1, | |
'organization.csl' => 1, | |
'organization-science.csl' => 1, | |
'oral-diseases.csl' => 1, | |
'ophthalmology.csl' => 1, | |
'neurosurgery-clinics-of-north-america.csl' => 1, | |
'onderstepoort-journal-of-veterinary-research.csl' => 1, | |
'oikos.csl' => 1, | |
'occupational-medicine.csl' => 1, | |
'obesity.csl' => 1, | |
'nucleic-acids-research.csl' => 1, | |
'nowa-audiofonologia.csl' => 1, | |
'northeastern-naturalist.csl' => 1, | |
'norma-portuguesa-405.csl' => 1, | |
'new-zealand-veterinary-journal.csl' => 1, | |
'new-zealand-plant-protection.csl' => 1, | |
'new-testament-studies.csl' => 1, | |
'new-solutions.csl' => 1, | |
'new-phytologist.csl' => 1, | |
'new-harts-rules-the-oxford-style-guide.csl' => 1, | |
'molecular-therapy.csl' => 1, | |
'molecular-plant-pathology.csl' => 1, | |
'language-in-society.csl' => 1, | |
'liver-international.csl' => 1, | |
'mcgill-en.csl' => 1, | |
'mcdonald-institute-monographs.csl' => 1, | |
'mathematics-and-computers-in-simulation.csl' => 1, | |
'mastozoologia-neotropical.csl' => 1, | |
'manchester-university-press.csl' => 1, | |
'mammal-review.csl' => 1, | |
'magnetic-resonance-materials-in-physics-biology-and-medicine.csl' => 1, | |
'magnetic-resonance-in-medicine.csl' => 1, | |
'macromolecular-reaction-engineering.csl' => 1, | |
'lund-university-school-of-economics-and-management.csl' => 1, | |
'london-south-bank-university-numeric.csl' => 1, | |
'lluelles.csl' => 1, | |
'lluelles-no-ibid.csl' => 1, | |
'limnology-and-oceanography.csl' => 1, | |
'medecine-sciences.csl' => 1, | |
'leviathan.csl' => 1, | |
'lettres-et-sciences-humaines-fr.csl' => 1, | |
'lethaia.csl' => 1, | |
'les-journees-de-la-recherche-porcine.csl' => 1, | |
'les-journees-de-la-recherche-avicole.csl' => 1, | |
'leidraad-voor-juridische-auteurs.csl' => 1, | |
'le-tapuscrit-note.csl' => 1, | |
'le-tapuscrit-author-date.csl' => 1, | |
'le-mouvement-social.csl' => 1, | |
'law-and-society-review.csl' => 1, | |
'latin-american-research-review.csl' => 1, | |
'latin-american-perspectives.csl' => 1, | |
'language.csl' => 1, | |
'mcgill-fr.csl' => 1, | |
'media-culture-and-society.csl' => 1, | |
'molecular-plant-microbe-interactions.csl' => 1, | |
'mis-quarterly.csl' => 1, | |
'molecular-microbiology.csl' => 1, | |
'molecular-metabolism.csl' => 1, | |
'molecular-ecology.csl' => 1, | |
'molecular-biology-of-the-cell.csl' => 1, | |
'molecular-biology-and-evolution.csl' => 1, | |
'molecular-and-cellular-proteomics.csl' => 1, | |
'mohr-siebeck-recht.csl' => 1, | |
'modern-language-association.csl' => 1, | |
'modern-language-association-with-url.csl' => 1, | |
'modern-language-association-underline.csl' => 1, | |
'modern-language-association-6th-edition-note.csl' => 1, | |
'modern-humanities-research-association.csl' => 1, | |
'modern-humanities-research-association-author-date.csl' => 1, | |
'mineralogical-magazine.csl' => 1, | |
'medical-dosimetry.csl' => 1, | |
'middle-east-critique.csl' => 1, | |
'microscopy-and-microanalysis.csl' => 1, | |
'microbial-drug-resistance.csl' => 1, | |
'metropolitiques.csl' => 1, | |
'methods-of-information-in-medicine.csl' => 1, | |
'methods-in-ecology-and-evolution.csl' => 1, | |
'meteorological-applications.csl' => 1, | |
'meteoritics-and-planetary-science.csl' => 1, | |
'metallurgical-and-materials-transactions.csl' => 1, | |
'memorias-do-instituto-oswaldo-cruz.csl' => 1, | |
'melbourne-school-of-theology.csl' => 1, | |
'medicine-and-science-in-sports-and-exercise.csl' => 1, | |
'medical-physics.csl' => 1, | |
'medical-history.csl' => 1, | |
'easy.php' => 1, | |
'qrcode-terminal' => 1, | |
'journal-of-chemistry-and-chemical-engineering.csl' => 1, | |
'themecomponent.php' => 1, | |
'app-web.php' => 1, | |
'app-console.php' => 1, | |
'app-config.php' => 1, | |
'changelog-old' => 1, | |
'yasharewidget.php' => 1, | |
'yashasset.php' => 1, | |
'vkcommunitywidget.php' => 1, | |
'vkcommunityassetinnerfile.php' => 1, | |
'vkcommunityasset.php' => 1, | |
'vkcommentswidget.php' => 1, | |
'vkasset.php' => 1, | |
'viewcomponentsettings.php' => 1, | |
'viewcomponent.php' => 1, | |
'cmsseomodule.php' => 1, | |
'atroposasset.php' => 1, | |
'cmsseocomponent.php' => 1, | |
'cmssearchmodule.php' => 1, | |
'cmssearchcomponent.php' => 1, | |
'intlformatter.php' => 1, | |
'exchangeratescbrf.php' => 1, | |
'cmsmarketplacemodule.php' => 1, | |
'cmsmarketplacecomponent.php' => 1, | |
'mailersettings.php' => 1, | |
'logdbtarget.php' => 1, | |
'i18ndbmodule.php' => 1, | |
'i18ndbcomponent.php' => 1, | |
'cmssettingsexternallinkscomponent.php' => 1, | |
'cmsexternallinkscomponent.php' => 1, | |
'auto-config.php' => 1, | |
'boomerangasset.php' => 1, | |
'dbdumpercomponent.php' => 1, | |
'skillbertogitbundle.php' => 1, | |
'onesky' => 1, | |
'sevenoneskybundle.php' => 1, | |
'magebuild.phar' => 1, | |
'skimiaangularbundle.php' => 1, | |
'jquery.form.min.js' => 1, | |
'update-3.0' => 1, | |
'update-2.0' => 1, | |
'update-1.0' => 1, | |
'commandhandler.php' => 1, | |
'skillbertosonatapagemenubundle.php' => 1, | |
'skillbertosonataextendedadminbundle.php' => 1, | |
'skillbertoroutingextrabundle.php' => 1, | |
'skillbertolesscssbundle.php' => 1, | |
'skillbertoconsoleextendbundle.php' => 1, | |
'cubeasset.php' => 1, | |
'skillatwigmarkdownbundle.php' => 1, | |
'execute.php' => 1, | |
'highstock.php' => 1, | |
'highmaps.php' => 1, | |
'proxmoxcomponent.php' => 1, | |
'httpbasicauthcomponent.php' => 1, | |
'googleapicomponent.php' => 1, | |
'externallinksmodule.php' => 1, | |
'externallinkscomponent.php' => 1, | |
'ckeditorpresets.php' => 1, | |
'unifyasset.php' => 1, | |
'tshopasset.php' => 1, | |
'smartyasset.php' => 1, | |
'smartyadminasset.php' => 1, | |
'dbdumpermodule.php' => 1, | |
'_settingsfrom.php' => 1, | |
'typeserializer.php' => 1, | |
'zmqbroker.php' => 1, | |
'areachart.php' => 1, | |
'fuzzydatebehavior.php' => 1, | |
'datelineasset.php' => 1, | |
'dateline.php' => 1, | |
'bandoneonasset.php' => 1, | |
'bandoneon.php' => 1, | |
'_alphatrait.php' => 1, | |
'arraydataprovider.php' => 1, | |
'alphapager.php' => 1, | |
'spec4php.php' => 1, | |
'spec4php.bat' => 1, | |
'sixdaysopcachebundle.php' => 1, | |
'zmqworker.php' => 1, | |
'whereparser.php' => 1, | |
'columnchart.php' => 1, | |
'cachehelper.php' => 1, | |
'cacheactivequery.php' => 1, | |
'activequerycachehelper.php' => 1, | |
'smtoolsplugin.php' => 1, | |
'kphoensitemapbundle.php' => 1, | |
'framework2.sql' => 1, | |
'siriuslabaccountmanagerbundle.php' => 1, | |
'textutils.php' => 1, | |
'bvrbundle.php' => 1, | |
'sircampgooglemapformtypebundle.php' => 1, | |
'siphocpdfbundle.php' => 1, | |
'vadmin.php' => 1, | |
'listjs.php' => 1, | |
'bubblechart.php' => 1, | |
'geochart.php' => 1, | |
'cmsauthclientsettings.php' => 1, | |
'jquery.jqicon.js' => 1, | |
'cmsauthclientmodule.php' => 1, | |
'cmsauthclientcollection.php' => 1, | |
'settingsassetsautocompress.php' => 1, | |
'cmsagentmodule.php' => 1, | |
'cmsagentcomponent.php' => 1, | |
'daemonsbundle.php' => 1, | |
'fix_syle.sh' => 1, | |
'fix_style.sh' => 1, | |
'skautisbundle.php' => 1, | |
'min.jquery.jqdesktop.js' => 1, | |
'jquery.jqwindow.js' => 1, | |
'jquery.jqtaskbar.js' => 1, | |
'jquery.jqlayout.js' => 1, | |
'jquery.jqdesktop.js' => 1, | |
'linechart.php' => 1, | |
'jqdesktop.jquery.json' => 1, | |
'telexasset.php' => 1, | |
'telex.php' => 1, | |
'tagsuggestaction.php' => 1, | |
'tageditorasset.php' => 1, | |
'tageditor.php' => 1, | |
'tagbehavior.php' => 1, | |
'symbolpicker.php' => 1, | |
'symbolcolorsasset.php' => 1, | |
'spatialhelper.php' => 1, | |
'uploaderasset.php' => 1, | |
'illustration.php' => 1, | |
'illustrated.php' => 1, | |
'scatterchart.php' => 1, | |
'onesky.phar' => 1, | |
'rpcbundle.php' => 1, | |
'chatjs.php' => 1, | |
'monologbridge.php' => 1, | |
'linux0uidcontentfinderbundle.php' => 1, | |
'staticwp.php' => 1, | |
'whoopsbridge.php' => 1, | |
'viewmanager.php' => 1, | |
'servicefactory.php' => 1, | |
'ruleinterface.php' => 1, | |
'mimetypestore.php' => 1, | |
'errorstore.php' => 1, | |
'rsscollector.php' => 1, | |
'articleextractor.php' => 1, | |
'routerfactory.php' => 1, | |
'routebuildertrait.php' => 1, | |
'httpmethod.php' => 1, | |
'listenerpriorityqueue.php' => 1, | |
'default-avatar.png' => 1, | |
'listenerinterface.php' => 1, | |
'callbacklistener.php' => 1, | |
'servicedependency.php' => 1, | |
'dependencyinterface.php' => 1, | |
'helperregistry.php' => 1, | |
'helpcommand.php' => 1, | |
'dataobject.php' => 1, | |
'cakebridge.php' => 1, | |
'memcachedcache.php' => 1, | |
'memcachecache.php' => 1, | |
'arraycache.php' => 1, | |
'abstractcache.php' => 1, | |
'eventstore.php' => 1, | |
'smacharahtml2pdfbundle.php' => 1, | |
'smadasymfonytoolsbundle.php' => 1, | |
'apigen-config.neon' => 1, | |
'ezimagecropbundle.php' => 1, | |
'controller_front.php' => 1, | |
'controller_back.php' => 1, | |
'standardloader.php' => 1, | |
'standardformatter.php' => 1, | |
'iformatter.php' => 1, | |
'control.php' => 1, | |
'echartasset.php' => 1, | |
'echart.php' => 1, | |
'bar.php' => 1, | |
'phpunit_hhvm.sh' => 1, | |
'phpunit-coverage.bat' => 1, | |
'phpunit_smarty.php' => 1, | |
'smartivehandlebarsbundle.php' => 1, | |
'ezcontenttypemanagerbundle.php' => 1, | |
'smadasymfonytypeextrasbundle.php' => 1, | |
'flashmessage.php' => 1, | |
'monologlogroute.php' => 1, | |
'monologerrorhandler.php' => 1, | |
'monologcomponent.php' => 1, | |
'codemelli.php' => 1, | |
'jalali_date.php' => 1, | |
'magentoexception.php' => 1, | |
'magentoevents.php' => 1, | |
'magentobundle.php' => 1, | |
'drushrc.php.sample' => 1, | |
'cerbere.info' => 1, | |
'sample.yml' => 1, | |
'ajaxasset.php' => 1, | |
'smallteamimagebundle.php' => 1, | |
'custom.ini' => 1, | |
'cahngelog' => 1, | |
'skonsoftlftpdeployementbundle.php' => 1, | |
'abstracttransactionalproducer.php' => 1, | |
'zh_hk.csv.20160221' => 1, | |
'zh_hk.csv' => 1, | |
'demo_database.sqlite' => 1, | |
'skydiablophpseclibbundle.php' => 1, | |
'phpseclibautoloadersf21.php' => 1, | |
'phpseclibautoloadersf20.php' => 1, | |
'crypt_random.interface' => 1, | |
'skuolasitemapbundle.php' => 1, | |
'bcapi.class.php' => 1, | |
'skphp.php' => 1, | |
'skrzbunnybundle.php' => 1, | |
'bunnymanager.php' => 1, | |
'bunnyexception.php' => 1, | |
'abstractproducer.php' => 1, | |
'zh_hk.csv.20160320' => 1, | |
'skrzautowiringbundle.php' => 1, | |
'scaffolding.html' => 1, | |
'javascript.html' => 1, | |
'getting-started.html' => 1, | |
'extend.html' => 1, | |
'customize.html' => 1, | |
'components.html' => 1, | |
'base-css.html' => 1, | |
'skonsoftvehiclemanagerbundle.php' => 1, | |
'skonsofttranslatorbundle.php' => 1, | |
'skonsoftredirectorbundle.php' => 1, | |
'skonsoftpostaladdressbundle.php' => 1, | |
'skonsoftcompanyhierarchybundle.php' => 1, | |
'zh_hk.csv.20160222' => 1, | |
'license-cc0' => 1, | |
'out' => 1, | |
'class.router.php' => 1, | |
'recordlist.php' => 1, | |
'.scruninizer.yml' => 1, | |
'singletoninterface.php' => 1, | |
'basesingleton.php' => 1, | |
'basemethods.php' => 1, | |
'examplelogger.php' => 1, | |
'phpstan.neon' => 1, | |
'performance.php' => 1, | |
'sleepy.php' => 1, | |
'router.web.config' => 1, | |
'router.htaccess' => 1, | |
'class.template.php' => 1, | |
'class.sm.php' => 1, | |
'class.hooks.php' => 1, | |
'license-unlicense' => 1, | |
'class.debug.php' => 1, | |
'fancyguytodomvcclientbundle.php' => 1, | |
'update0.4.0' => 1, | |
'eovzmicrosofttranslatorapiclientbundle.php' => 1, | |
'hellowordplsimpleentitygeneratorbundle.php' => 1, | |
'environment.ini' => 1, | |
'update_app' => 1, | |
'init_update_app' => 1, | |
'bp-default-data.php' => 1, | |
'spdx-licenses.json' => 1, | |
'service_listing.php' => 1, | |
'template.twig' => 1, | |
'mimetypes.json' => 1, | |
'customize.json' => 1, | |
'chatroom.php' => 1, | |
'whatsappjs.php' => 1, | |
'zphp_jg.jpg' => 1, | |
'ltmain.sh' => 1, | |
'zmq_device.lo' => 1, | |
'zmq_device.c' => 1, | |
'zmq_clock.lo' => 1, | |
'zmq_clock.c' => 1, | |
'zmq.lo' => 1, | |
'zmq.la' => 1, | |
'zmq.c' => 1, | |
'php_zmq_private.h' => 1, | |
'php_zmq_pollset.h' => 1, | |
'php_zmq.h' => 1, | |
'php-zmq.spec' => 1, | |
'mkinstalldirs' => 1, | |
'missing' => 1, | |
'libtool' => 1, | |
'zmq_fd_stream.lo' => 1, | |
'install-sh' => 1, | |
'configure.in' => 1, | |
'config.sub' => 1, | |
'config.status' => 1, | |
'config.nice' => 1, | |
'config.log' => 1, | |
'config.h.in' => 1, | |
'config.h' => 1, | |
'config.guess' => 1, | |
'aclocal.m4' => 1, | |
'acinclude.m4' => 1, | |
'makefile.objects' => 1, | |
'makefile.global' => 1, | |
'zmq_fd_stream.c' => 1, | |
'zmq_pollset.c' => 1, | |
'.deps' => 1, | |
'pugpig_logging.php' => 1, | |
'phploc.bat' => 1, | |
'phpcpd.php' => 1, | |
'phpcpd.bat' => 1, | |
'sw' => 1, | |
'timber-rewrite-image-domain.php' => 1, | |
'croissant-sane-setup.php' => 1, | |
'croissant-admin-theme.php' => 1, | |
'shortlist-manifest-generator.php' => 1, | |
'pugpig_url_rewrites.php' => 1, | |
'pugpig_settings.php' => 1, | |
'pugpig_notifications_wordpress.php' => 1, | |
'pugpig_metaboxes.php' => 1, | |
'pugpig_manifests_wordpress.php' => 1, | |
'pugpig_html_manifest.php' => 1, | |
'zmq_pollset.lo' => 1, | |
'pugpig_filesystem.php' => 1, | |
'pugpig_change_hooks.php' => 1, | |
'pugpig_article_rewrite.php' => 1, | |
'pugpig_admin.php' => 1, | |
'pugpig_ad_bundles.php' => 1, | |
'old_pugpig.php' => 1, | |
'acf-typography.php' => 1, | |
'eula_en' => 1, | |
'eula' => 1, | |
'viewbundle.php' => 1, | |
'errorbundle.php' => 1, | |
'twitchapibundle.php' => 1, | |
'zmq_sockopt.lo' => 1, | |
'zmq_sockopt.c' => 1, | |
'makefile.fragments' => 1, | |
'timelinebundle.php' => 1, | |
'sami-md.cfg.php' => 1, | |
'httpauth.php' => 1, | |
'markupsolariumbundle.php' => 1, | |
'xml_doc.php' => 1, | |
'xml_curl.php' => 1, | |
'xml_api_call.php' => 1, | |
'urlsearchparams.php' => 1, | |
'systemcall.php' => 1, | |
'server_event.php' => 1, | |
'searchparams.php' => 1, | |
'namespacedfunction.php' => 1, | |
'magic_object.php' => 1, | |
'magic_cache.php' => 1, | |
'jsoncurl.php' => 1, | |
'ieconditionalcomment.php' => 1, | |
'html_element.php' => 1, | |
'hostbase-ansible.phar' => 1, | |
'html_el.php' => 1, | |
'html_doc.php' => 1, | |
'githubwebhook.php' => 1, | |
'exceptionlog.php' => 1, | |
'error_reporter.php' => 1, | |
'error_event.php' => 1, | |
'creative_commons_license.php' => 1, | |
'acimagepng.php' => 1, | |
'acimagejpg.php' => 1, | |
'acimagegif.php' => 1, | |
'acimage.php' => 1, | |
'accolor.php' => 1, | |
'seocontroller.php' => 1, | |
'haproxycc.phar' => 1, | |
'hostbase-manifest.json' => 1, | |
'keepassphp-cli.php' => 1, | |
'httpexceptiontest.php' => 1, | |
'ajaxopen.php' => 1, | |
'phpfun.php' => 1, | |
'statementbuilderinterface.php' => 1, | |
'objectcontainerinterface.php' => 1, | |
'jsonobjectcontainer.php' => 1, | |
'psr4autoloader.php' => 1, | |
'shivasversioningbundle.php' => 1, | |
'shivasbouncerbundle.php' => 1, | |
'shivasphealbundle.php' => 1, | |
'shiroyukiroutebundle.php' => 1, | |
'nature.functiontest.php' => 1, | |
'configuretest.php' => 1, | |
'curltest.php' => 1, | |
'apptest.php' => 1, | |
'hostbase.phar' => 1, | |
'nature.function.php' => 1, | |
'templatedesignerlayoutbundle.php' => 1, | |
'legendary_creatures_from_japan.json' => 1, | |
'dotdeb.list' => 1, | |
'docker-test.sh' => 1, | |
'docker-run.sh' => 1, | |
'docker-build.sh' => 1, | |
'loaderio-runner' => 1, | |
'heroku_create' => 1, | |
'spallocinebundle.php' => 1, | |
'noshreminder' => 1, | |
'noshfax' => 1, | |
'noshbackup' => 1, | |
'.google1' => 1, | |
'phploc.php' => 1, | |
'sami.cfg.php' => 1, | |
'whatsapp.php' => 1, | |
'maintenance.html.template' => 1, | |
'webbot.php' => 1, | |
'superthumb.jpg' => 1, | |
'validate.sh' => 1, | |
'run-caketests.php' => 1, | |
'urlcheck.php' => 1, | |
'spider.php' => 1, | |
'simgroepconcurrentspiderbundle.php' => 1, | |
'persistabledocument.php' => 1, | |
'invalidcontentexception.php' => 1, | |
'crawljob.php' => 1, | |
'terena_ssl_ca.pem' => 1, | |
'mollom-captcha-player.swf' => 1, | |
'.platform.yml' => 1, | |
'maintenance.htaccess.template' => 1, | |
'gumdrop.php' => 1, | |
'git-deploy.sh' => 1, | |
'environment.template' => 1, | |
'capfile.template' => 1, | |
'_configure_database.php' => 1, | |
'node_web.yml' => 1, | |
'node_ha.yml' => 1, | |
'node_deploynaut.yml' => 1, | |
'framework.patch' => 1, | |
'dependent-modules' => 1, | |
'buildfile.xml' => 1, | |
'symlinktask.php' => 1, | |
'silverstripetesttask.php' => 1, | |
'silverstripedeploytask.php' => 1, | |
'launch.sh' => 1, | |
'travis_build.sh' => 1, | |
'loadmodulestask.php' => 1, | |
'simplethingsformextrabundle.php' => 1, | |
'ageapibundle.php' => 1, | |
'sinencoallopasspaymentbundle.php' => 1, | |
'sinencoallopassapibundle.php' => 1, | |
'sineflowelasticsearchbundle.php' => 1, | |
'gifcreator.php' => 1, | |
'.simpspector.yml' => 1, | |
'stripeevents.php' => 1, | |
'simplewebstripebundle.php' => 1, | |
'simplewebsaasbundle.php' => 1, | |
'saasevents.php' => 1, | |
'simplewebbugsnagbundle.php' => 1, | |
'simpspector.yml' => 1, | |
'simplethingssolrbundle.php' => 1, | |
'simplethingsdistributionbundle.php' => 1, | |
'atom.xml.twig' => 1, | |
'simplesms.php' => 1, | |
'alipaybundle.php' => 1, | |
'deployer' => 1, | |
'mvc.sql' => 1, | |
'quickrbac.php' => 1, | |
'baseassetbundle.php' => 1, | |
'slamewhitelabelbundle.php' => 1, | |
'justgageassets.php' => 1, | |
'justgage.php' => 1, | |
'anonymoususercomponent.php' => 1, | |
'sitemap.xsl' => 1, | |
'sitemap.xml.twig' => 1, | |
'search_db.json.twig' => 1, | |
'page_db.json.twig' => 1, | |
'silverstripebuildtask.php' => 1, | |
'copyfolderstask.php' => 1, | |
'workflux.xsd' => 1, | |
'ndy' => 1, | |
'sikindustriesbundlestrobauserbundle.php' => 1, | |
'sikindustriesbundlesfacebookbundle.php' => 1, | |
'header.png' => 1, | |
'ico.php' => 1, | |
'start-redis-servers.sh' => 1, | |
'installdefaultapp.php' => 1, | |
'phpunit_db_config.travis.sqlite.php' => 1, | |
'phpunit_db_config.travis.mysql.php' => 1, | |
'phpunit_db_config.php.dist' => 1, | |
'siciarekphotogallerybundle.php' => 1, | |
'getresponseapibundle.php' => 1, | |
'siciarekchatbundle.php' => 1, | |
'properties.cnf.dist' => 1, | |
'trashquerybehavior.php' => 1, | |
'lumoon' => 1, | |
'trashquery.php' => 1, | |
'trashbehavior.php' => 1, | |
'translitinput.php' => 1, | |
'standartcontroller.php' => 1, | |
'urlcolumn.php' => 1, | |
'translatetrait.php' => 1, | |
'formfooter.php' => 1, | |
'userdatabehavior.php' => 1, | |
'lockedbehavior.php' => 1, | |
'dynamicquery.php' => 1, | |
'beforequerytrait.php' => 1, | |
'_intellij_phpunit_launcher.php' => 1, | |
'laravelblog' => 1, | |
'browserconfig.xml' => 1, | |
'lessc-adminlte' => 1, | |
'applypatchestask.php' => 1, | |
'monologserviceprovider.php' => 1, | |
'sisocontentloaderbundle.php' => 1, | |
'castanet.php' => 1, | |
'removetemplates.sh' => 1, | |
's3-expand' => 1, | |
'opsworks-deploy' => 1, | |
'local.env.dist' => 1, | |
'ecs-deploy' => 1, | |
'vardumperserviceprovider.php' => 1, | |
'twigserviceprovider.php' => 1, | |
'swiftmailerserviceprovider.php' => 1, | |
'servicecontrollerserviceprovider.php' => 1, | |
'securityserviceprovider.php' => 1, | |
'remembermeserviceprovider.php' => 1, | |
'localeserviceprovider.php' => 1, | |
'jenkins.yml' => 1, | |
'httpkernelserviceprovider.php' => 1, | |
'httpfragmentserviceprovider.php' => 1, | |
'httpcacheserviceprovider.php' => 1, | |
'exceptionhandlerserviceprovider.php' => 1, | |
'doctrineserviceprovider.php' => 1, | |
'csrfserviceprovider.php' => 1, | |
'assetserviceprovider.php' => 1, | |
'eventlistenerproviderinterface.php' => 1, | |
'controllerproviderinterface.php' => 1, | |
'bootableproviderinterface.php' => 1, | |
'read_me.html' => 1, | |
'amfphp_updates.php' => 1, | |
'lessc' => 1, | |
'.karma' => 1, | |
'journal-of-child-and-adolescent-psychopharmacology.csl' => 1, | |
'journal-of-cellular-and-molecular-medicine.csl' => 1, | |
'rzcalendarbundle.php' => 1, | |
'locales-hr-hr.xml' => 1, | |
'locales-nn-no.xml' => 1, | |
'locales-nl-nl.xml' => 1, | |
'locales-nb-no.xml' => 1, | |
'locales-mn-mn.xml' => 1, | |
'locales-lv-lv.xml' => 1, | |
'locales-lt-lt.xml' => 1, | |
'locales-ko-kr.xml' => 1, | |
'locales-km-kh.xml' => 1, | |
'locales-ja-jp.xml' => 1, | |
'locales-it-it.xml' => 1, | |
'locales-is-is.xml' => 1, | |
'locales-id-id.xml' => 1, | |
'locales-hu-hu.xml' => 1, | |
'locales-he-il.xml' => 1, | |
'locales-pt-br.xml' => 1, | |
'locales-fr-fr.xml' => 1, | |
'locales-fr-ca.xml' => 1, | |
'locales-fi-fi.xml' => 1, | |
'locales-fa-ir.xml' => 1, | |
'locales-eu.xml' => 1, | |
'locales-et-ee.xml' => 1, | |
'locales-es-mx.xml' => 1, | |
'locales-es-es.xml' => 1, | |
'locales-es-cl.xml' => 1, | |
'locales-en-us.xml' => 1, | |
'locales-en-gb.xml' => 1, | |
'locales-el-gr.xml' => 1, | |
'locales-de-de.xml' => 1, | |
'locales-pl-pl.xml' => 1, | |
'locales-pt-pt.xml' => 1, | |
'locales-de-at.xml' => 1, | |
'acm-sigchi-proceedings-extended-abstract-format.csl' => 1, | |
'acta-polytechnica.csl' => 1, | |
'acta-philosophica.csl' => 1, | |
'acta-pharmaceutica.csl' => 1, | |
'acta-pharmaceutica-sinica-b.csl' => 1, | |
'acta-palaeontologica-polonica.csl' => 1, | |
'acta-ophthalmologica.csl' => 1, | |
'acta-neurochirurgica.csl' => 1, | |
'acta-naturae.csl' => 1, | |
'acta-anaesthesiologica-taiwanica.csl' => 1, | |
'acta-anaesthesiologica-scandinavica.csl' => 1, | |
'acs-nano.csl' => 1, | |
'acm-siggraph.csl' => 1, | |
'acm-sigchi-proceedings.csl' => 1, | |
'acm-sig-proceedings.csl' => 1, | |
'locales-ro-ro.xml' => 1, | |
'acm-sig-proceedings-long-author-list.csl' => 1, | |
'academy-of-management-review.csl' => 1, | |
'locales.json' => 1, | |
'locales-zh-tw.xml' => 1, | |
'locales-zh-cn.xml' => 1, | |
'locales-vi-vn.xml' => 1, | |
'locales-uk-ua.xml' => 1, | |
'locales-tr-tr.xml' => 1, | |
'locales-th-th.xml' => 1, | |
'locales-sv-se.xml' => 1, | |
'locales-sr-rs.xml' => 1, | |
'locales-sl-si.xml' => 1, | |
'locales-sk-sk.xml' => 1, | |
'locales-ru-ru.xml' => 1, | |
'locales-de-ch.xml' => 1, | |
'locales-da-dk.xml' => 1, | |
'acta-societatis-botanicorum-poloniae.csl' => 1, | |
'adminpage.php' => 1, | |
'djjob.php' => 1, | |
'phpwee.php' => 1, | |
'abstractquery.php' => 1, | |
'iniconfig.php' => 1, | |
'extending' => 1, | |
'metricbundle.php' => 1, | |
'pimprestashopconnectorbundle.php' => 1, | |
'frozone.jpg' => 1, | |
'twitterstreambundle.php' => 1, | |
'requestevents.php' => 1, | |
'load-composer.php' => 1, | |
'postmetabox.php' => 1, | |
'boxespage.php' => 1, | |
'url-query.php' => 1, | |
'crosswalkquery.php' => 1, | |
'side.php' => 1, | |
'side-user.php' => 1, | |
'side-post.php' => 1, | |
'side-attachment.php' => 1, | |
'shortcodes.php' => 1, | |
'reciprocal-connection-type.php' => 1, | |
'query-user.php' => 1, | |
'query-post.php' => 1, | |
'list-renderer.php' => 1, | |
'item-user.php' => 1, | |
'item-post.php' => 1, | |
'item-attachment.php' => 1, | |
'item-any.php' => 1, | |
'crosswalk.php' => 1, | |
'crosswalkresponse.php' => 1, | |
'locales-cy-gb.xml' => 1, | |
'changelog-4.6' => 1, | |
'locales-cs-cz.xml' => 1, | |
'locales-ca-ad.xml' => 1, | |
'locales-bg-bg.xml' => 1, | |
'locales-ar.xml' => 1, | |
'locales-af-za.xml' => 1, | |
'generate-api-local.sh' => 1, | |
'changelog-5.4' => 1, | |
'changelog-5.3' => 1, | |
'changelog-5.2' => 1, | |
'changelog-5.1' => 1, | |
'changelog-5.0' => 1, | |
'changelog-4.8' => 1, | |
'changelog-4.7' => 1, | |
'changelog-4.5' => 1, | |
'dbunit' => 1, | |
'changelog-4.4' => 1, | |
'changelog-4.3' => 1, | |
'changelog-4.2' => 1, | |
'changelog-4.1' => 1, | |
'phptok' => 1, | |
'phploc' => 1, | |
'phpdcd' => 1, | |
'phpcpd' => 1, | |
'phpcov' => 1, | |
'changelog-3.3' => 1, | |
'changelog-2.2' => 1, | |
'pdepend-process' => 1, | |
'hhvm-wrapper' => 1, | |
'de-legacy-fy' => 1, | |
'acta-psychiatrica-scandinavica.csl' => 1, | |
'acta-universitatis-agriculturae-sueciae.csl' => 1, | |
'indeterminate-connection-type.php' => 1, | |
'annual-review-of-nuclear-and-particle-science.csl' => 1, | |
'apa-no-ampersand.csl' => 1, | |
'apa-fr-universite-de-montreal.csl' => 1, | |
'apa-fr-provost.csl' => 1, | |
'apa-cv.csl' => 1, | |
'apa-annotated-bibliography.csl' => 1, | |
'apa-5th-edition.csl' => 1, | |
'antiquity.csl' => 1, | |
'anticancer-research.csl' => 1, | |
'antarctic-science.csl' => 1, | |
'annual-reviews.csl' => 1, | |
'annual-reviews-without-titles.csl' => 1, | |
'annual-reviews-author-date.csl' => 1, | |
'annual-reviews-alphabetical.csl' => 1, | |
'annual-review-of-medicine.csl' => 1, | |
'apa-single-spaced.csl' => 1, | |
'annual-review-of-astronomy-and-astrophysics.csl' => 1, | |
'annals-of-the-association-of-american-geographers.csl' => 1, | |
'annals-of-oncology.csl' => 1, | |
'annals-of-neurology.csl' => 1, | |
'annals-of-botany.csl' => 1, | |
'annals-of-biomedical-engineering.csl' => 1, | |
'annals-of-applied-biology.csl' => 1, | |
'annales.csl' => 1, | |
'annalen-des-naturhistorischen-museums-in-wien.csl' => 1, | |
'animal-welfare.csl' => 1, | |
'angiologia.csl' => 1, | |
'angewandte-chemie.csl' => 1, | |
'anesthesiology.csl' => 1, | |
'apa-no-doi-no-issue.csl' => 1, | |
'apa-tr.csl' => 1, | |
'analytical-sciences.csl' => 1, | |
'asa-cssa-sssa.csl' => 1, | |
'associacao-nacional-de-pesquisa-e-ensino-em-transportes.csl' => 1, | |
'associacao-brasileira-de-normas-tecnicas.csl' => 1, | |
'associacao-brasileira-de-normas-tecnicas-usp-fmvz.csl' => 1, | |
'associacao-brasileira-de-normas-tecnicas-ufpr.csl' => 1, | |
'associacao-brasileira-de-normas-tecnicas-ufmg-face-initials.csl' => 1, | |
'associacao-brasileira-de-normas-tecnicas-ufmg-face-full.csl' => 1, | |
'associacao-brasileira-de-normas-tecnicas-ufjf.csl' => 1, | |
'associacao-brasileira-de-normas-tecnicas-note.csl' => 1, | |
'associacao-brasileira-de-normas-tecnicas-ipea.csl' => 1, | |
'associacao-brasileira-de-normas-tecnicas-eceme.csl' => 1, | |
'asian-studies-review.csl' => 1, | |
'asia-and-the-pacific-policy-studies.csl' => 1, | |
'asaio-journal.csl' => 1, | |
'arzneimitteltherapie.csl' => 1, | |
'apa.csl' => 1, | |
'arthritis-and-rheumatism.csl' => 1, | |
'artery-research.csl' => 1, | |
'art-history.csl' => 1, | |
'archivos-de-la-sociedad-espanola-de-oftalmologia.csl' => 1, | |
'archives-of-physical-medicine-and-rehabilitation.csl' => 1, | |
'archiv-fur-geschichte-der-philosophie.csl' => 1, | |
'archiv-fur-die-civilistische-praxis.csl' => 1, | |
'archeologie-medievale.csl' => 1, | |
'archaeometry.csl' => 1, | |
'arachnology.csl' => 1, | |
'arachne.csl' => 1, | |
'aquatic-living-resources.csl' => 1, | |
'aquatic-conservation.csl' => 1, | |
'applied-spectroscopy.csl' => 1, | |
'anesthesia-and-analgesia.csl' => 1, | |
'american-veterinary-medical-association.csl' => 1, | |
'administrative-science-quarterly.csl' => 1, | |
'ameghiniana.csl' => 1, | |
'american-geophysical-union.csl' => 1, | |
'american-fisheries-society.csl' => 1, | |
'american-chemical-society.csl' => 1, | |
'american-chemical-society-with-titles.csl' => 1, | |
'american-chemical-society-with-titles-sentence-case.csl' => 1, | |
'american-chemical-society-with-titles-sentence-case-doi.csl' => 1, | |
'american-chemical-society-with-titles-page-first.csl' => 1, | |
'american-chemical-society-with-titles-no-et-al.csl' => 1, | |
'american-chemical-society-page-first.csl' => 1, | |
'american-chemical-society-author-date.csl' => 1, | |
'american-association-of-petroleum-geologists.csl' => 1, | |
'american-association-for-cancer-research.csl' => 1, | |
'american-anthropological-association.csl' => 1, | |
'ambio.csl' => 1, | |
'american-institute-of-aeronautics-and-astronautics.csl' => 1, | |
'alternatives-to-animal-experimentation.csl' => 1, | |
'allergy.csl' => 1, | |
'allergology-international.csl' => 1, | |
'alexandria-journal-of-medicine.csl' => 1, | |
'aids.csl' => 1, | |
'aging-cell.csl' => 1, | |
'african-zoology.csl' => 1, | |
'african-journal-of-emergency-medicine.csl' => 1, | |
'advances-in-complex-systems.csl' => 1, | |
'advances-in-alzheimers-disease.csl' => 1, | |
'advanced-materials.csl' => 1, | |
'advanced-functional-materials.csl' => 1, | |
'advanced-engineering-materials.csl' => 1, | |
'american-heart-association.csl' => 1, | |
'american-institute-of-physics.csl' => 1, | |
'american-sociological-association.csl' => 1, | |
'american-medical-association-alphabetical.csl' => 1, | |
'american-society-of-mechanical-engineers.csl' => 1, | |
'american-society-of-civil-engineers.csl' => 1, | |
'american-society-for-pharmacology-and-experimental-therapeutics.csl' => 1, | |
'american-society-for-microbiology.csl' => 1, | |
'american-political-science-association.csl' => 1, | |
'american-phytopathological-society.csl' => 1, | |
'american-physiological-society.csl' => 1, | |
'american-physics-society.csl' => 1, | |
'american-mineralogist.csl' => 1, | |
'american-meteorological-society.csl' => 1, | |
'american-medical-association.csl' => 1, | |
'american-medical-association-no-url.csl' => 1, | |
'american-medical-association-no-et-al.csl' => 1, | |
'american-marketing-association.csl' => 1, | |
'american-journal-of-agricultural-economics.csl' => 1, | |
'american-journal-of-surgical-pathology.csl' => 1, | |
'american-journal-of-respiratory-and-critical-care-medicine.csl' => 1, | |
'american-journal-of-primatology.csl' => 1, | |
'american-journal-of-political-science.csl' => 1, | |
'american-journal-of-plant-sciences.csl' => 1, | |
'american-journal-of-orthodontics-and-dentofacial-orthopedics.csl' => 1, | |
'american-journal-of-neuroradiology.csl' => 1, | |
'american-journal-of-medical-genetics.csl' => 1, | |
'american-journal-of-human-genetics.csl' => 1, | |
'american-journal-of-health-behavior.csl' => 1, | |
'american-journal-of-epidemiology.csl' => 1, | |
'american-journal-of-clinical-pathology.csl' => 1, | |
'american-journal-of-botany.csl' => 1, | |
'american-journal-of-archaeology.csl' => 1, | |
'indeterminate-directed-connection-type.php' => 1, | |
'direction-strategy.php' => 1, | |
'association-for-computing-machinery.csl' => 1, | |
'tinybox2.js' => 1, | |
'network.php' => 1, | |
'emailstatus.php' => 1, | |
'ya_search.js' => 1, | |
'yasearch.php' => 1, | |
'iurl.php' => 1, | |
'smscua.php' => 1, | |
'scalecontroller.php' => 1, | |
'letsads.php' => 1, | |
'mixin.less' => 1, | |
'media.less' => 1, | |
'lessc.php' => 1, | |
'esputnik.php' => 1, | |
'coffeescript.php' => 1, | |
'tinybox.js' => 1, | |
'badcowaddressbundle.php' => 1, | |
'tinybox.css' => 1, | |
'smoothscroll.js' => 1, | |
'sjsslider.js' => 1, | |
'select.less' => 1, | |
'select.js' => 1, | |
'searchfilter.js' => 1, | |
'sjsmd5.js' => 1, | |
'sjslighbox.js' => 1, | |
'trim.js' => 1, | |
'sizzle.js' => 1, | |
'events.js' => 1, | |
'dom.js' => 1, | |
'compatibility.js' => 1, | |
'helloworld.class.php' => 1, | |
'__fff__.php' => 1, | |
'_samsonjs.js' => 1, | |
'inputswitch.php' => 1, | |
'definitions.php' => 1, | |
'simplefilter.php' => 1, | |
'spresssitemapxml.php' => 1, | |
'xmpp-enabled.php' => 1, | |
'juick-xp.php' => 1, | |
'license.fixtures' => 1, | |
'wcurl.php' => 1, | |
'wp-less.php' => 1, | |
'sparkpost-wp-mail.php' => 1, | |
'storageasset.php' => 1, | |
'themebootstrap.php' => 1, | |
'itemselectasset.php' => 1, | |
'itemselect.php' => 1, | |
'gridkeyval.php' => 1, | |
'social.html' => 1, | |
'daterangecolumn.php' => 1, | |
'fieldsetasset.php' => 1, | |
'ckeditorpackagepluginasset.php' => 1, | |
'browserasset.php' => 1, | |
'manytomanybehavior.php' => 1, | |
'areaasset.php' => 1, | |
'area.php' => 1, | |
'tag-and-release.sh' => 1, | |
'traverser.php' => 1, | |
'genealogy.php' => 1, | |
'genealogy.i18n.php' => 1, | |
'genealogy.i18n.magic.php' => 1, | |
'jimdojimflowprintticketbundle.php' => 1, | |
'swift-mail.php' => 1, | |
'binder.js' => 1, | |
'shoppingcartitem.php' => 1, | |
'mainform.java' => 1, | |
'rzredirectbundle.php' => 1, | |
'olixserverbundle.php' => 1, | |
'olixsecuritybundle.php' => 1, | |
'olixformsextbootstrapbundle.php' => 1, | |
'olixdatatablesbootstrapbundle.php' => 1, | |
'saadtazigchartbundle.php' => 1, | |
'rzusersecuritybundle.php' => 1, | |
'rzuserevents.php' => 1, | |
'rzuserbundle.php' => 1, | |
'rztimelinebundle.php' => 1, | |
'rztaxonomiesbundle.php' => 1, | |
'rzseobundle.php' => 1, | |
'rzsearchbundle.php' => 1, | |
'rzpiwikbundle.php' => 1, | |
'rzpagebundle.php' => 1, | |
'sdresthookbundle.php' => 1, | |
'rzoauthbundle.php' => 1, | |
'rznewsbundle.php' => 1, | |
'rzmediabundle.php' => 1, | |
'rzjquerybundle.php' => 1, | |
'rzgoogleapiclientbundle.php' => 1, | |
'rzformatterbundle.php' => 1, | |
'rzfieldtypebundle.php' => 1, | |
'rzdoctrineormadminbundle.php' => 1, | |
'rzcorebundle.php' => 1, | |
'rzcommentbundle.php' => 1, | |
'rzcodemirrorbundle.php' => 1, | |
'rzclassificationbundle.php' => 1, | |
'rzckeditorbundle.php' => 1, | |
'olixtestbundle.php' => 1, | |
'sachoocrudgenbundle.php' => 1, | |
'cmssearch.less' => 1, | |
'salbertsrecaptcha2bundle.php' => 1, | |
'cmssearch.js' => 1, | |
'samsoncms.sql.gz' => 1, | |
'psql.sql' => 1, | |
'config.bat' => 1, | |
'versioner' => 1, | |
'webshellasset.php' => 1, | |
'jqueryterminalasset.php' => 1, | |
'phpgsb.class.php' => 1, | |
'lookup.php' => 1, | |
'listupdater.php' => 1, | |
'savant3.php' => 1, | |
'jdatetime.class.php' => 1, | |
'tableprinter.php' => 1, | |
'wp_bootstrap_navwalker.php' => 1, | |
'operationstate.php' => 1, | |
'.brackets.json' => 1, | |
'test-sshkey' => 1, | |
'config.sh.sample' => 1, | |
'run-inspections' => 1, | |
'tomatomatombundle.php' => 1, | |
'linkedin_3.2.0.1.class.php' => 1, | |
'logger.class.php' => 1, | |
'juithemeselectwidget.php' => 1, | |
'juithemeselectasset.php' => 1, | |
'juithemeselect.js' => 1, | |
'actrack' => 1, | |
'basic-http-authentication.php' => 1, | |
'operationstatemanager.php' => 1, | |
'operationstateexception.php' => 1, | |
'test_bridge.php' => 1, | |
'architect.log' => 1, | |
'directed-connection-type.php' => 1, | |
'p3widgetsmodule.php' => 1, | |
'samples_docs.php' => 1, | |
'createtest.php' => 1, | |
'release-list' => 1, | |
'sugared-sami' => 1, | |
'sugared-phpunit' => 1, | |
'sugared-phpmd' => 1, | |
'sugared-phpcs' => 1, | |
'sugared-phpcbf' => 1, | |
'schnittstabil-phpunit-starter' => 1, | |
'giic-config.php' => 1, | |
'sakilamodule.php' => 1, | |
'ckeditorconfiguratormodule.php' => 1, | |
'phinflector.php' => 1, | |
'p3pagesmodule.php' => 1, | |
'phlop' => 1, | |
'p3mediamodule.php' => 1, | |
'p3adminmodule.php' => 1, | |
'emultithememanager.php' => 1, | |
'giic.xsl' => 1, | |
'giic.php' => 1, | |
'shellcolors.php' => 1, | |
'giiccommand.php' => 1, | |
'giicapplication.php' => 1, | |
'edatabasecommand.php' => 1, | |
'jmstwigjsbundle.php' => 1, | |
'jmssecurityextrabundle.php' => 1, | |
'jmspaymentpaypalbundle.php' => 1, | |
'jmspaymentcorebundle.php' => 1, | |
'samples_views.php' => 1, | |
'phlop.json' => 1, | |
'jmsdiextrabundle.php' => 1, | |
'.htaccess-sample' => 1, | |
'determinate-connection-type.php' => 1, | |
'connection-type.php' => 1, | |
'connection-type-factory.php' => 1, | |
'scribepheanstalkbundle.php' => 1, | |
'pheanstalklocator.php' => 1, | |
'code-climate-coverage.sh' => 1, | |
'ant.properties' => 1, | |
'pom-main.xml' => 1, | |
'scribestripebundle.php' => 1, | |
'scribeclockworkbundle.php' => 1, | |
'zuolikebundle.php' => 1, | |
'generate-config.sh' => 1, | |
'remote-uploads.sh' => 1, | |
'database-update.sh' => 1, | |
'hookrunner.php' => 1, | |
'database-prepare.sh' => 1, | |
'database-import.sh' => 1, | |
'database-export.sh' => 1, | |
'tzid.json' => 1, | |
'timezone_dump.php' => 1, | |
'timezone-select-screenshot.png' => 1, | |
'scorpiosphinxsearchbundle.php' => 1, | |
'scoreyacinderellasdkbundle.php' => 1, | |
'phpunit_onlyreduceruntime.xml' => 1, | |
'phpunit_onlyenvironment.xml' => 1, | |
'scigrouptinymcepluploadfilemanagerbundle.php' => 1, | |
'traits.php' => 1, | |
'facades.php' => 1, | |
'precommit.yml' => 1, | |
'jmsgoogleclosurebundle.php' => 1, | |
'jmsdebuggingbundle.php' => 1, | |
'architect.log.1' => 1, | |
'mediaapibundle.php' => 1, | |
'rutvalidatorasset.php' => 1, | |
'rutvalidator.php' => 1, | |
'rutformatbehavior.php' => 1, | |
'excelview.php' => 1, | |
'test3.php' => 1, | |
'layout.macro' => 1, | |
'example-template3.macro' => 1, | |
'example-template2.macro' => 1, | |
'example-template.php' => 1, | |
'example-element1.php' => 1, | |
'ods.php' => 1, | |
'pclzip.php' => 1, | |
'nanophp' => 1, | |
'applog.log' => 1, | |
'rutwidgetasset.php' => 1, | |
'ahservicearchivingbundle.php' => 1, | |
'history.js' => 1, | |
'santhapanepalidateconverterbundle.php' => 1, | |
'monstabox.php' => 1, | |
'lotteryresultbundle.php' => 1, | |
'.pomm_cli_bootstrap.php' => 1, | |
'sangkilbiz.backup' => 1, | |
'sangkilbiz-3 data model.architect' => 1, | |
'init_db_schema_only.sql' => 1, | |
'init_db_data_only3.sql' => 1, | |
'init_db_data_only2.sql' => 1, | |
'init_db_data_only.sql' => 1, | |
'db_schemas.sql' => 1, | |
'rutwidget.php' => 1, | |
'jquery.rut.js' => 1, | |
'jmscommandbundle.php' => 1, | |
'scandiopaginatorbundle.php' => 1, | |
'jmsaopbundle.php' => 1, | |
'api-key.local.php.dist' => 1, | |
'asins.php' => 1, | |
'flexiblecallback.php' => 1, | |
'local-config.php.dist' => 1, | |
'readme_fork' => 1, | |
'noticeexception.php' => 1, | |
'invalidexception.php' => 1, | |
'tombstone.php' => 1, | |
'tombstone' => 1, | |
'schebstockpanelbundle.php' => 1, | |
'copying.phalcon' => 1, | |
'scandiotrobabridgebundle.php' => 1, | |
'scabbia.bat' => 1, | |
'rut-widget.js' => 1, | |
'xmlstr_to_array.php' => 1, | |
'saymegulprevbundle.php' => 1, | |
'saxulum-collection.js' => 1, | |
'vsavritskymorpherbundle.php' => 1, | |
'saulswidgetbundle.php' => 1, | |
'mooflashcardbundle.php' => 1, | |
'mooflashcardadminbundle.php' => 1, | |
'log4php.xml' => 1, | |
'rss_utils.inc' => 1, | |
'rss_parse.inc' => 1, | |
'rss_fetch.inc' => 1, | |
'rss_cache.inc' => 1, | |
'troubleshooting' => 1, | |
'satelliteudeploybundle.php' => 1, | |
'association-for-computational-linguistics.csl' => 1, | |
'atencion-primaria.csl' => 1, | |
'journal-of-cardiothoracic-and-vascular-anesthesia.csl' => 1, | |
'harvard-leeds-metropolitan-university.csl' => 1, | |
'harvard-the-university-of-melbourne.csl' => 1, | |
'harvard-swinburne-university-of-technology.csl' => 1, | |
'harvard-stellenbosch-university.csl' => 1, | |
'harvard-staffordshire-university.csl' => 1, | |
'harvard-southampton-solent-university.csl' => 1, | |
'harvard-pontificia-universidad-catolica-del-ecuador.csl' => 1, | |
'harvard-oxford-brookes-university-faculty-of-health-and-life-sciences.csl' => 1, | |
'harvard-north-west-university.csl' => 1, | |
'harvard-newcastle-university.csl' => 1, | |
'harvard-manchester-metropolitan-university.csl' => 1, | |
'harvard-manchester-business-school.csl' => 1, | |
'harvard-london-south-bank-university.csl' => 1, | |
'harvard-limerick.csl' => 1, | |
'harvard-leeds-beckett-university.csl' => 1, | |
'harvard-the-university-of-sheffield-school-of-east-asian-studies.csl' => 1, | |
'harvard-kings-college-london.csl' => 1, | |
'harvard-institut-fur-praxisforschung-de.csl' => 1, | |
'harvard-imperial-college-london.csl' => 1, | |
'harvard-gesellschaft-fur-bildung-und-forschung-in-europa.csl' => 1, | |
'harvard-fachhochschule-salzburg.csl' => 1, | |
'harvard-european-archaeology.csl' => 1, | |
'harvard-edge-hill-university.csl' => 1, | |
'harvard-durham-university-business-school.csl' => 1, | |
'harvard-dundalk-institute-of-technology.csl' => 1, | |
'harvard-cranfield-university.csl' => 1, | |
'harvard-coventry-university.csl' => 1, | |
'harvard-cite-them-right.csl' => 1, | |
'harvard-cardiff-university.csl' => 1, | |
'harvard-the-university-of-northampton.csl' => 1, | |
'harvard-the-university-of-sheffield-town-and-regional-planning.csl' => 1, | |
'harvard-cape-peninsula-university-of-technology.csl' => 1, | |
'harvard-university-of-worcester.csl' => 1, | |
'hematology-oncology-clinics-of-north-america.csl' => 1, | |
'heart-rhythm.csl' => 1, | |
'heart-failure-clinics.csl' => 1, | |
'health-services-research.csl' => 1, | |
'health-reform-observer-observatoire-des-reformes-de-sante.csl' => 1, | |
'health-policy-and-planning.csl' => 1, | |
'health-economics.csl' => 1, | |
'health-economics-policy-and-law.csl' => 1, | |
'health-and-social-care-in-the-community.csl' => 1, | |
'hawaii-international-conference-on-system-sciences-proceedings.csl' => 1, | |
'harvard7de.csl' => 1, | |
'harvard1.csl' => 1, | |
'harvard-york-st-john-university.csl' => 1, | |
'harvard-university-of-wolverhampton.csl' => 1, | |
'harvard-universiti-tunku-abdul-rahman.csl' => 1, | |
'harvard-university-of-westminster.csl' => 1, | |
'harvard-university-of-west-london.csl' => 1, | |
'harvard-university-of-the-west-of-scotland.csl' => 1, | |
'harvard-university-of-the-west-of-england.csl' => 1, | |
'harvard-university-of-sunderland.csl' => 1, | |
'harvard-university-of-leeds.csl' => 1, | |
'harvard-university-of-kent.csl' => 1, | |
'harvard-university-of-greenwich.csl' => 1, | |
'harvard-university-of-gloucestershire.csl' => 1, | |
'harvard-university-of-cape-town.csl' => 1, | |
'harvard-university-of-brighton-school-of-environment-and-technology.csl' => 1, | |
'harvard-university-of-birmingham.csl' => 1, | |
'harvard-university-of-abertay-dundee.csl' => 1, | |
'harvard-university-for-the-creative-arts.csl' => 1, | |
'harvard-cardiff-university-biosi.csl' => 1, | |
'harvard-bournemouth-university.csl' => 1, | |
'heredity.csl' => 1, | |
'food-and-agriculture-organization-of-the-united-nations.csl' => 1, | |
'frontiers-in-optics.csl' => 1, | |
'frontiers-in-ecology-and-the-environment.csl' => 1, | |
'freshwater-science.csl' => 1, | |
'freshwater-biology.csl' => 1, | |
'french4.csl' => 1, | |
'french3.csl' => 1, | |
'french2.csl' => 1, | |
'french1.csl' => 1, | |
'french-politics.csl' => 1, | |
'freie-universitat-berlin-geographische-wissenschaften.csl' => 1, | |
'free-radical-research.csl' => 1, | |
'forest-science.csl' => 1, | |
'forensic-science-review.csl' => 1, | |
'fold-and-r.csl' => 1, | |
'frontiers-medical-journals.csl' => 1, | |
'foerster-geisteswissenschaft.csl' => 1, | |
'florida-entomologist.csl' => 1, | |
'flavour-and-fragrance-journal.csl' => 1, | |
'fish-and-fisheries.csl' => 1, | |
'first-monday.csl' => 1, | |
'finanzarchiv.csl' => 1, | |
'fertility-and-sterility.csl' => 1, | |
'ferdinand-porsche-fern-fachhochschule.csl' => 1, | |
'facial-plastic-surgery-clinics-of-north-america.csl' => 1, | |
'fachhochschule-vorarlberg.csl' => 1, | |
'fachhochschule-kiel-fachbereich-medien.csl' => 1, | |
'eye.csl' => 1, | |
'experimental-dermatology.csl' => 1, | |
'frontiers-in-physics.csl' => 1, | |
'frontiers.csl' => 1, | |
'harvard-anglia-ruskin-university.csl' => 1, | |
'geological-magazine.csl' => 1, | |
'hand.csl' => 1, | |
'hamburg-school-of-food-science.csl' => 1, | |
'grasas-y-aceites.csl' => 1, | |
'gost-r-7-0-5-2008.csl' => 1, | |
'gost-r-7-0-5-2008-numeric.csl' => 1, | |
'gost-r-7-0-5-2008-numeric-alphabetical.csl' => 1, | |
'global-ecology-and-biogeography.csl' => 1, | |
'global-change-biology.csl' => 1, | |
'gewerblicher-rechtsschutz-und-urheberrecht.csl' => 1, | |
'gesellschaft-fur-popularmusikforschung.csl' => 1, | |
'georg-august-universitat-gottingen-institut-fur-ethnologie-und-ethnologische-sammlung.csl' => 1, | |
'geopolitics.csl' => 1, | |
'geology.csl' => 1, | |
'geografie-sbornik-cgs.csl' => 1, | |
'future-science-group.csl' => 1, | |
'geochimica-et-cosmochimica-acta.csl' => 1, | |
'geobiology.csl' => 1, | |
'geoarchaeology.csl' => 1, | |
'genome-biology-and-evolution.csl' => 1, | |
'genetics.csl' => 1, | |
'genetics-and-molecular-biology.csl' => 1, | |
'geneses.csl' => 1, | |
'genes-to-cells.csl' => 1, | |
'geistes-und-kulturwissenschaften-heilmann.csl' => 1, | |
'gastrointestinal-intervention.csl' => 1, | |
'gastrointestinal-endoscopy-clinics-of-north-america.csl' => 1, | |
'gastroenterology.csl' => 1, | |
'gallia.csl' => 1, | |
'g3.csl' => 1, | |
'hepatology.csl' => 1, | |
'hiob-ludolf-centre-for-ethiopian-studies-with-url-doi.csl' => 1, | |
'evolutionary-ecology-research.csl' => 1, | |
'investigative-radiology.csl' => 1, | |
'iso690-numeric-cs.csl' => 1, | |
'iso690-numeric-brackets-cs.csl' => 1, | |
'iso690-note-fr.csl' => 1, | |
'iso690-note-cs.csl' => 1, | |
'iso690-full-note-sk.csl' => 1, | |
'iso690-author-date-sk.csl' => 1, | |
'iso690-author-date-fr.csl' => 1, | |
'iso690-author-date-fr-no-abstract.csl' => 1, | |
'iso690-author-date-es.csl' => 1, | |
'iso690-author-date-en.csl' => 1, | |
'iso690-author-date-cs.csl' => 1, | |
'irish-historical-studies.csl' => 1, | |
'invisu.csl' => 1, | |
'invertebrate-biology.csl' => 1, | |
'iso690-numeric-fr.csl' => 1, | |
'international-union-of-crystallography.csl' => 1, | |
'international-studies-association.csl' => 1, | |
'international-pig-veterinary-society-congress-proceedings.csl' => 1, | |
'international-organization.csl' => 1, | |
'international-microbiology.csl' => 1, | |
'international-labour-organization.csl' => 1, | |
'international-journal-of-wildland-fire.csl' => 1, | |
'international-journal-of-sports-medicine.csl' => 1, | |
'international-journal-of-radiation-oncology-biology-physics.csl' => 1, | |
'international-journal-of-quantum-chemistry.csl' => 1, | |
'international-journal-of-plant-sciences.csl' => 1, | |
'international-journal-of-osteopathic-medicine.csl' => 1, | |
'international-journal-of-osteoarchaeology.csl' => 1, | |
'iso690-numeric-en.csl' => 1, | |
'iso690-numeric-lt.csl' => 1, | |
'international-journal-of-occupational-medicine-and-environmental-health.csl' => 1, | |
'journal-of-applied-ecology.csl' => 1, | |
'journal-of-business-logistics.csl' => 1, | |
'journal-of-burn-care-and-research.csl' => 1, | |
'journal-of-brachial-plexus-and-peripheral-nerve-injury.csl' => 1, | |
'journal-of-bone-and-mineral-research.csl' => 1, | |
'journal-of-biomedical-materials-research-part-a.csl' => 1, | |
'journal-of-biological-chemistry.csl' => 1, | |
'journal-of-biogeography.csl' => 1, | |
'journal-of-basic-microbiology.csl' => 1, | |
'journal-of-avian-biology.csl' => 1, | |
'journal-of-atrial-fibrillation.csl' => 1, | |
'journal-of-archaeological-research.csl' => 1, | |
'journal-of-applied-philosophy.csl' => 1, | |
'journal-of-applied-entomology.csl' => 1, | |
'journal-of-applied-animal-science.csl' => 1, | |
'iso690-numeric-sk.csl' => 1, | |
'journal-of-antimicrobial-chemotherapy.csl' => 1, | |
'journal-of-animal-science.csl' => 1, | |
'journal-of-animal-physiology-and-animal-nutrition.csl' => 1, | |
'journal-of-analytical-toxicology.csl' => 1, | |
'journal-of-alzheimers-disease.csl' => 1, | |
'journal-of-aerosol-medicine-and-pulmonary-drug-delivery.csl' => 1, | |
'journal-of-adolescent-health.csl' => 1, | |
'journal-for-the-history-of-astronomy.csl' => 1, | |
'javnost-the-public.csl' => 1, | |
'jahrbuch-fur-evangelikale-theologie.csl' => 1, | |
'jahrbuch-der-osterreichischen-byzantinischen-gesellschaft.csl' => 1, | |
'jacc-cardiovascular-imaging.csl' => 1, | |
'ithaque.csl' => 1, | |
'israel-medical-association-journal.csl' => 1, | |
'international-journal-of-oral-and-maxillofacial-surgery.csl' => 1, | |
'international-journal-of-obstetric-anesthesia.csl' => 1, | |
'hiob-ludolf-centre-for-ethiopian-studies.csl' => 1, | |
'hydrobiologia.csl' => 1, | |
'indian-journal-of-medical-research.csl' => 1, | |
'immunological-reviews.csl' => 1, | |
'im-gesprach.csl' => 1, | |
'iica-catie.csl' => 1, | |
'igaku-toshokan.csl' => 1, | |
'ieee.csl' => 1, | |
'ieee-with-url.csl' => 1, | |
'ie-comunicaciones.csl' => 1, | |
'ices-journal-of-marine-science.csl' => 1, | |
'hypotheses-in-the-life-sciences.csl' => 1, | |
'hypertension-research.csl' => 1, | |
'hydrological-sciences-journal.csl' => 1, | |
'hydrological-processes.csl' => 1, | |
'humboldt-state-university-environmental-resources-engineering.csl' => 1, | |
'infectio.csl' => 1, | |
'human-wildlife-interactions.csl' => 1, | |
'human-resource-management-journal.csl' => 1, | |
'human-reproduction.csl' => 1, | |
'human-reproduction-update.csl' => 1, | |
'human-mutation.csl' => 1, | |
'human-brain-mapping.csl' => 1, | |
'hong-kong-journal-of-radiology.csl' => 1, | |
'hochschule-fur-wirtschaft-und-recht-berlin.csl' => 1, | |
'history-of-the-human-sciences.csl' => 1, | |
'history-and-theory.csl' => 1, | |
'histoire-et-mesure.csl' => 1, | |
'histoire-at-politique.csl' => 1, | |
'hipertension-y-riesgo-vascular.csl' => 1, | |
'indoor-air.csl' => 1, | |
'infectious-disease-clinics-of-north-america.csl' => 1, | |
'international-journal-of-nuclear-security.csl' => 1, | |
'interdisziplinare-zeitschrift-fur-technologie-und-lernen.csl' => 1, | |
'international-journal-of-lexicography.csl' => 1, | |
'international-journal-of-infectious-diseases.csl' => 1, | |
'international-journal-of-humanoid-robotics.csl' => 1, | |
'international-journal-of-geriatric-psychiatry.csl' => 1, | |
'international-journal-of-food-science-and-technology.csl' => 1, | |
'international-journal-of-exercise-science.csl' => 1, | |
'international-journal-of-epidemiology.csl' => 1, | |
'international-journal-of-electronic-commerce.csl' => 1, | |
'international-journal-of-climatology.csl' => 1, | |
'international-journal-of-cancer.csl' => 1, | |
'international-journal-of-audiology.csl' => 1, | |
'international-conference-on-information-systems-development.csl' => 1, | |
'international-atomic-energy-agency.csl' => 1, | |
'interaction-design-and-architectures.csl' => 1, | |
'inflammatory-bowel-diseases.csl' => 1, | |
'inter-ro.csl' => 1, | |
'inter-research-science-center.csl' => 1, | |
'instituto-superior-de-teologia-de-las-islas-canarias.csl' => 1, | |
'instituto-de-pesquisas-tecnologicas.csl' => 1, | |
'institute-of-physics-numeric.csl' => 1, | |
'institute-of-physics-harvard.csl' => 1, | |
'institut-national-de-sante-publique-du-quebec-topo.csl' => 1, | |
'institut-national-de-sante-publique-du-quebec-napp.csl' => 1, | |
'institut-national-de-la-recherche-scientifique-sciences-sociales.csl' => 1, | |
'ingenieria-agricola.csl' => 1, | |
'information-systems-research.csl' => 1, | |
'infoclio-fr-smallcaps.csl' => 1, | |
'infoclio-fr-nocaps.csl' => 1, | |
'infoclio-de.csl' => 1, | |
'exercer.csl' => 1, | |
'evolutionary-anthropology.csl' => 1, | |
'ausonius-editions.csl' => 1, | |
'cellular-reprogramming.csl' => 1, | |
'chicago-author-date.csl' => 1, | |
'chicago-author-date-fr.csl' => 1, | |
'chicago-author-date-de.csl' => 1, | |
'chicago-author-date-basque.csl' => 1, | |
'chicago-annotated-bibliography.csl' => 1, | |
'chest.csl' => 1, | |
'chemical-senses.csl' => 1, | |
'chemical-and-pharmaceutical-bulletin.csl' => 1, | |
'changer-d-epoque.csl' => 1, | |
'ceska-zemedelska-univerzita-v-praze-fakulta-agrobiologie-potravinovych-a-prirodnich-zdroju.csl' => 1, | |
'cerebral-cortex.csl' => 1, | |
'centre-de-recherche-sur-les-civilisations-de-l-asie-orientale.csl' => 1, | |
'centaurus.csl' => 1, | |
'cellular-and-molecular-bioengineering.csl' => 1, | |
'chicago-fullnote-bibliography-fr.csl' => 1, | |
'cell.csl' => 1, | |
'cell-transplantation.csl' => 1, | |
'cell-research.csl' => 1, | |
'cell-numeric.csl' => 1, | |
'catholic-biblical-association.csl' => 1, | |
'cardiocore.csl' => 1, | |
'carcinogenesis.csl' => 1, | |
'carbohydrate-research.csl' => 1, | |
'canadian-public-policy.csl' => 1, | |
'canadian-journal-of-fisheries-and-aquatic-sciences.csl' => 1, | |
'canadian-journal-of-economics.csl' => 1, | |
'canadian-journal-of-dietetic-practice-and-research.csl' => 1, | |
'campus-adventiste-du-saleve-faculte-adventiste-de-theologie.csl' => 1, | |
'chicago-figures.csl' => 1, | |
'chicago-fullnote-bibliography-no-ibid.csl' => 1, | |
'byzantina-symmeikta.csl' => 1, | |
'clays-and-clay-minerals.csl' => 1, | |
'collection-du-centre-jean-berard.csl' => 1, | |
'collection-de-l-ecole-francaise-de-rome-note.csl' => 1, | |
'collection-de-l-ecole-francaise-de-rome-full-note.csl' => 1, | |
'cold-spring-harbor-laboratory-press.csl' => 1, | |
'cns-and-neurological-disorders-drug-targets.csl' => 1, | |
'clio-medica.csl' => 1, | |
'clinical-pharmacology-and-therapeutics.csl' => 1, | |
'clinical-otolaryngology.csl' => 1, | |
'clinical-orthopaedics-and-related-research.csl' => 1, | |
'clinical-nuclear-medicine.csl' => 1, | |
'clinical-infectious-diseases.csl' => 1, | |
'clinical-gastroenterology-and-hepatology.csl' => 1, | |
'clinica-e-investigacion-en-arteriosclerosis.csl' => 1, | |
'clay-minerals.csl' => 1, | |
'chicago-fullnote-bibliography.csl' => 1, | |
'clara-architecture-recherche.csl' => 1, | |
'cladistics.csl' => 1, | |
'cirugia-espanola.csl' => 1, | |
'cirugia-cardiovascular.csl' => 1, | |
'circulation.csl' => 1, | |
'chroniques-des-activites-archeologiques-de-l-ecole-francaise-de-rome.csl' => 1, | |
'chinese-journal-of-aeronautics.csl' => 1, | |
'chinese-gb7714-2005-numeric.csl' => 1, | |
'chinese-gb7714-2005-author-date.csl' => 1, | |
'chinese-gb7714-1987-numeric.csl' => 1, | |
'chimia.csl' => 1, | |
'chicago-note-bibliography.csl' => 1, | |
'chicago-note-biblio-no-ibid.csl' => 1, | |
'chicago-library-list.csl' => 1, | |
'cahiers-du-centre-gustave-glotz.csl' => 1, | |
'bulletin-of-marine-science.csl' => 1, | |
'collections-electroniques-de-l-inha-full-note.csl' => 1, | |
'beltz-padagogik.csl' => 1, | |
'biological-psychiatry.csl' => 1, | |
'biological-journal-of-the-linnean-society.csl' => 1, | |
'biological-and-pharmaceutical-bulletin.csl' => 1, | |
'biologia.csl' => 1, | |
'bioinformatics.csl' => 1, | |
'bioessays.csl' => 1, | |
'bioelectromagnetics.csl' => 1, | |
'biochimica-et-biophysica-acta.csl' => 1, | |
'biochemistry.csl' => 1, | |
'biochemical-society-transactions.csl' => 1, | |
'biochemical-journal.csl' => 1, | |
'bioarchaeology-of-the-near-east.csl' => 1, | |
'bibtex.csl' => 1, | |
'babes-bolyai-university-faculty-of-orthodox-theology.csl' => 1, | |
'biology-of-reproduction.csl' => 1, | |
'aviation-space-and-environmental-medicine.csl' => 1, | |
'avian-pathology.csl' => 1, | |
'avian-diseases.csl' => 1, | |
'avian-conservation-and-ecology.csl' => 1, | |
'austrian-legal.csl' => 1, | |
'australian-veterinary-journal.csl' => 1, | |
'australian-journal-of-grape-and-wine-research.csl' => 1, | |
'australian-journal-of-earth-sciences.csl' => 1, | |
'australian-historical-studies.csl' => 1, | |
'australian-guide-to-legal-citation.csl' => 1, | |
'australian-critical-care.csl' => 1, | |
'australasian-emergency-nursing-journal.csl' => 1, | |
'austral-ecology.csl' => 1, | |
'biological-reviews.csl' => 1, | |
'biomed-central.csl' => 1, | |
'bulletin-of-faculty-of-pharmacy-cairo-university.csl' => 1, | |
'brain.csl' => 1, | |
'bulletin-de-la-societe-prehistorique-francaise.csl' => 1, | |
'building-structure.csl' => 1, | |
'british-journal-of-surgery.csl' => 1, | |
'british-journal-of-political-science.csl' => 1, | |
'british-journal-of-pharmacology.csl' => 1, | |
'british-journal-of-industrial-relations.csl' => 1, | |
'british-journal-of-haematology.csl' => 1, | |
'british-journal-of-dermatology.csl' => 1, | |
'british-journal-of-cancer.csl' => 1, | |
'british-journal-of-anaesthesia.csl' => 1, | |
'british-ecological-society.csl' => 1, | |
'briefings-in-bioinformatics.csl' => 1, | |
'brazilian-journal-of-infectious-diseases.csl' => 1, | |
'boreal-environment-research.csl' => 1, | |
'biomed-research-international.csl' => 1, | |
'body-and-society.csl' => 1, | |
'bmj.csl' => 1, | |
'bluebook2.csl' => 1, | |
'bluebook-law-review.csl' => 1, | |
'bluebook-inline.csl' => 1, | |
'blood.csl' => 1, | |
'biotropica.csl' => 1, | |
'biotechnology-and-bioengineering.csl' => 1, | |
'biotechniques.csl' => 1, | |
'bioresources.csl' => 1, | |
'biopolymers.csl' => 1, | |
'biophysical-journal.csl' => 1, | |
'bioorganic-and-medicinal-chemistry-letters.csl' => 1, | |
'biometrics.csl' => 1, | |
'collections-electroniques-de-l-inha-author-date.csl' => 1, | |
'colombian-journal-of-anesthesiology.csl' => 1, | |
'evolution.csl' => 1, | |
'enfermeria-clinica.csl' => 1, | |
'environmental-toxicology-and-chemistry.csl' => 1, | |
'environmental-microbiology.csl' => 1, | |
'environmental-health-perspectives.csl' => 1, | |
'environmental-conservation.csl' => 1, | |
'environmental-chemistry.csl' => 1, | |
'environmental-and-engineering-geoscience.csl' => 1, | |
'environment-and-urbanization.csl' => 1, | |
'environment-and-planning.csl' => 1, | |
'entomological-society-of-america.csl' => 1, | |
'entomologia-experimentalis-et-applicata.csl' => 1, | |
'ens-de-lyon-centre-d-ingenierie-documentaire.csl' => 1, | |
'engineering-in-life-sciences.csl' => 1, | |
'enfermeria-intensiva.csl' => 1, | |
'endoscopia.csl' => 1, | |
'epidemiologie-et-sante-animale.csl' => 1, | |
'endocrinologia-y-nutricion.csl' => 1, | |
'endocrine-press.csl' => 1, | |
'emu-austral-ornithology.csl' => 1, | |
'emerald-harvard.csl' => 1, | |
'embo-reports.csl' => 1, | |
'elsevier-without-titles.csl' => 1, | |
'elsevier-with-titles.csl' => 1, | |
'elsevier-with-titles-alphabetical.csl' => 1, | |
'elsevier-vancouver.csl' => 1, | |
'elsevier-harvard2.csl' => 1, | |
'elsevier-harvard.csl' => 1, | |
'elsevier-harvard-without-titles.csl' => 1, | |
'el-profesional-de-la-informacion.csl' => 1, | |
'environnement-risques-et-sante.csl' => 1, | |
'equine-veterinary-education.csl' => 1, | |
'ecosistemas.csl' => 1, | |
'european-journal-of-international-law.csl' => 1, | |
'evolution-and-development.csl' => 1, | |
'european-union-interinstitutional-style-guide.csl' => 1, | |
'european-society-of-cardiology.csl' => 1, | |
'european-retail-research.csl' => 1, | |
'european-respiratory-journal.csl' => 1, | |
'european-journal-of-vascular-and-endovascular-surgery.csl' => 1, | |
'european-journal-of-surgical-oncology.csl' => 1, | |
'european-journal-of-soil-science.csl' => 1, | |
'european-journal-of-political-research.csl' => 1, | |
'european-journal-of-pain.csl' => 1, | |
'european-journal-of-paediatric-neurology.csl' => 1, | |
'european-journal-of-ophthalmology.csl' => 1, | |
'european-journal-of-neuroscience.csl' => 1, | |
'european-journal-of-information-systems.csl' => 1, | |
'equine-veterinary-journal.csl' => 1, | |
'european-journal-of-immunology.csl' => 1, | |
'european-journal-of-human-genetics.csl' => 1, | |
'european-journal-of-emergency-medicine.csl' => 1, | |
'european-journal-of-clinical-microbiology-and-infectious-diseases.csl' => 1, | |
'european-cells-and-materials.csl' => 1, | |
'europace.csl' => 1, | |
'ets-ecole-de-technologie-superieure.csl' => 1, | |
'ethnologie-francaise.csl' => 1, | |
'ethnobiology-and-conservation.csl' => 1, | |
'ethics-book-reviews.csl' => 1, | |
'escuela-nacional-de-antropologia-e-historia-short-note.csl' => 1, | |
'escuela-nacional-de-antropologia-e-historia-full-note.csl' => 1, | |
'escuela-nacional-de-antropologia-e-historia-author-date.csl' => 1, | |
'ergoscience.csl' => 1, | |
'ecosystems.csl' => 1, | |
'ecoscience.csl' => 1, | |
'comision-economica-para-america-latina-y-el-caribe.csl' => 1, | |
'cultivos-tropicales.csl' => 1, | |
'der-moderne-staat.csl' => 1, | |
'demographic-research.csl' => 1, | |
'decision-sciences.csl' => 1, | |
'de-buck.csl' => 1, | |
'database.csl' => 1, | |
'cytometry.csl' => 1, | |
'currents-in-biblical-research.csl' => 1, | |
'current-topics-in-medicinal-chemistry.csl' => 1, | |
'current-protocols.csl' => 1, | |
'current-proteomics.csl' => 1, | |
'current-opinion.csl' => 1, | |
'culture-medicine-and-psychiatry.csl' => 1, | |
'cultural-studies-of-science-education.csl' => 1, | |
'cuadernos-de-filologia-clasica.csl' => 1, | |
'deutsche-medizinische-wochenschrift.csl' => 1, | |
'critical-care-medicine.csl' => 1, | |
'creativity-and-innovation-management.csl' => 1, | |
'cranfield-university-numeric.csl' => 1, | |
'council-of-science-editors.csl' => 1, | |
'council-of-science-editors-author-date.csl' => 1, | |
'council-of-science-editors-alphabetical.csl' => 1, | |
'corrosion.csl' => 1, | |
'coral-reefs.csl' => 1, | |
'copernicus-publications.csl' => 1, | |
'conservation-physiology.csl' => 1, | |
'conservation-letters.csl' => 1, | |
'conservation-biology.csl' => 1, | |
'computer-und-recht.csl' => 1, | |
'communication-et-langages.csl' => 1, | |
'deutsche-gesellschaft-fur-psychologie.csl' => 1, | |
'deutsche-sprache.csl' => 1, | |
'economie-et-statistique.csl' => 1, | |
'drug-testing-and-analysis.csl' => 1, | |
'economic-commission-for-latin-america-and-the-caribbean.csl' => 1, | |
'ecology.csl' => 1, | |
'ecology-letters.csl' => 1, | |
'ecology-and-society.csl' => 1, | |
'ecological-entomology.csl' => 1, | |
'ecole-pratique-des-hautes-etudes-sciences-historiques-et-philologiques.csl' => 1, | |
'ecclesial-practices.csl' => 1, | |
'earthquake-engineering-and-structural-dynamics.csl' => 1, | |
'earth-surface-processes-and-landforms.csl' => 1, | |
'early-medieval-europe.csl' => 1, | |
'early-christianity.csl' => 1, | |
'ear-and-hearing.csl' => 1, | |
'drugs-of-today.csl' => 1, | |
'drug-development-research.csl' => 1, | |
'deutsches-archaologisches-institut.csl' => 1, | |
'documents-d-archeologie-francaise.csl' => 1, | |
'dna-research.csl' => 1, | |
'disability-and-rehabilitation.csl' => 1, | |
'diplo.csl' => 1, | |
'din-1505-2.csl' => 1, | |
'din-1505-2-numeric.csl' => 1, | |
'din-1505-2-numeric-alphabetical.csl' => 1, | |
'din-1505-2-alphanumeric.csl' => 1, | |
'die-bachelorarbeit-samac-et-al-note.csl' => 1, | |
'die-bachelorarbeit-samac-et-al-in-text.csl' => 1, | |
'diatom-research.csl' => 1, | |
'dialisis-y-trasplante.csl' => 1, | |
'diagnostico-prenatal.csl' => 1, | |
'development-policy-review.csl' => 1, | |
'baffordweblibbundle.php' => 1, | |
'boundinteger.php' => 1, | |
'baffordcsscolorvalidatorbundle.php' => 1, | |
'smartcorebundle.php' => 1, | |
'widgetmodule.php' => 1, | |
'webformmodule.php' => 1, | |
'unicatmodule.php' => 1, | |
'textermodule.php' => 1, | |
'simplenewsmodule.php' => 1, | |
'gallerymodule.php' => 1, | |
'breadcrumbsmodule.php' => 1, | |
'smartmediabundleusecases.php' => 1, | |
'smartmediabundle.php' => 1, | |
'htmlbundle.php' => 1, | |
'felibbundle.php' => 1, | |
'smartdbdumperbundle.php' => 1, | |
'cmsgeneratorbundle.php' => 1, | |
'smartseobundle.php' => 1, | |
'cmsappkernel.php' => 1, | |
'cacheclearerservice.php' => 1, | |
'acceleratorcacheclearer.php' => 1, | |
'acceleratorcachebundle.php' => 1, | |
'uncia.php' => 1, | |
'bare.php' => 1, | |
'safehtml.php' => 1, | |
'slikio.php' => 1, | |
'sleepnessubertranslationbundle.php' => 1, | |
'sleepnessubertranslationadminbundle.php' => 1, | |
'sleepnessuberfrontendvalidationbundle.php' => 1, | |
'hoauthadminaction.php' => 1, | |
'smartricheditorbundle.php' => 1, | |
'smartcoresessionbundle.php' => 1, | |
'dummyuseridentity.php' => 1, | |
'domainmessage.php' => 1, | |
'soclozeventqueuebundle.php' => 1, | |
'socloznsqbundle.php' => 1, | |
'goutte.phar' => 1, | |
'frontend.php' => 1, | |
'snceutilitybundle.php' => 1, | |
'snceezpublishlegacyutilitybundle.php' => 1, | |
'errorcontroller.php' => 1, | |
'objectselfserializer.php' => 1, | |
'eventsourcedrepository.php' => 1, | |
'aggregateroot.php' => 1, | |
'projectenableddispatcher.php' => 1, | |
'simpleeventbus.php' => 1, | |
'domaineventstream.php' => 1, | |
'smartsettingsbundle.php' => 1, | |
'simplecommandtranslator.php' => 1, | |
'simplecommandhandlerresolver.php' => 1, | |
'commandhandlermiddleware.php' => 1, | |
'basecommand.php' => 1, | |
'smilesimplepageviewbundle.php' => 1, | |
'testsettings-dist.php' => 1, | |
'example-full.php' => 1, | |
'smartrockuserbundle.php' => 1, | |
'smartgeckothriftbundle.php' => 1, | |
'governorframeworkbundle.php' => 1, | |
'externalresource.php' => 1, | |
'smartsitemapbundle.php' => 1, | |
'smartsimpleprofilerbundle.php' => 1, | |
'hoauthaction.php' => 1, | |
'slaxer' => 1, | |
'soclozmonitoringbundle.php' => 1, | |
'linkshere_body.php' => 1, | |
'alink.i18n.php' => 1, | |
'alink.i18n.magic.php' => 1, | |
'aform_body.php' => 1, | |
'aform.php' => 1, | |
'aform.i18n.php' => 1, | |
'aform.i18n.magic.php' => 1, | |
'userpageinfo_body.php' => 1, | |
'userpageinfo.php' => 1, | |
'userpageinfo.i18n.php' => 1, | |
'userpageinfo.i18n.magic.php' => 1, | |
'mailman.php' => 1, | |
'mailman.i18n.php' => 1, | |
'linkshere.php' => 1, | |
'alink_body.php' => 1, | |
'gravatar_body.php' => 1, | |
'gravatar.i18n.php' => 1, | |
'gravatar.i18n.magic.php' => 1, | |
'getuserinfo_body.php' => 1, | |
'getuserinfo.php' => 1, | |
'getuserinfo.i18n.php' => 1, | |
'getuserinfo.i18n.magic.php' => 1, | |
'getpageinfo.php' => 1, | |
'getpageinfo.body.php' => 1, | |
'extracttext_body.php' => 1, | |
'extracttext.php' => 1, | |
'extracttext.i18n.php' => 1, | |
'extracttext.i18n.magic.php' => 1, | |
'alink.php' => 1, | |
'linkrel.i18n.magic.php' => 1, | |
'street.php' => 1, | |
'sithousnetsuitebundle.php' => 1, | |
'building.php' => 1, | |
'apartment.php' => 1, | |
'sizanniatranslationbundle.php' => 1, | |
'sizanniajquerytoolsbundle.php' => 1, | |
'sizanniaeditorbundle.php' => 1, | |
'sizanniadataanalyticsbundle.php' => 1, | |
'imodule.php' => 1, | |
'deuton.sample.ini' => 1, | |
'param.php' => 1, | |
'opt.php' => 1, | |
'deuton.php' => 1, | |
'abort.php' => 1, | |
'sithousantispambundle.php' => 1, | |
'linkrel.i18n.php' => 1, | |
'exemples.php' => 1, | |
'sglim' => 1, | |
'config.sh' => 1, | |
'flyr.zip' => 1, | |
'suffixbehavior.php' => 1, | |
'mailqueue.neon.example' => 1, | |
'typo3cms' => 1, | |
'simonsimcityliipimaginewatermarkfilterbundle.php' => 1, | |
'simonsimcitygetid3bundle.php' => 1, | |
'simonsimcitycouchbasebundle.php' => 1, | |
'ansi.php' => 1, | |
'linkrel_body.php' => 1, | |
'linkrel.php' => 1, | |
'soclozfeatureflagbundle.php' => 1, | |
'gh-pages.sh' => 1, | |
'docviewer.php' => 1, | |
'classinfo_html.php' => 1, | |
'commanduserbundle.php' => 1, | |
'spomkylabsrolehierarchybundle.php' => 1, | |
'spomkylabsoauth2serverbundle.php' => 1, | |
'extensionwithplugins.php' => 1, | |
'configurationwithplugins.php' => 1, | |
'bundlewithplugins.php' => 1, | |
'bundleplugininterface.php' => 1, | |
'spomkylabsjosebundle.php' => 1, | |
'spomkylabsipfilterbundle.php' => 1, | |
'spikeointltelbundle.php' => 1, | |
'speicher210cloudinarybundle.php' => 1, | |
'spfixturedumperbundle.php' => 1, | |
'sparkreflection.php' => 1, | |
'bprsassetbundle.php' => 1, | |
'basics.php' => 1, | |
'fixers' => 1, | |
'soulboundawscloudsearchbundle.php' => 1, | |
'php-export-data.class.php' => 1, | |
'dtd-parser.iml' => 1, | |
'soothsilverdtdparser.php' => 1, | |
'extyii.php' => 1, | |
'classdiagram.png' => 1, | |
'classdiagram.dia' => 1, | |
'yamlstorage.php' => 1, | |
'parametersstorage.php' => 1, | |
'configstorage.php' => 1, | |
'spraedvcardbundle.php' => 1, | |
'bprsassetevent.php' => 1, | |
'slot.php' => 1, | |
'kcfinderinput.php' => 1, | |
'openssl.conf' => 1, | |
'opensslca.php' => 1, | |
'laravel-docker' => 1, | |
'overlayasset.php' => 1, | |
'debugpanelasset.php' => 1, | |
'crontask.php' => 1, | |
'cronservice.php' => 1, | |
'cronprocess.php' => 1, | |
'documents.json' => 1, | |
'documents-sample.json' => 1, | |
'stephanemanginangularjwtauthenticationbundle.php' => 1, | |
'kcfinderselectasset.php' => 1, | |
'yii2boletos.php' => 1, | |
'bprscommandlinebundle.php' => 1, | |
'smalltal.php' => 1, | |
'smalltal.tests.php' => 1, | |
'smalltal.compiler.php' => 1, | |
'neartal.php' => 1, | |
'neartal.tests.php' => 1, | |
'neartal.compiler.php' => 1, | |
'license.agpl-3.0' => 1, | |
'testwidget.php' => 1, | |
'piha.sh' => 1, | |
'staglag13womtestbundle.php' => 1, | |
'cli_run.php' => 1, | |
'bprsuserbundle.php' => 1, | |
'bprsstylebundle.php' => 1, | |
'arraystorage.php' => 1, | |
'uriservice.php' => 1, | |
'webpackpublishplugin.js' => 1, | |
'corrector.php' => 1, | |
'single-esdeveniment.php' => 1, | |
'plantilla-text-menuleft.php' => 1, | |
'plantilla-steps.php' => 1, | |
'plantilla-distribuidora-02.php' => 1, | |
'plantilla-distribuidora-02-auto.php' => 1, | |
'plantilla-distribuidora-01.php' => 1, | |
'plantilla-distribuidora-01-auto.php' => 1, | |
'planeta.php' => 1, | |
'home-sc.php' => 1, | |
'dist-recursos_traductors.php' => 1, | |
'dist-eines_consulta.php' => 1, | |
'diccionari-multilingue.php' => 1, | |
'contacte.php' => 1, | |
'single-projecte.php' => 1, | |
'archive-projecte.php' => 1, | |
'archive-programa.php' => 1, | |
'archive-esdeveniment.php' => 1, | |
'aparell.php' => 1, | |
'sc-shortcodes.php' => 1, | |
'sc-normalize-upload-dir.php' => 1, | |
'sc-importer.php' => 1, | |
'scfootnotes.php' => 1, | |
'scfootnotes.js' => 1, | |
'mce-table-buttons-class.php' => 1, | |
'logboardbundle.php' => 1, | |
'soclemissingtypebundle.php' => 1, | |
'socleintldatetimeformatbundle.php' => 1, | |
'single-programa.php' => 1, | |
'sinonims.php' => 1, | |
'solve' => 1, | |
'formulaire.php' => 1, | |
'httpstatus.php' => 1, | |
'headerstorage.php' => 1, | |
'fsservice.php' => 1, | |
'eventstate.php' => 1, | |
'eventpriority.php' => 1, | |
'dependencyunit.php' => 1, | |
'dependencycontainer.php' => 1, | |
'qc.php' => 1, | |
'dataprocessortest.php' => 1, | |
'dataprocessor.php' => 1, | |
'soloistbaseadminbundle.php' => 1, | |
'tester.php' => 1, | |
'fastconfig.php' => 1, | |
'subpagina-programa.php' => 1, | |
'exceptioninternal.php' => 1, | |
'processtrait.php' => 1, | |
'trieur.php' => 1, | |
'sourcefilter.php' => 1, | |
'abstractformat.php' => 1, | |
'mysqldump.class.php' => 1, | |
'soipookentouserbundle.php' => 1, | |
'soipookentoadminbundle.php' => 1, | |
'theme-mover.php' => 1, | |
'traductor.php' => 1, | |
'taxonomy-esdeveniment_cat.php' => 1, | |
'taxonomy-categoria_projecte.php' => 1, | |
'subpagina-projecte.php' => 1, | |
'docviewer_body.php' => 1, | |
'docviewer.i18n.php' => 1, | |
'license-numeraljs' => 1, | |
'screeperactionbundle.php' => 1, | |
'textcutter.php' => 1, | |
'swmmailhookevent.php' => 1, | |
'swmmailhookbundle.php' => 1, | |
'reph.php' => 1, | |
'reph.phn' => 1, | |
'template_debug.php' => 1, | |
'pharen.php' => 1, | |
'lexical.php' => 1, | |
'lang.phn' => 1, | |
'screeperserverbundle.php' => 1, | |
'screeperplayerbundle.php' => 1, | |
'screeperjsonapibundle.php' => 1, | |
'screamzsecuredownloadbundle.php' => 1, | |
'php-console.js' => 1, | |
'htmlsample.html' => 1, | |
'googlechart.php' => 1, | |
'export2excelbehavior.php' => 1, | |
'downloadaction.php' => 1, | |
'shkpagebundle.php' => 1, | |
'details' => 1, | |
'chart.png' => 1, | |
'release.command' => 1, | |
'svdschedulerbundle.php' => 1, | |
'svdmediabundle.php' => 1, | |
'sceniccitylabsoauthbundle.php' => 1, | |
'changelog-5.8' => 1, | |
'jquery-1.9.1.min.js' => 1, | |
'selenesoftwarespressplugindeployaws.php' => 1, | |
'user-data.tpl.sh' => 1, | |
'semanticwatchlist.hooks.php' => 1, | |
'wp-dashboard-log-monitor.php' => 1, | |
'wp-custom-bulk-actions.php' => 1, | |
'lake' => 1, | |
'budgegeriadatetimebundle.php' => 1, | |
'datacollectorbundle.php' => 1, | |
'sendmachineapiclient.php' => 1, | |
'sempredfacebookbundle.php' => 1, | |
'whatsnearby.php' => 1, | |
'semanticwatchlist.settings.php' => 1, | |
'semanticwatchlist.php' => 1, | |
'semanticwatchlist.i18n.php' => 1, | |
'semanticwatchlist.i18n.alias.php' => 1, | |
'semanticsignup.php' => 1, | |
'example.phpunit.xml.dist' => 1, | |
'semanticmetatags.php' => 1, | |
'semanticmediawiki.settings.php' => 1, | |
'semanticmediawiki.php' => 1, | |
'semanticmediawiki.hooks.php' => 1, | |
'semanticmaps.php' => 1, | |
'semanticmaps.hooks.php' => 1, | |
'sm_settings.php' => 1, | |
'semanticinterlanguagelinks.php' => 1, | |
'semanticglossary.php' => 1, | |
'semanticformsselect.php' => 1, | |
'semanticextraspecialproperties.php' => 1, | |
'semanticexternalquerylookup.php' => 1, | |
'semanticcite.php' => 1, | |
'changelog-5.10' => 1, | |
'options-icon.png' => 1, | |
'wp-frontend-profile.php' => 1, | |
'statementiteratorfactory.php' => 1, | |
'bspaccountingbundle.php' => 1, | |
'breakouthelper.php' => 1, | |
'sstwitterbundle.php' => 1, | |
'parallaxbundle.php' => 1, | |
'url_rewriting' => 1, | |
'sparqlutils.php' => 1, | |
'saft.wordpress.php' => 1, | |
'chainablestore.php' => 1, | |
'basictriplepatternstore.php' => 1, | |
'abstracttriplepatternstore.php' => 1, | |
'abstractsparqlstore.php' => 1, | |
'statementiteratorfactoryimpl.php' => 1, | |
'statementiterator.php' => 1, | |
'activemongocursor.php' => 1, | |
'statementimpl.php' => 1, | |
'statementfactoryimpl.php' => 1, | |
'statementfactory.php' => 1, | |
'nodeutils.php' => 1, | |
'nodefactoryimpl.php' => 1, | |
'nodefactory.php' => 1, | |
'namednodeimpl.php' => 1, | |
'namednode.php' => 1, | |
'literalpatternimpl.php' => 1, | |
'literalimpl.php' => 1, | |
'literal.php' => 1, | |
'blanknodeimpl.php' => 1, | |
'blanknode.php' => 1, | |
'logroute.php' => 1, | |
'indexcontroller.php' => 1, | |
'logo-white.png' => 1, | |
'samsondatagridbundle.php' => 1, | |
'internal' => 1, | |
'satoripopimagesbundle.php' => 1, | |
'sarsportuserbundle.php' => 1, | |
'sarsportapplicationbundle.php' => 1, | |
'stnwechatbundle.php' => 1, | |
'stnstatemachinebundle.php' => 1, | |
'samsonyoutrackbundle.php' => 1, | |
'samsonunexpectedresponsebundle.php' => 1, | |
'samsonsimplerknppaginatorbundle.php' => 1, | |
'samsonreleasebundle.php' => 1, | |
'samsonfilterbundle.php' => 1, | |
'samsondataviewbundle.php' => 1, | |
'samsonautocompletebundle.php' => 1, | |
'elephantio.php' => 1, | |
'samsonangularroutingbundle.php' => 1, | |
'rackspace.php' => 1, | |
'jquery.qtip.min.map' => 1, | |
'jquery.qtip.min.js' => 1, | |
'jquery.qtip.min.css' => 1, | |
'jquery.qtip.js' => 1, | |
'jquery.qtip.css' => 1, | |
'imagesloaded.pkg.min.js' => 1, | |
'qtipasset.php' => 1, | |
'qtip.php' => 1, | |
'outdatedbrowserasset.php' => 1, | |
'outdatedbrowser.php' => 1, | |
'keycdn.php' => 1, | |
'wp-fetch-social-posts.php' => 1, | |
'wp-hq-responsive-youtube-embed.php' => 1, | |
'docviewer.i18n.magic.php' => 1, | |
'basewpapi.php' => 1, | |
'arnmmediabundle.php' => 1, | |
'arnmcorebundle.php' => 1, | |
'arnmcontentbundle.php' => 1, | |
'arnmcontactbundle.php' => 1, | |
'configbundleinfo.php' => 1, | |
'arnmconfigbundle.php' => 1, | |
'arnmcatalogbundle.php' => 1, | |
'arnmartistbundle.php' => 1, | |
'arrayfinder.php' => 1, | |
'wpapiexception.php' => 1, | |
'orgwpapi.php' => 1, | |
'comwpapi.php' => 1, | |
'apirequest.php' => 1, | |
'arnmmenubundle.php' => 1, | |
'ilinkoscope.php' => 1, | |
'iapihandler.php' => 1, | |
'orglinkoscope.php' => 1, | |
'getlinksresult.php' => 1, | |
'getlinksrequest.php' => 1, | |
'getcommentsresult.php' => 1, | |
'getcommentsrequest.php' => 1, | |
'comlinkoscope.php' => 1, | |
'libs.php' => 1, | |
'twisto.php' => 1, | |
'shareddbresponse.php' => 1, | |
'orderitem.php' => 1, | |
'neworder.php' => 1, | |
'mediacontentbundle.php' => 1, | |
'arnmpagesbundle.php' => 1, | |
'checkresponse.php' => 1, | |
'silvestramediabundle.php' => 1, | |
'silvestratextnodebundle.php' => 1, | |
'silvestratextbundle.php' => 1, | |
'silvestrasitemapbundle.php' => 1, | |
'silvestraseobundle.php' => 1, | |
'seopageinterface.php' => 1, | |
'seopage.php' => 1, | |
'silvestrasandboxbundle.php' => 1, | |
'silvestrapaginatorbundle.php' => 1, | |
'urlhelper.php' => 1, | |
'templatinghelperinterface.php' => 1, | |
'silvestranotificationbundle.php' => 1, | |
'alertmanager.php' => 1, | |
'silvestralocalebundle.php' => 1, | |
'arnmwidgetbundle.php' => 1, | |
'silvestrafrontendbundle.php' => 1, | |
'silvestraformbundle.php' => 1, | |
'keyvaluearray.php' => 1, | |
'silvestracachebundle.php' => 1, | |
'silvestrabannerbundle.php' => 1, | |
'bannerzonesynchronizer.php' => 1, | |
'silvestraadminuserbundle.php' => 1, | |
'silvestraadminbundle.php' => 1, | |
'silverkixcmsbundle.php' => 1, | |
'simpleorm.php' => 1, | |
'containerawarecommand.php' => 1, | |
'sibsetaopfeaturebundle.php' => 1, | |
'jwthttpbearerauth.php' => 1, | |
'customer.php' => 1, | |
'bareorder.php' => 1, | |
'admin-readme.html' => 1, | |
'employee.php' => 1, | |
'sflsettingsbundle.php' => 1, | |
'sflpagebundle.php' => 1, | |
'sflgoogleapibundle.php' => 1, | |
'sendpulseinterface.php' => 1, | |
'sendpulse.php' => 1, | |
'dtobundle.php' => 1, | |
'smsaero.php' => 1, | |
'econfig.php' => 1, | |
'sergsxmuibundle.php' => 1, | |
'schedulewidget.php' => 1, | |
'rgobjecttrait.php' => 1, | |
'employeegroup.php' => 1, | |
'pushmenuwidget.php' => 1, | |
'hidenamespace.i18n.magic.php' => 1, | |
'bootstrowidget.php' => 1, | |
'inbapiauthenticationbundle.php' => 1, | |
'editlinkasset.php' => 1, | |
'editlink.php' => 1, | |
'siphash_apache.so' => 1, | |
'siphash.so' => 1, | |
'serializebehavior.php' => 1, | |
'searchlucene.php' => 1, | |
'menubuilderassets.php' => 1, | |
'simple-header-footer-html.php' => 1, | |
'wp-multisite-plugin-statistics.php' => 1, | |
'link-relative.js' => 1, | |
'https-domain-alias.php' => 1, | |
'breadcrumb.css' => 1, | |
'hidenamespace.i18n.php' => 1, | |
'barecustomer.php' => 1, | |
'shaygantelegrambotapibundle.php' => 1, | |
'bareaddress.php' => 1, | |
'shoplobundle.php' => 1, | |
'.shootproof-sample' => 1, | |
'shonmresquebundle.php' => 1, | |
'resqueevents.php' => 1, | |
'chesscomhoneybadgerbundle.php' => 1, | |
'usoftidealbundle.php' => 1, | |
'abstracttranslationbundle.php' => 1, | |
'class-jp-tax-query.php' => 1, | |
'jp-rest-cache.php' => 1, | |
'class-jp-menu-api.php' => 1, | |
'telegrambotapi.php' => 1, | |
'shayganaffiliateevents.php' => 1, | |
'hidenamespace.php' => 1, | |
'shayganaffiliatebundle.php' => 1, | |
'increment.php' => 1, | |
'generalizing' => 1, | |
'feature.php' => 1, | |
'shakepeers.php' => 1, | |
'myscripts.js' => 1, | |
'mising-trads' => 1, | |
'custom.css' => 1, | |
'shakepeers.skin.php' => 1, | |
'sitelinkssearchbox.php' => 1, | |
'pagecreator.php' => 1, | |
'pagecontributors.php' => 1, | |
'pagecontributors.i18n.magic.php' => 1, | |
'stillat_common.png' => 1, | |
'license-numbro' => 1, | |
'anypatternimpl.php' => 1, | |
'stop.sh' => 1, | |
'thibautg16squelettebundle.php' => 1, | |
'theratbranchingbundle.php' => 1, | |
'appfile' => 1, | |
'aws.config.yml' => 1, | |
'thephalconsamazonwebservicesbundle.php' => 1, | |
'basesocketlistener.php' => 1, | |
'settingtrait.php' => 1, | |
'mongoclient.php' => 1, | |
'utilities.sublime-project' => 1, | |
'tumblr-parser.sublime-project' => 1, | |
'rating.sublime-project' => 1, | |
'phpcsrs.sublime-project' => 1, | |
'start-mua.sh' => 1, | |
'sitebuild' => 1, | |
'start-daemon.sh' => 1, | |
'phpchat.sublime-project' => 1, | |
'listports.sh' => 1, | |
'macho.sublime-project' => 1, | |
'dbg.sh' => 1, | |
'config.check.sh' => 1, | |
'imapd.sublime-project' => 1, | |
'html2markdown.sublime-project' => 1, | |
'hashcash.sublime-project' => 1, | |
'assembly.sublime-project' => 1, | |
'masonry' => 1, | |
'fscrestbundle.php' => 1, | |
'new text document' => 1, | |
'dist.configuration.php' => 1, | |
'fscp3pbundle.php' => 1, | |
'wpsimplemapper.class.php' => 1, | |
'kendobuild.php' => 1, | |
'tigreboitefunkylabbundle.php' => 1, | |
'.gitiignore' => 1, | |
'ticketparkpingenbundle.php' => 1, | |
'ticketparkpdfbundle.php' => 1, | |
'ticketparklocalebundle.php' => 1, | |
'ticketparkimagebundle.php' => 1, | |
'ticketparkfilebundle.php' => 1, | |
'ticketparkexpiringurlbundle.php' => 1, | |
'ticketparkexcelbundle.php' => 1, | |
'ticketparkdynamicrolebundle.php' => 1, | |
'ticketparkbarcodebundle.php' => 1, | |
'wpsimpledao.class.php' => 1, | |
'start_phantomjs.sh' => 1, | |
'plib.class.php' => 1, | |
'phpgamification.class.php' => 1, | |
'dao.class.php' => 1, | |
'phalconfilter.php' => 1, | |
'ar_migrate' => 1, | |
'test_configs.php' => 1, | |
'ar_benchmark' => 1, | |
'tctwigglobalbundle.php' => 1, | |
'tctwigdefaultbundle.php' => 1, | |
'tcpjaxbundle.php' => 1, | |
'pool.php' => 1, | |
'controllable.php' => 1, | |
'start_selenium.sh' => 1, | |
'responsedecorator.php' => 1, | |
'fschateoasbundle.php' => 1, | |
'git_env.reg' => 1, | |
'teckhousemdetectbundle.php' => 1, | |
'tecnocreacionesvzlafixturesbundle.php' => 1, | |
'tecnocreacionesvzlaentitybundle.php' => 1, | |
'tecnocreacionesvzlaapibundle.php' => 1, | |
'toolsevents.php' => 1, | |
'tecnocreacionestoolsbundle.php' => 1, | |
'tecnocreacionesresourcebundle.php' => 1, | |
'tecnocreacionesinstallbundle.php' => 1, | |
'tecnocreacionescrmtemplatebundle.php' => 1, | |
'btobsocialnetworkentitybundle.php' => 1, | |
'btobsocialnetworkcorebundle.php' => 1, | |
'tecnocreacionesajaxfosuserbundle.php' => 1, | |
'tecnowordbundle.php' => 1, | |
'teckhouseanalyticsbundle.php' => 1, | |
'tecnocreacionesvzlatoolsbundle.php' => 1, | |
'techdatacontextdibundle.php' => 1, | |
'techdataas2securebundle.php' => 1, | |
'stormdeltalatexencoderannotationbundle.php' => 1, | |
'razorgatorfulfillmentapiv1.pdf' => 1, | |
'newtype.php' => 1, | |
'generate_model.php' => 1, | |
'usersbase.php' => 1, | |
'taysormbase.php' => 1, | |
'easyconnect.php' => 1, | |
'sqlbrainstorming.sql' => 1, | |
'librarianapinoodling.php' => 1, | |
'taoti_bootstrap.libraries.yml' => 1, | |
'taoti_bootstrap.info.yml' => 1, | |
'tecnocreacionesvzlagovernmentbundle.php' => 1, | |
'laravelpayzencontroller.php' => 1, | |
'fscemailfilterbundle.php' => 1, | |
'th3moukdoctrinetableprefixbundle.php' => 1, | |
'dotcommercefastentitybundle.php' => 1, | |
'northwind.sql' => 1, | |
'architect' => 1, | |
'tbbcrestutilbundle.php' => 1, | |
'composer-template.json' => 1, | |
'tbbcmoneyevents.php' => 1, | |
'tbbcmoneybundle.php' => 1, | |
'moneyexception.php' => 1, | |
'tbbccachebundle.php' => 1, | |
'classnotfoundexception.php' => 1, | |
'th3moukyahooweatherbundle.php' => 1, | |
'th3moukplanningbundle.php' => 1, | |
'th3moukcmssiteplanbundle.php' => 1, | |
'laravelpayzenserviceprovider.php' => 1, | |
'th3moukcmssimplecontentmanagerbundle.php' => 1, | |
'th3moukcmspagebundle.php' => 1, | |
'th3moukcmscorebundle.php' => 1, | |
'textrazor.php' => 1, | |
'mhosts.php' => 1, | |
'php7exceptions.php' => 1, | |
'telerivet.php' => 1, | |
'telemessage_web.phar' => 1, | |
'sellsy-plugin.php' => 1, | |
'asteriskmanager.php' => 1, | |
'agi.php' => 1, | |
'tehrancodeyahooapibundle.php' => 1, | |
'payzenformtoolbox.php' => 1, | |
'symfonianindonesiagammubundle.php' => 1, | |
'simplethingszetawebmailbundle.php' => 1, | |
'testbannerbundle.php' => 1, | |
'ucssecuritybobundle.php' => 1, | |
'datagridcolumninterface.php' => 1, | |
'datagridcolumnconfigurationinterface.php' => 1, | |
'datagridcolumnconfiguration.php' => 1, | |
'datagridcolumn.php' => 1, | |
'abstractdatagridtype.php' => 1, | |
'currencycodeguesserinterface.php' => 1, | |
'ucsutilsbundle.php' => 1, | |
'userprofileevents.php' => 1, | |
'userlogevents.php' => 1, | |
'ucsusermodelbundle.php' => 1, | |
'ucsuserbobundle.php' => 1, | |
'ucssecuritymodelbundle.php' => 1, | |
'ucssearchbundle.php' => 1, | |
'datagridconfigurationinterface.php' => 1, | |
'ucsrichuibundle.php' => 1, | |
'ucsmailerbundle.php' => 1, | |
'ucshtmlgeneratorbundle.php' => 1, | |
'markupevents.php' => 1, | |
'ucsdatagridbundle.php' => 1, | |
'ucsbackofficebundle.php' => 1, | |
'ucsadminstrapbundle.php' => 1, | |
'efficientpaginator.php' => 1, | |
'ucsnewsbundle.php' => 1, | |
'newsevents.php' => 1, | |
'newsmediamanagerinterface.php' => 1, | |
'newsmediamanager.php' => 1, | |
'datagridconfiguration.php' => 1, | |
'datagridfactory.php' => 1, | |
'newsmedia.php' => 1, | |
'.arrayformtype.php.swp' => 1, | |
'autoload_test_function.php' => 1, | |
'autoload_test_classmap.php' => 1, | |
'ufo_license_ru' => 1, | |
'markupmanagerinterface.php' => 1, | |
'markupmanager.php' => 1, | |
'markupinterface.php' => 1, | |
'generatorfactoryinterface.php' => 1, | |
'generatorfactory.php' => 1, | |
'constraintfactoryinterface.php' => 1, | |
'constraintfactory.php' => 1, | |
'arrayformtype.php' => 1, | |
'arrayformdataparserinterface.php' => 1, | |
'datapropertytransformerinterface.php' => 1, | |
'datagridfactoryinterface.php' => 1, | |
'datapropertyinterface.php' => 1, | |
'datapropertyformatterregistryinterface.php' => 1, | |
'datapropertyformatterregistry.php' => 1, | |
'datapropertyformatterinterface.php' => 1, | |
'datapropertyconfigurationinterface.php' => 1, | |
'datapropertyconfiguration.php' => 1, | |
'dataproperty.php' => 1, | |
'datagridtypeinterface.php' => 1, | |
'datagridrowtransformerinterface.php' => 1, | |
'datagridrowformatterinterface.php' => 1, | |
'datagridrowformatter.php' => 1, | |
'datagridpreviewerinterface.php' => 1, | |
'datagridinterface.php' => 1, | |
'newsmediainterface.php' => 1, | |
'newsmanagerinterface.php' => 1, | |
'tgaaudiencebundle.php' => 1, | |
'tom32iuserbundle.php' => 1, | |
'translation.sql' => 1, | |
'views-info.png' => 1, | |
'server-info.png' => 1, | |
'request-info.png' => 1, | |
'database-info.png' => 1, | |
'atlassianstashintegrationplugin.php' => 1, | |
'traackr-api.sublime-project' => 1, | |
'upload.xml' => 1, | |
'etherpad-lite-client.php' => 1, | |
'api-spec.json' => 1, | |
'example-loader.php' => 1, | |
'interop.php' => 1, | |
'tom32iurlscannerbundle.php' => 1, | |
'phpunit-no-logging.xml' => 1, | |
'tom32isimplesecuritybundle.php' => 1, | |
'tom32ifilebundle.php' => 1, | |
'tom32icsvbundle.php' => 1, | |
'max' => 1, | |
'dbconnector.php' => 1, | |
'math' => 1, | |
'tinyview.php' => 1, | |
'reasons.php' => 1, | |
'tinyvalidator.php' => 1, | |
'showloading.php' => 1, | |
'panelmenu.php' => 1, | |
'advanced-rss-widget.php' => 1, | |
'tilowebpaginationbundle.php' => 1, | |
'treewebvalidationbundle.php' => 1, | |
'test_configuration.example.yml' => 1, | |
'newsmanager.php' => 1, | |
'guide_utilisation_magento2.docx' => 1, | |
'newsinterface.php' => 1, | |
'newsawareinterface.php' => 1, | |
'tmpvj91xg' => 1, | |
'mailercollection.php' => 1, | |
'defaultmailer.php' => 1, | |
'configurableactioninterface.php' => 1, | |
'actionsubjectinterface.php' => 1, | |
'actioninterface.php' => 1, | |
'actionevents.php' => 1, | |
'actionevent.php' => 1, | |
'actioncollection.php' => 1, | |
'user_guide_magento2.docx' => 1, | |
'txtonyarrowdbconnectorevents.php' => 1, | |
'mondrian.php' => 1, | |
'txtonyarrowdbconnectorbundle.php' => 1, | |
'sweet-qa' => 1, | |
'session_messages.php' => 1, | |
'tuxes3doctrineutilbundle.php' => 1, | |
'tohtmlmini.jpg' => 1, | |
'uglifycss-lib.js' => 1, | |
'uglifycss' => 1, | |
'serpri.php' => 1, | |
'serpri' => 1, | |
'tdsinflectorbundle.php' => 1, | |
'troissixmysqlpostfixadminbundle.php' => 1, | |
'trismegistewambundle.php' => 1, | |
'howtouse' => 1, | |
'taoti_bootstrap.breakpoints.yml' => 1, | |
'planned' => 1, | |
'stingerbootstrapmaxlengthjsbundle.php' => 1, | |
'precisions.php' => 1, | |
'catalog-1.0.mwb' => 1, | |
'walvasimplecmsbundle.php' => 1, | |
'ste.php' => 1, | |
'pathcompiler.php' => 1, | |
'hostcompiler.php' => 1, | |
'compilerinterface.php' => 1, | |
'resourceserver.php' => 1, | |
'refreshtokeninterface.php' => 1, | |
'mac.php' => 1, | |
'implicitgrantinterface.php' => 1, | |
'dynamicuriinterface.php' => 1, | |
'authcodeinterface.php' => 1, | |
'exchangerateexception.php' => 1, | |
'swpmultitenancybundle.php' => 1, | |
'nativedriver.php' => 1, | |
'modriver.php' => 1, | |
'directories.php' => 1, | |
'sqlitedriver.php' => 1, | |
'pgsqltableschema.php' => 1, | |
'pgsqldriver.php' => 1, | |
'mysqldriver.php' => 1, | |
'pdostatementinterface.php' => 1, | |
'pdointerface.php' => 1, | |
'yamlloader.php' => 1, | |
'xmlloader.php' => 1, | |
'nativeloader.php' => 1, | |
'swpbridgebundle.php' => 1, | |
'swpupdaterbundle.php' => 1, | |
'iniloader.php' => 1, | |
'ordershippingtransitions.php' => 1, | |
'resourceactions.php' => 1, | |
'serviceregistryinterface.php' => 1, | |
'prioritizedserviceregistryinterface.php' => 1, | |
'prioritizedserviceregistry.php' => 1, | |
'nonexistingserviceexception.php' => 1, | |
'existingserviceexception.php' => 1, | |
'paymenttransitions.php' => 1, | |
'ordertransitions.php' => 1, | |
'syliusmailerevents.php' => 1, | |
'syliusstockableevents.php' => 1, | |
'inventoryunittransitions.php' => 1, | |
'syliuscheckoutevents.php' => 1, | |
'orderpaymenttransitions.php' => 1, | |
'html2pdf.js' => 1, | |
'ordercheckouttransitions.php' => 1, | |
'ordercheckoutstates.php' => 1, | |
'syliuscartevents.php' => 1, | |
'sylakesylakimbundle.php' => 1, | |
'licence.sample' => 1, | |
'coffee.php' => 1, | |
'swith' => 1, | |
'errorlayout.php' => 1, | |
'switherror.php' => 1, | |
'modulebootstrapper.php' => 1, | |
'scales.tsv' => 1, | |
'chords' => 1, | |
'survosmogreetbundle.php' => 1, | |
'jsonloader.php' => 1, | |
'captcha.ttf' => 1, | |
'shipmenttransitions.php' => 1, | |
'stingerckeditortableresizebundle.php' => 1, | |
'stingervisjsbundle.php' => 1, | |
'readme-orig' => 1, | |
'license-apache-2.0' => 1, | |
'stingerstrophejsbundle.php' => 1, | |
'stingersoftplatformbundle.php' => 1, | |
'stingermomentjsbundle.php' => 1, | |
'stingersoftmediaparsingbundle.php' => 1, | |
'stingerjquerybackstretchbundle.php' => 1, | |
'stingerckeditorwidgetbundle.php' => 1, | |
'stingerckeditoruploadwidgetbundle.php' => 1, | |
'stingerckeditoruploadimagebundle.php' => 1, | |
'stingerckeditortabletoolsbundle.php' => 1, | |
'stingerckeditorsavebundle.php' => 1, | |
'load-mu-plugins.php' => 1, | |
'stingerckeditorquicktablebundle.php' => 1, | |
'stingerckeditorpreviewbundle.php' => 1, | |
'stingerckeditorpanelbuttonbundle.php' => 1, | |
'stingerckeditorpanelbundle.php' => 1, | |
'stingerckeditoroffice2013skinbundle.php' => 1, | |
'stingerckeditornotificationbundle.php' => 1, | |
'stingerckeditornotificationaggregatorbundle.php' => 1, | |
'stingerckeditorlineutilsbundle.php' => 1, | |
'stingerckeditorimage2bundle.php' => 1, | |
'stingerckeditorfontbundle.php' => 1, | |
'stingerckeditorfloatingpanelbundle.php' => 1, | |
'stingerckeditorfiletoolsbundle.php' => 1, | |
'stingerckeditorcolorbuttonbundle.php' => 1, | |
'zohosubscriptionbundle.php' => 1, | |
'understory.php' => 1, | |
'memcachestore.php' => 1, | |
'phpunit-full.xml.dist' => 1, | |
'incrementorinterface.php' => 1, | |
'remembermeinterface.php' => 1, | |
'limitinterface.php' => 1, | |
'internalexception.php' => 1, | |
'hotpsecret.php' => 1, | |
'hotp.php' => 1, | |
'jspacker.php' => 1, | |
'jshrinkfilter.php' => 1, | |
'dummypacker.php' => 1, | |
'csspacker.php' => 1, | |
'abstractpacker.php' => 1, | |
'modell.php' => 1, | |
'attachment.class.php' => 1, | |
'epayapicontroller.php' => 1, | |
'mimemailparser.class.php' => 1, | |
'htaccess.redirect' => 1, | |
'strontiumpjaxbundle.php' => 1, | |
'specificationfactory.php' => 1, | |
'specificationbundle.php' => 1, | |
'woocommerce-first-atlantic-commerce.php' => 1, | |
'woocommerce-affiliate-tracking.php' => 1, | |
'trackerfactory.php' => 1, | |
'stregogooglebundle.php' => 1, | |
'events-manager-osm.php' => 1, | |
'events-manager-osm.js' => 1, | |
'iepay.php' => 1, | |
'epayapiserviceprovider.php' => 1, | |
'syliussequenceevents.php' => 1, | |
'shipmentunittransitions.php' => 1, | |
'treeexception.php' => 1, | |
'syndmultitenantbundle.php' => 1, | |
'pointers.js' => 1, | |
'pointers-tour.php' => 1, | |
'pointersmanagerinterface.php' => 1, | |
'pointersmanager.php' => 1, | |
'class-tgm-plugin-activation.php' => 1, | |
'tdmschedulerbundle.php' => 1, | |
'tdmswiftmailereventbundle.php' => 1, | |
'tdmdoctrineeventprioritybundle.php' => 1, | |
'tdmdoctrineencryptbundle.php' => 1, | |
'wp-mainwp-child-hidemenu.php' => 1, | |
'syren7owncloudapibundle.php' => 1, | |
'tenantevents.php' => 1, | |
'syndfreshbooksbundle.php' => 1, | |
'httpcapture.php' => 1, | |
'uasparser_example.phps' => 1, | |
'parameters.json-dist' => 1, | |
'db-config-sample.php' => 1, | |
'symfonianindonesiarestcrudevents.php' => 1, | |
'symfonianindonesiarestcrudbundle.php' => 1, | |
'symfonianindonesiarehatconstants.php' => 1, | |
'symfonianindonesiarehatbundle.php' => 1, | |
'symfonianindonesiaadminconstants.php' => 1, | |
'symfonianindonesiaadminbundle.php' => 1, | |
'adminbundle.png' => 1, | |
'votingbundle.php' => 1, | |
'taxonomybundle.php' => 1, | |
'sessionbundle.php' => 1, | |
'pointers.php' => 1, | |
'httpcapturebundle.php' => 1, | |
'linkbuttonbundle.php' => 1, | |
'surf' => 1, | |
'factoryexception.php' => 1, | |
'dom.php' => 1, | |
'diexception.php' => 1, | |
'configurabletrait.php' => 1, | |
'talandynamicformbundle.php' => 1, | |
'talakadoctrineversioningbundle.php' => 1, | |
'talakadoctrinetranslatablebundle.php' => 1, | |
'talakaapiplatformmongodbbundle.php' => 1, | |
'talakaannotationskitbundle.php' => 1, | |
'webpack.js' => 1, | |
'tacticscommandbusbundle.php' => 1, | |
'_.htaccess' => 1, | |
'raw' => 1, | |
'coreasteriskbundle.php' => 1, | |
'browse' => 1, | |
'n2r' => 1, | |
'tmsolutionextjsbundle.php' => 1, | |
'tmsolutionsmsbundle.php' => 1, | |
'coresecuritybundle.php' => 1, | |
'coremenubundle.php' => 1, | |
'tmsolutionloggingbundle.php' => 1, | |
'logmanager.php' => 1, | |
'tmsolutiongeneratorbundle.php' => 1, | |
'phpanalyzer.php' => 1, | |
'tmsolutiongamificationbundle.php' => 1, | |
'tmsolutionformtypebundle.php' => 1, | |
'tmsolutioncronbundle.php' => 1, | |
'machinenamefieldbundle.php' => 1, | |
'imagefieldbundle.php' => 1, | |
'cookiestorage.php' => 1, | |
'syliuscurrencybundle.php' => 1, | |
'syliuspayumbundle.php' => 1, | |
'syliuspaymentbundle.php' => 1, | |
'syliusorderbundle.php' => 1, | |
'syliusomnipaybundle.php' => 1, | |
'syliusmoneybundle.php' => 1, | |
'syliusmetadatabundle.php' => 1, | |
'syliusmailerbundle.php' => 1, | |
'syliuslocalebundle.php' => 1, | |
'syliusinstallerbundle.php' => 1, | |
'syliusgridbundle.php' => 1, | |
'syliusflowbundle.php' => 1, | |
'syliusfixturesbundle.php' => 1, | |
'syliuscorebundle.php' => 1, | |
'syliuspricingbundle.php' => 1, | |
'syliuscontactbundle.php' => 1, | |
'syliuschannelbundle.php' => 1, | |
'syliuscategorizerbundle.php' => 1, | |
'syliuscartbundle.php' => 1, | |
'syliusbloggerbundle.php' => 1, | |
'syliusattributebundle.php' => 1, | |
'syliusassortmentbundle.php' => 1, | |
'syliusassociationbundle.php' => 1, | |
'syliusarchetypebundle.php' => 1, | |
'syliusapibundle.php' => 1, | |
'syliusadminbundle.php' => 1, | |
'syliusaddressingbundle.php' => 1, | |
'doctrinecachestorage.php' => 1, | |
'syliuspluginsbundle.php' => 1, | |
'syliuspromotionbundle.php' => 1, | |
'filefieldbundle.php' => 1, | |
'syliuswebbundle.php' => 1, | |
'filedatabundle.php' => 1, | |
'dynamicmenubundle.php' => 1, | |
'cronexecuter.php' => 1, | |
'contentschedulerbundle.php' => 1, | |
'confirmbundle.php' => 1, | |
'alertermanager.php' => 1, | |
'alerterbundle.php' => 1, | |
'imagemagick_dependency.sh' => 1, | |
'symfonycommonsimagebundle.php' => 1, | |
'symbbextensionbundle.php' => 1, | |
'kernelplugin.php' => 1, | |
'composerplugin.php' => 1, | |
'syliusvariationbundle.php' => 1, | |
'syliusrbacbundle.php' => 1, | |
'syliusvariableproductbundle.php' => 1, | |
'syliususerbundle.php' => 1, | |
'syliusuibundle.php' => 1, | |
'syliusthemingbundle.php' => 1, | |
'syliustaxonomybundle.php' => 1, | |
'syliustaxationbundle.php' => 1, | |
'syliusshippingbundle.php' => 1, | |
'syliussettingsbundle.php' => 1, | |
'syliussequencebundle.php' => 1, | |
'syliussearchbundle.php' => 1, | |
'syliussalesbundle.php' => 1, | |
'syliusreviewbundle.php' => 1, | |
'syliusreportbundle.php' => 1, | |
'arraystatementiteratorimpl.php' => 1, | |
'abstractstatement.php' => 1, | |
'ujmexobundle.php' => 1, | |
'blockcurrencies.tpl' => 1, | |
'blocklayered-attribute-indexer.php' => 1, | |
'blocklayered-ajax.php' => 1, | |
'blocklayered-15.css' => 1, | |
'blocklanguages.tpl' => 1, | |
'blocklanguages.php' => 1, | |
'blocklanguages.css' => 1, | |
'blockfacebook.tpl' => 1, | |
'blockfacebook.php' => 1, | |
'blockfacebook.js' => 1, | |
'blockcustomerprivacy.tpl' => 1, | |
'blockcustomerprivacy.php' => 1, | |
'blockcustomerprivacy-simple.tpl' => 1, | |
'blockcurrencies.php' => 1, | |
'blocklayered-no-products.tpl' => 1, | |
'blockcurrencies.css' => 1, | |
'blockcontactinfos.tpl' => 1, | |
'blockcontactinfos.php' => 1, | |
'blockcontact.tpl' => 1, | |
'blockcontact.php' => 1, | |
'blockcontact.css' => 1, | |
'blockcmsinfo.tpl' => 1, | |
'blockcmsinfo.php' => 1, | |
'blockcms.tpl' => 1, | |
'blockcms.php' => 1, | |
'blockcmsmodel.php' => 1, | |
'blockcategories_footer.tpl' => 1, | |
'blocklayered-footer.js' => 1, | |
'blocklayered-price-indexer.php' => 1, | |
'blockcategories.php' => 1, | |
'blocknewproducts.php' => 1, | |
'reassuranceclass.php' => 1, | |
'blockreassurance.php' => 1, | |
'blockpermanentlinks.tpl' => 1, | |
'blockpermanentlinks.php' => 1, | |
'blockpermanentlinks.css' => 1, | |
'blockpermanentlinks-header.tpl' => 1, | |
'blockpermanentlinks-footer.tpl' => 1, | |
'blockpaymentlogo.tpl' => 1, | |
'blockpaymentlogo.php' => 1, | |
'blocknewsletter.php' => 1, | |
'blocknewsletter.js' => 1, | |
'blocknewsletter.css' => 1, | |
'blockmyaccountfooter.tpl' => 1, | |
'blocklayered-url-indexer.php' => 1, | |
'blockmyaccountfooter.php' => 1, | |
'blockmyaccount.css' => 1, | |
'blockmyaccount.tpl' => 1, | |
'blockmyaccount.php' => 1, | |
'blockmanufacturer.tpl' => 1, | |
'blockmanufacturer.php' => 1, | |
'prefs.gif' => 1, | |
'blocklink.tpl' => 1, | |
'blocklink.php' => 1, | |
'blocklayered.tpl' => 1, | |
'blocklayered.php' => 1, | |
'blocklayered.js' => 1, | |
'blocklayered.css' => 1, | |
'blockcategories.tpl' => 1, | |
'crossselling.tpl' => 1, | |
'blockreinsurance.tpl' => 1, | |
'poolport-sample.php' => 1, | |
'positibeuniqueviewsbundle.php' => 1, | |
'positibeseobundle.php' => 1, | |
'portalflareuserbundle.php' => 1, | |
'pfpdf.php' => 1, | |
'portalflarereportbundle.php' => 1, | |
'propertymetadata.php' => 1, | |
'portalflaremetadatabundle.php' => 1, | |
'metadataprocessor.php' => 1, | |
'metadataannotation.php' => 1, | |
'annotationdriver.php' => 1, | |
'portalflarefilterbundle.php' => 1, | |
'magicgettersetter.php' => 1, | |
'.simplecov' => 1, | |
'destroy.png' => 1, | |
'ruleset.phpcs.xml' => 1, | |
'sslcreator' => 1, | |
'polyauth' => 1, | |
'pssmockerybundle.php' => 1, | |
'pssdoctrineextensionsbundle.php' => 1, | |
'pssblogbundle.php' => 1, | |
'pfftagitbundle.php' => 1, | |
'urlmatcher.php' => 1, | |
'kernellistener.php' => 1, | |
'acceptheaderserviceprovider.php' => 1, | |
'class-pwp-system-status.php' => 1, | |
'plemipayboxbundle.php' => 1, | |
'plemiboomgobundle.php' => 1, | |
'.scrutinizer.yml ' => 1, | |
'index (copy 1).html' => 1, | |
'blockcart.tpl' => 1, | |
'bankwire.php' => 1, | |
'blockcart.php' => 1, | |
'blockcart.css' => 1, | |
'blockcart-set-collapse.php' => 1, | |
'blockcart-json.tpl' => 1, | |
'blockcart-ajax.php' => 1, | |
'ajax-cart.js' => 1, | |
'blockbestsellers.php' => 1, | |
'blockbanner.tpl' => 1, | |
'blockbanner.php' => 1, | |
'blockbanner.css' => 1, | |
'blockadvertising.tpl' => 1, | |
'blockadvertising.php' => 1, | |
'bankwire.jpg' => 1, | |
'index (copy 2).html' => 1, | |
'backwardcompatibility.php' => 1, | |
'backward_compatibility' => 1, | |
'ru.php' => 1, | |
'it.php' => 1, | |
'autoupgrade.php' => 1, | |
'ajax-upgradetab.php' => 1, | |
'adminselfupgrade.php' => 1, | |
'adminselfupgrade.gif' => 1, | |
'adminselftab.php' => 1, | |
'adminpreferences.php' => 1, | |
'advancedeucompliance.php' => 1, | |
'pswebservicelibrary.php' => 1, | |
'index (copy 3).html' => 1, | |
'blockreinsurance.php' => 1, | |
'reinsuranceclass.php' => 1, | |
'setup.yml.sample' => 1, | |
'homefeatured.php' => 1, | |
'productcomments.css' => 1, | |
'productcomments-extra.tpl' => 1, | |
'productcomments-ajax.php' => 1, | |
'productcriterion.php' => 1, | |
'productcommentcriterion.php' => 1, | |
'productcomment.php' => 1, | |
'paymentexample.php' => 1, | |
'payment.jpg' => 1, | |
'pagesnotfound.php' => 1, | |
'comment.gif' => 1, | |
'newsletter.php' => 1, | |
'homeslider.php' => 1, | |
'gsitemap.php' => 1, | |
'productcomments.tpl' => 1, | |
'gsitemap-cron.php' => 1, | |
'gridhtml.php' => 1, | |
'graphnvd3.php' => 1, | |
'oauth2callback.php' => 1, | |
'gapi.php' => 1, | |
'sql_install.php' => 1, | |
'prestashop.pub' => 1, | |
'gamification.php' => 1, | |
'followup.php' => 1, | |
'favoriteproducts.php' => 1, | |
'favoriteproducts.js' => 1, | |
'favoriteproducts.css' => 1, | |
'productcomments.php' => 1, | |
'productcomments_reviews.tpl' => 1, | |
'favoriteproducts-account.php' => 1, | |
'ps_customtext.tpl' => 1, | |
'referralprogrammodule.php' => 1, | |
'pscleaner.php' => 1, | |
'ps_socialfollow.tpl' => 1, | |
'ps_socialfollow.php' => 1, | |
'ps_sharebuttons.php' => 1, | |
'ps_mainmenu.tpl' => 1, | |
'ps_mainmenu.php' => 1, | |
'ps_linklist.php' => 1, | |
'ps_imageslider.php' => 1, | |
'homeslider.gif' => 1, | |
'ps_featuredproducts.php' => 1, | |
'ps_emailsubscription.php' => 1, | |
'ps_customtext.php' => 1, | |
'productcommentscriterion.php' => 1, | |
'ps_customersignin.tpl' => 1, | |
'ps_customersignin.php' => 1, | |
'ps_contactinfo.tpl' => 1, | |
'ps_contactinfo.php' => 1, | |
'ps_contactinfo-rich.tpl' => 1, | |
'ps_categorytree.php' => 1, | |
'ps_banner.tpl' => 1, | |
'ps_banner.php' => 1, | |
'producttooltip.php' => 1, | |
'productscategory.php' => 1, | |
'productpaymentlogos.php' => 1, | |
'tab.tpl' => 1, | |
'products-comparison.tpl' => 1, | |
'favoriteproducts-ajax.php' => 1, | |
'favoriteproduct.php' => 1, | |
'blockrss.php' => 1, | |
'blockstore.tpl' => 1, | |
'blockviewed.css' => 1, | |
'blockuserinfo.tpl' => 1, | |
'blockuserinfo.php' => 1, | |
'blockuserinfo.css' => 1, | |
'blocktopmenu.tpl' => 1, | |
'blocktopmenu.php' => 1, | |
'blocktags.tpl' => 1, | |
'blocktags.php' => 1, | |
'blocktags.css' => 1, | |
'blocksupplier.tpl' => 1, | |
'blocksupplier.php' => 1, | |
'store.jpg' => 1, | |
'blockstore.php' => 1, | |
'blockviewed.tpl' => 1, | |
'blockspecials.php' => 1, | |
'blocksocial.tpl' => 1, | |
'blocksocial.php' => 1, | |
'blocksocial.jpg' => 1, | |
'blocksharefb.tpl' => 1, | |
'blocksharefb.php' => 1, | |
'blocksearch.tpl' => 1, | |
'blocksearch.php' => 1, | |
'blocksearch.js' => 1, | |
'blocksearch.css' => 1, | |
'blocksearch-top.tpl' => 1, | |
'blocksearch-instantsearch.tpl' => 1, | |
'blockrss.tpl' => 1, | |
'blockviewed.php' => 1, | |
'blockwishlist-ajax.tpl' => 1, | |
'editorial.tpl' => 1, | |
'cheque.jpg' => 1, | |
'editorial.php' => 1, | |
'editorialclass.php' => 1, | |
'orderdetail.tpl' => 1, | |
'dateofdelivery.php' => 1, | |
'beforecarrier.tpl' => 1, | |
'dashtrends.php' => 1, | |
'dashproducts.php' => 1, | |
'dashgoals.php' => 1, | |
'gapi-logo.gif' => 1, | |
'dashactivity.php' => 1, | |
'crossselling.php' => 1, | |
'contactform.php' => 1, | |
'cashondelivery.php' => 1, | |
'blockwishlist-extra.tpl' => 1, | |
'cashondelivery.jpg' => 1, | |
'cashondelivery.gif' => 1, | |
'carriercompare.php' => 1, | |
'carriercompare.js' => 1, | |
'sendwishlist.php' => 1, | |
'my-account.tpl' => 1, | |
'managewishlist.php' => 1, | |
'buywishlistproduct.php' => 1, | |
'blockwishlist_top.tpl' => 1, | |
'blockwishlist_button.tpl' => 1, | |
'blockwishlist.tpl' => 1, | |
'blockwishlist.php' => 1, | |
'blockwishlist.css' => 1, | |
'swagger.json' => 1, | |
'playadzquicksetupbundle.php' => 1, | |
'referralprogram.php' => 1, | |
'padam87knockoutjsbundle.php' => 1, | |
'crypter.php' => 1, | |
'pandafirecorebundle.php' => 1, | |
'clonerinterface.php' => 1, | |
'pagomio.php' => 1, | |
'pageonaccountingbundle.php' => 1, | |
'paellatwitterbootstrapbundle.php' => 1, | |
'padam87searchbundle.php' => 1, | |
'rasterizer.php' => 1, | |
'padam87rasterizebundle.php' => 1, | |
'tempdir.php' => 1, | |
'configurationawaretrait.php' => 1, | |
'padam87modulebundle.php' => 1, | |
'padam87doctrinecacheinvalidatorbundle.php' => 1, | |
'encryptableiteminterface.php' => 1, | |
'padam87cronbundle.php' => 1, | |
'padam87billingobundle.php' => 1, | |
'padam87addressbundle.php' => 1, | |
'lightncandy' => 1, | |
'pugxshortiddoctrinebundle.php' => 1, | |
'bigquery' => 1, | |
'pugxi18nbundle.php' => 1, | |
'pugxgeoformbundle.php' => 1, | |
'pugxgeneratorbundle.php' => 1, | |
'pugxextravalidatorbundle.php' => 1, | |
'pugxautocompleterbundle.php' => 1, | |
'cascade.sublime-project' => 1, | |
'crypterinterface.php' => 1, | |
'nullcrypter.php' => 1, | |
'logincidadaotosbundle.php' => 1, | |
'slacklogger.php' => 1, | |
'banwiregatewaymethod.php' => 1, | |
'banwiregatewaybundle.php' => 1, | |
'banwiremethod.php' => 1, | |
'banwirebundle.php' => 1, | |
'bankwiremethod.php' => 1, | |
'bankwirebundle.php' => 1, | |
'authorizenetmethod.php' => 1, | |
'authorizenetbundle.php' => 1, | |
'openpayu_domain.php' => 1, | |
'html_helper.php' => 1, | |
'urlparserasset.php' => 1, | |
'bladebehavior.php' => 1, | |
'slackclient.php' => 1, | |
'timegenerator.php' => 1, | |
'xcopy.php' => 1, | |
'img_resize.php' => 1, | |
'priceformatter.php' => 1, | |
'clib.php' => 1, | |
'uploadercontroller.php' => 1, | |
'imguploader.php' => 1, | |
'parizzcacheextrabundle.php' => 1, | |
'parizzcachebundle.php' => 1, | |
'lsvpddkapibundle.php' => 1, | |
'lsvglsdkapibundle.php' => 1, | |
'paytrailgatewayfactory.php' => 1, | |
'pandawantechnologyrolevizbundle.php' => 1, | |
'timegeneratorinterface.php' => 1, | |
'praynocasauthbundle.php' => 1, | |
'procergslogincidadaomonitorbundle.php' => 1, | |
'dineromailapimethod.php' => 1, | |
'o2userbundle.php' => 1, | |
'plugin.js' => 1, | |
'persist.js' => 1, | |
'node.js' => 1, | |
'i18n.js' => 1, | |
'format.js' => 1, | |
'debug.js' => 1, | |
'arsenic.php' => 1, | |
'ppm.php' => 1, | |
'epitwitter.php' => 1, | |
'episequence.php' => 1, | |
'epioauth.php' => 1, | |
'epicurl.php' => 1, | |
'o2uibundle.php' => 1, | |
'string.js' => 1, | |
'o2modelbundle.php' => 1, | |
'thematicspeech.php' => 1, | |
'enseparhtml2pdfbundle.php' => 1, | |
'withingsbundle.php' => 1, | |
'oryzoneoauthbundle.php' => 1, | |
'oryzonemediastoragebundle.php' => 1, | |
'oryzoneimagevalidatorbundle.php' => 1, | |
'oryzoneimageresizerbundle.php' => 1, | |
'oryzoneboilerplatebundle.php' => 1, | |
'orkestrowebbundle.php' => 1, | |
'orkestrocountrybundle.php' => 1, | |
'orkestrocorebundle.php' => 1, | |
'orimgoogleapibundle.php' => 1, | |
'state.js' => 1, | |
'toolbar.js' => 1, | |
'procergslogincidadaoigpbundle.php' => 1, | |
'datetimerangesplitter.php' => 1, | |
'acmebadgesbundle.php' => 1, | |
'logincidadaobadgesbundle.php' => 1, | |
'pqstudiorestutilitybundle.php' => 1, | |
'pqstudioratelimitbundle.php' => 1, | |
'vk_exception.php' => 1, | |
'firstfriday.php' => 1, | |
'database.sqlite' => 1, | |
'addadmin.php' => 1, | |
'phppdo.php' => 1, | |
'pdostatementabstract.php' => 1, | |
'pdoexception.php' => 1, | |
'pdoabstract.php' => 1, | |
'datetimerange.php' => 1, | |
'types.js' => 1, | |
'cachebundle.php' => 1, | |
'phpfastcgispeedfonybundle.php' => 1, | |
'runfromweb.php' => 1, | |
'phpcheckstyle.sh' => 1, | |
'phpcheckstyle.cmd' => 1, | |
'.anorak.yml' => 1, | |
'database_pgsql.sql' => 1, | |
'wasp' => 1, | |
'profiles.php' => 1, | |
'stash.png' => 1, | |
'perbilitybcryptbundle.php' => 1, | |
'pbxg33kvocadbbundle.php' => 1, | |
'treetable.jquery.json' => 1, | |
'dineromailapibundle.php' => 1, | |
'dineromailbundle.php' => 1, | |
'platzengysasseticremoveloggingbundle.php' => 1, | |
'asesfeedbackcommand.php' => 1, | |
'form-protector.js' => 1, | |
'slyurlshortenerbundle.php' => 1, | |
'slypushoverbundle.php' => 1, | |
'slyfrancoisbundle.php' => 1, | |
'tinymce_toolbar.png' => 1, | |
'pco-kint.php' => 1, | |
'pco-image-widget-field.php' => 1, | |
'codesniffer.xml' => 1, | |
'wreaths' => 1, | |
'hawkstyles.css' => 1, | |
'.env_example' => 1, | |
'asesfeedbackhandler.php' => 1, | |
'asesfeedback.php' => 1, | |
'phing' => 1, | |
'imageresizer.php' => 1, | |
'visitorinfo.php' => 1, | |
'visitorfilter.php' => 1, | |
'updatecommand.php' => 1, | |
'peerjmpdfbundle.php' => 1, | |
'peerjusersecuritybundle.php' => 1, | |
'run-tests-with-coverage.sh' => 1, | |
'init.environment.php' => 1, | |
'public-routes.php' => 1, | |
'init.example.php' => 1, | |
'markdowntest.php' => 1, | |
'checker_bootstrap.php' => 1, | |
'phpaint.php' => 1, | |
'default_config.php' => 1, | |
'index.textile' => 1, | |
'currencytest.php' => 1, | |
'testguy.php' => 1, | |
'multidatespickerasset.php' => 1, | |
'multidatespicker.php' => 1, | |
'datespickerasset.php' => 1, | |
'datespicker.php' => 1, | |
'datesasset.php' => 1, | |
'collapsemenu.php' => 1, | |
'adminmenu.php' => 1, | |
'activeviewbutton.php' => 1, | |
'activetoolbarbutton.php' => 1, | |
'activeformbutton.php' => 1, | |
'composer.l' => 1, | |
'pipin' => 1, | |
'scenario.php' => 1, | |
'index.lex' => 1, | |
'codeguy.php' => 1, | |
'phpantom.php' => 1, | |
'phpantom' => 1, | |
'composer-extension.phar' => 1, | |
'htmlrenderer.php' => 1, | |
'test.file' => 1, | |
'phosprdoubleentrybundle.php' => 1, | |
'phosprcorebundle.php' => 1, | |
'workflow.png' => 1, | |
'rabbitmqsupervisorbundle.php' => 1, | |
'phobetorbillomatbundle.php' => 1, | |
'yml-example.php' => 1, | |
'i18n.class.php' => 1, | |
'circle-tests.yml' => 1, | |
'stripejsgatewayfactory.php' => 1, | |
'dineromailmethod.php' => 1, | |
'visanetmethod.php' => 1, | |
'redsysmethod.php' => 1, | |
'redsysbundle.php' => 1, | |
'paypalwebcheckoutmethod.php' => 1, | |
'paypalwebcheckoutemptymethod.php' => 1, | |
'paypalwebcheckoutbundle.php' => 1, | |
'paypalexpresscheckoutmethod.php' => 1, | |
'paypalexpresscheckoutbundle.php' => 1, | |
'paymillmethod.php' => 1, | |
'paymillbundle.php' => 1, | |
'paymentmethodinterface.php' => 1, | |
'paymentcoreevents.php' => 1, | |
'paymentcorebundle.php' => 1, | |
'payutransactiontypes.php' => 1, | |
'safetypaymethod.php' => 1, | |
'payurequesttypes.php' => 1, | |
'payumethod.php' => 1, | |
'payudetailstypes.php' => 1, | |
'payuadditionalvaluetypes.php' => 1, | |
'pagosonlinegatewaymethod.php' => 1, | |
'pagosonlinegatewaybundle.php' => 1, | |
'pagosonlinecommbundle.php' => 1, | |
'pagosonlinemethod.php' => 1, | |
'pagosonlinebundle.php' => 1, | |
'googlewalletmethod.php' => 1, | |
'googlewalletbundle.php' => 1, | |
'freepaymentmethod.php' => 1, | |
'freepaymentbundle.php' => 1, | |
'safetypaybundle.php' => 1, | |
'stripebundle.php' => 1, | |
'stripedirectgatewayfactory.php' => 1, | |
'payumbuilder.php' => 1, | |
'stripecheckoutgatewayfactory.php' => 1, | |
'sofortgatewayfactory.php' => 1, | |
'skeletongatewayfactory.php' => 1, | |
'payumbundle.php' => 1, | |
'paypalrestgatewayfactory.php' => 1, | |
'paypalprocheckoutgatewayfactory.php' => 1, | |
'paypalmasspaygatewayfactory.php' => 1, | |
'paypalexpresscheckoutgatewayfactory.php' => 1, | |
'payexgatewayfactory.php' => 1, | |
'offlinegatewayfactory.php' => 1, | |
'klarnainvoicegatewayfactory.php' => 1, | |
'klarnacheckoutgatewayfactory.php' => 1, | |
'payum.php' => 1, | |
'stripemethod.php' => 1, | |
'gatewayfactoryinterface.php' => 1, | |
'gatewayawaretrait.php' => 1, | |
'gatewayawareinterface.php' => 1, | |
'coregatewayfactory.php' => 1, | |
'apiawaretrait.php' => 1, | |
'apiawareinterface.php' => 1, | |
'be2billoffsitegatewayfactory.php' => 1, | |
'be2billdirectgatewayfactory.php' => 1, | |
'authorizenetaimgatewayfactory.php' => 1, | |
'undefinedkeyinstrictarrayexception.php' => 1, | |
'strictarray.php' => 1, | |
'webpaymethod.php' => 1, | |
'webpaybundle.php' => 1, | |
'referralprogram.gif' => 1, | |
'securitypatch.php' => 1, | |
'abstractnamednode.php' => 1, | |
'cookie-banner.php' => 1, | |
'rauwekostreleasebundle.php' => 1, | |
'rauwekostmonologawsbundle.php' => 1, | |
'rattlerhoneypotbundle.php' => 1, | |
'update-blocker.php' => 1, | |
'toolbar-theme-switcher.php' => 1, | |
'class-locate-vendor.php' => 1, | |
'holder.php' => 1, | |
'fragment-cache.php' => 1, | |
'error-log-dashboard-widget.php' => 1, | |
'class-r-hook-handler.php' => 1, | |
'advanced-hooks-api.php' => 1, | |
'rare-font-fout.php' => 1, | |
'generate_metrics.sh' => 1, | |
'release.yml.dist' => 1, | |
'raptekregonbundle.php' => 1, | |
'sf2genconsolelistener.php' => 1, | |
'sf2genconsolebundle.php' => 1, | |
'raphymarkdownbundle.php' => 1, | |
'raphyepitechuserbundle.php' => 1, | |
'samurai' => 1, | |
'.samurai.json' => 1, | |
'puppy' => 1, | |
'thrift.php' => 1, | |
'tania_serrano.sql' => 1, | |
'application.raid' => 1, | |
'autoload.gradle' => 1, | |
'deploy.yml.dist' => 1, | |
'version.yml.dist' => 1, | |
'apiserver-test.php' => 1, | |
'azubuapi.php' => 1, | |
'example.phtml' => 1, | |
'renton56paginatorbundle.php' => 1, | |
'rjemailbundle.php' => 1, | |
'google-translate.gemspec' => 1, | |
'.rvmrc' => 1, | |
'remguserbundle.php' => 1, | |
'remgpagebundle.php' => 1, | |
'remgmessagebundle.php' => 1, | |
'remggeneratorbundle.php' => 1, | |
'remgfrontendbundle.php' => 1, | |
'remgbackendbundle.php' => 1, | |
'ogravatar.php' => 1, | |
'sharescounter.php' => 1, | |
'rauwekostschedulebundle.php' => 1, | |
'scrypt130302pitcairnglg2tc8192w256l8.bin' => 1, | |
'regelwerkignorebotswiftmailerhandlerbundle.php' => 1, | |
'pscss' => 1, | |
'rdirsimplearraybundle.php' => 1, | |
'redexpertserrbitbundle.php' => 1, | |
'platesslimextension.php' => 1, | |
'platesmailtoextension.php' => 1, | |
'rravenmenuannotationsbundle.php' => 1, | |
'igbinary.php' => 1, | |
'eassetmanager.php' => 1, | |
'yiimailer.php' => 1, | |
'style_guide' => 1, | |
'liw.php' => 1, | |
'pdfcrowd.php' => 1, | |
'ec2ssh-worker' => 1, | |
'travis-coverage.php' => 1, | |
'context.go' => 1, | |
'staticroute.go' => 1, | |
'router_test.go' => 1, | |
'router.go' => 1, | |
'route_test.go' => 1, | |
'route.go' => 1, | |
'response_test.go' => 1, | |
'response.go' => 1, | |
'request_test.go' => 1, | |
'request.go' => 1, | |
'regexroute.go' => 1, | |
'middleware.go' => 1, | |
'context_test.go' => 1, | |
'comptage' => 1, | |
'defaultrequest_test.go' => 1, | |
'cadastre_type' => 1, | |
'bano-974.csv' => 1, | |
'bano-973.csv' => 1, | |
'bano-972.csv' => 1, | |
'bano-971.csv' => 1, | |
'bano-95.csv' => 1, | |
'bano-94.csv' => 1, | |
'bano-93.csv' => 1, | |
'bano-92.csv' => 1, | |
'bano-91.csv' => 1, | |
'bano-90.csv' => 1, | |
'bano-89.csv' => 1, | |
'bano-88.csv' => 1, | |
'defaultrequest.go' => 1, | |
'defaultresponse.go' => 1, | |
'ec2ssh' => 1, | |
'rncryptor-spec-v2' => 1, | |
'radiocerosbitidbundle.php' => 1, | |
'rwsoftexcelbundle.php' => 1, | |
'excelresponse.php' => 1, | |
'helper.css' => 1, | |
'yamlconfigbundle.php' => 1, | |
'vichimaginebundle.php' => 1, | |
'uploadbundle.php' => 1, | |
'ipinfobundle.php' => 1, | |
'itfadminbundle.php' => 1, | |
'homestead.yaml' => 1, | |
'draft-rncryptor-spec-v4.0' => 1, | |
'rncryptor-spec-v3' => 1, | |
'torrentapi.php' => 1, | |
'defaultresponse_test.go' => 1, | |
'api_documentation.pdf' => 1, | |
'googleapilibrary.php' => 1, | |
'slitslidermodule.php' => 1, | |
'manualwidget.php' => 1, | |
'manualimageaction.php' => 1, | |
'googlecalendarwidget.php' => 1, | |
'googlemapapi.php' => 1, | |
'propeltranslationbundle.php' => 1, | |
'pelau_suite_test.go' => 1, | |
'pelau.go' => 1, | |
'mime.go' => 1, | |
'defaultrouter_test.go' => 1, | |
'defaultrouter.go' => 1, | |
'quickpay.php' => 1, | |
'requestlabestatbundle.php' => 1, | |
'bano-86.csv' => 1, | |
'redactor.php' => 1, | |
'filearray.php' => 1, | |
'symfonybundleinstallerplugin.php' => 1, | |
'symfonybundleinstaller.php' => 1, | |
'servicesloader.php' => 1, | |
'scannerfactory.php' => 1, | |
'projectscanner.php' => 1, | |
'magicinjectionbundle.php' => 1, | |
'yamldeserializationvisitor.php' => 1, | |
'datetimehandler.php' => 1, | |
'abstractyamldeserializationhandler.php' => 1, | |
'jmsdeyamlbundle.php' => 1, | |
'elasticaentitymappingbundle.php' => 1, | |
'config.global.php' => 1, | |
'sipmultipleuploadbundle.php' => 1, | |
'priv.key' => 1, | |
'roles' => 1, | |
'syntaxhighlighter mit license' => 1, | |
'diem permissions' => 1, | |
'prove' => 1, | |
'ruhrtalnetmenubundle.php' => 1, | |
'gravatar-proxy.php' => 1, | |
'modifier.noscheme.php' => 1, | |
'rtmpdump' => 1, | |
'rtxlabsliquibasebundle.php' => 1, | |
'phppoker' => 1, | |
'gestion_framework.sql' => 1, | |
'rootaccezbasicbundle.php' => 1, | |
'siplocationpickerbundle.php' => 1, | |
'sipadmintreebundle.php' => 1, | |
'.ac-php-conf.json' => 1, | |
'symbioorangegatetimelinebundle.php' => 1, | |
'abstractliteral.php' => 1, | |
'abstractblanknode.php' => 1, | |
'querycache.php' => 1, | |
'serializerfactoryimpl.php' => 1, | |
'serializerfactory.php' => 1, | |
'serializationutils.php' => 1, | |
'parserfactory.php' => 1, | |
'nquadsserializerimpl.php' => 1, | |
'pxcorepaylinebundle.php' => 1, | |
'pxcorelibreofficeconverterbundle.php' => 1, | |
'symbioorangegateuserbundle.php' => 1, | |
'symbioorangegatetranslationbundle.php' => 1, | |
'symbioorangegatesearchbundle.php' => 1, | |
'sipdynamicconnectionbundle.php' => 1, | |
'symbioorangegatepagebundle.php' => 1, | |
'symbioorangegatenewsbundle.php' => 1, | |
'symbioorangegatemediabundle.php' => 1, | |
'symbioorangegatedoctrineormadminbundle.php' => 1, | |
'symbioorangegateclassificationbundle.php' => 1, | |
'symbioorangegateanalyticsbundle.php' => 1, | |
'symbioorangegateadminbundle.php' => 1, | |
'symbiofulltextsearchbundle.php' => 1, | |
'stiwlpagebundle.php' => 1, | |
'siptagbundle.php' => 1, | |
'siptranslationbundle.php' => 1, | |
'siptextbundle.php' => 1, | |
'sipnewsbundle.php' => 1, | |
'rootaccezodeskapibundle.php' => 1, | |
'watch.list' => 1, | |
'requestlabvimeobundle.php' => 1, | |
'cacheablebehaviorbundle.php' => 1, | |
'bamboo-example.png' => 1, | |
'fix-cs.sh' => 1, | |
'demo-config.yml' => 1, | |
'example-manual.php' => 1, | |
'configure.sample.json' => 1, | |
'tagcachetime.php' => 1, | |
'tagcacheobj.php' => 1, | |
'img-nocache.jpg' => 1, | |
'img-cached.jpg' => 1, | |
'tagcachecacheclearer.php' => 1, | |
'tagcachebundle.php' => 1, | |
'cacheablebehaviorfactory.php' => 1, | |
'itemfactory.php' => 1, | |
'phantomserver.js' => 1, | |
'itemcollectionfactory.php' => 1, | |
'itemcollection.php' => 1, | |
'itemallower.php' => 1, | |
'criteriabuilder.php' => 1, | |
'monexy.php' => 1, | |
'alphasms.php' => 1, | |
'exchanger.php' => 1, | |
'saasapiresourcemap' => 1, | |
'buttondropdownsorter.php' => 1, | |
'restapigeneratorbundle.php' => 1, | |
'respectvalidationbundle.php' => 1, | |
'rnkelfinderbundle.php' => 1, | |
'requestlabxitianalyticsbundle.php' => 1, | |
'filler.yml.dist' => 1, | |
'rjmcommentbundle.php' => 1, | |
'chosenbootstrapasset.php' => 1, | |
'ss3.jpg' => 1, | |
'roheaopenxintegrationbundle.php' => 1, | |
's2protocol' => 1, | |
'corezerobundle.php' => 1, | |
'settings.example.yml' => 1, | |
'parentchildtree.php' => 1, | |
'i18ntoolbar.php' => 1, | |
'treetable.php' => 1, | |
'term.php' => 1, | |
'taxonomytrait.php' => 1, | |
'rbrssbundle.php' => 1, | |
'rvdvdisqusbundle.php' => 1, | |
'example-output' => 1, | |
'ss2.jpg' => 1, | |
'rjmgenemusandboxbundle.php' => 1, | |
'ss1.jpg' => 1, | |
'docgen.json' => 1, | |
'reflectionmethod.php' => 1, | |
'reflectioninterface.php' => 1, | |
'docblock.php' => 1, | |
'use_native_gettext_function.php' => 1, | |
'use_class_gettext_function.php' => 1, | |
'gettextvars.php' => 1, | |
'gettextreader.php' => 1, | |
'multifactorauthforeveryone.png' => 1, | |
'twofactorauth.sln' => 1, | |
'twofactorauth.phpproj' => 1, | |
'rjmmaxmindbundle.php' => 1, | |
'bano-87.csv' => 1, | |
'bano-85.csv' => 1, | |
'sekeywords.php' => 1, | |
'smwfileprotect.php' => 1, | |
'smwuserprotect.classes.php' => 1, | |
'smwparent.php' => 1, | |
'smwparent.iterate.php' => 1, | |
'smwparent.i18n.php' => 1, | |
'smwparent.i18n.magic.php' => 1, | |
'smwparent.classes.php' => 1, | |
'smwlistprops.php' => 1, | |
'smwlistprops.i18n.php' => 1, | |
'smwlistprops.i18n.magic.php' => 1, | |
'smwlistprops.classes.php' => 1, | |
'smwnsprotect_body.php' => 1, | |
'smwfileprotect_body.php' => 1, | |
'formlink.php' => 1, | |
'smwuserprotect.php' => 1, | |
'emailobfuscator.js' => 1, | |
'laravel4.phpunit.xml' => 1, | |
'cmsadminbundle.php' => 1, | |
'entitystore' => 1, | |
'default-config.json' => 1, | |
'liscence' => 1, | |
'pkroundcolor.php' => 1, | |
'pkcolor.php' => 1, | |
'ps-forms.php' => 1, | |
'class-ps-forms.php' => 1, | |
'class-ps-forms-table.php' => 1, | |
'class-ps-forms-admin.php' => 1, | |
'smwuserprotect.i18n.php' => 1, | |
'semanticformsmultiedit.php' => 1, | |
'padoctrineenumbundle.php' => 1, | |
'sha1hashgenerator.php' => 1, | |
'.coverals.yml' => 1, | |
'pulpcache.php' => 1, | |
'pulpmediaserializedresponsebundle.php' => 1, | |
'pulpmedianghttpbundle.php' => 1, | |
'pulpmediap3pcookiebundle.php' => 1, | |
'radiobuttonmatrix.php' => 1, | |
'webtestcaseinterface.php' => 1, | |
'extensiontestcase.php' => 1, | |
'databasewebtestcase.php' => 1, | |
'databasetestcase.php' => 1, | |
'containerawaretestcase.php' => 1, | |
'consolecommandtestcase.php' => 1, | |
'md5hashgenerator.php' => 1, | |
'test.tpl' => 1, | |
'customalphabetcodegenerator.php' => 1, | |
'codegeneratorinterface.php' => 1, | |
'publeroapinotificationbundle.php' => 1, | |
'publerotokenauthenticationevents.php' => 1, | |
'publerotokenauthenticationbundle.php' => 1, | |
'publerotemplatemailerbundle.php' => 1, | |
'publeroapplemobilebundle.php' => 1, | |
'publerofilebundle.php' => 1, | |
'psycle-mail.php' => 1, | |
'psycle-mail.class.php' => 1, | |
'psycle-pii-scrub.php' => 1, | |
'class-pii-scrub.php' => 1, | |
'proxiwebpersonabundle.php' => 1, | |
'uri.lib.php' => 1, | |
'programmingarehardresourcebundle.php' => 1, | |
'loggly.php' => 1, | |
'statsbestvouchers.php' => 1, | |
'statspersonalinfos.php' => 1, | |
'statsorigin.php' => 1, | |
'statsnewsletter.php' => 1, | |
'statslive.php' => 1, | |
'statsforecast.php' => 1, | |
'next.png' => 1, | |
'funnel.png' => 1, | |
'statsequipment.php' => 1, | |
'statsdata.php' => 1, | |
'statscheckup.php' => 1, | |
'statscatalog.php' => 1, | |
'statscarrier.php' => 1, | |
'statsbestsuppliers.php' => 1, | |
'statsregistrations.php' => 1, | |
'statsbestproducts.php' => 1, | |
'statsbestmanufacturers.php' => 1, | |
'statsbestcustomers.php' => 1, | |
'statsbestcategories.php' => 1, | |
'socialsharing.php' => 1, | |
'sendtoafriend_ajax.php' => 1, | |
'sendtoafriend.tpl' => 1, | |
'sendtoafriend.png' => 1, | |
'sendtoafriend.php' => 1, | |
'sendtoafriend.js' => 1, | |
'sendtoafriend.css' => 1, | |
'sendtoafriend-extra.tpl' => 1, | |
'product_page.tpl' => 1, | |
'statsproduct.php' => 1, | |
'statssales.php' => 1, | |
'phar_stub.php' => 1, | |
'prims47translatebundle.php' => 1, | |
'tested.html' => 1, | |
'hypersafe.php' => 1, | |
'laravel.php' => 1, | |
'htmlki.php' => 1, | |
'smile.png' => 1, | |
'feeder.php' => 1, | |
'example-object.php' => 1, | |
'example-chain.php' => 1, | |
'example-array.php' => 1, | |
'chained.php' => 1, | |
'datefmt.php' => 1, | |
'certificationycertybundle.php' => 1, | |
'prims47paypalexpresscheckoutnvpbundle.php' => 1, | |
'statssearch.php' => 1, | |
'primenavigationbundle.php' => 1, | |
'prezenttranslationbundle.php' => 1, | |
'prezentgridbundle.php' => 1, | |
'prezentdompdfbundle.php' => 1, | |
'prezentdoctrinetranslatablebundle.php' => 1, | |
'watermark.php' => 1, | |
'watermark.gif' => 1, | |
'vatnumber.php' => 1, | |
'vatnumbertaxmanager.php' => 1, | |
'trackingfront.php' => 1, | |
'themeconfigurator.php' => 1, | |
'statsvisits.php' => 1, | |
'statsstock.php' => 1, | |
'boot_laravel.php' => 1, | |
'herokugeneratorcontroller.php' => 1, | |
'bano-84.csv' => 1, | |
'bano-40.csv' => 1, | |
'bano-52.csv' => 1, | |
'bano-51.csv' => 1, | |
'bano-50.csv' => 1, | |
'bano-49.csv' => 1, | |
'bano-48.csv' => 1, | |
'bano-47.csv' => 1, | |
'bano-46.csv' => 1, | |
'bano-45.csv' => 1, | |
'bano-44.csv' => 1, | |
'bano-43.csv' => 1, | |
'bano-42.csv' => 1, | |
'bano-41.csv' => 1, | |
'bano-39.csv' => 1, | |
'bano-54.csv' => 1, | |
'bano-38.csv' => 1, | |
'bano-37.csv' => 1, | |
'bano-36.csv' => 1, | |
'bano-35.csv' => 1, | |
'bano-34.csv' => 1, | |
'bano-33.csv' => 1, | |
'bano-32.csv' => 1, | |
'bano-31.csv' => 1, | |
'bano-30.csv' => 1, | |
'bano-2b.csv' => 1, | |
'bano-2a.csv' => 1, | |
'bano-29.csv' => 1, | |
'bano-28.csv' => 1, | |
'bano-53.csv' => 1, | |
'bano-55.csv' => 1, | |
'bano-26.csv' => 1, | |
'bano-71.csv' => 1, | |
'bano-83.csv' => 1, | |
'bano-82.csv' => 1, | |
'bano-81.csv' => 1, | |
'bano-80.csv' => 1, | |
'bano-79.csv' => 1, | |
'bano-78.csv' => 1, | |
'bano-77.csv' => 1, | |
'bano-76.csv' => 1, | |
'bano-75.csv' => 1, | |
'bano-74.csv' => 1, | |
'bano-73.csv' => 1, | |
'bano-72.csv' => 1, | |
'bano-70.csv' => 1, | |
'bano-56.csv' => 1, | |
'bano-69.csv' => 1, | |
'bano-68.csv' => 1, | |
'bano-67.csv' => 1, | |
'bano-66.csv' => 1, | |
'bano-65.csv' => 1, | |
'bano-64.csv' => 1, | |
'bano-63.csv' => 1, | |
'bano-62.csv' => 1, | |
'bano-61.csv' => 1, | |
'bano-60.csv' => 1, | |
'bano-59.csv' => 1, | |
'bano-58.csv' => 1, | |
'bano-57.csv' => 1, | |
'bano-27.csv' => 1, | |
'bano-25.csv' => 1, | |
'check_psr.sh' => 1, | |
'dataservice.php' => 1, | |
'sourcertrait.php' => 1, | |
'sourcerinterface.php' => 1, | |
'sourceabletrait.php' => 1, | |
'sourceableinterface.php' => 1, | |
'qualitypressstaticcontentbundle.php' => 1, | |
'qualitypresssocialmediabundle.php' => 1, | |
'qualitycurrencyconverterbundle.php' => 1, | |
'qualitypressbreadcrumbsbundle.php' => 1, | |
'requestadapter.php' => 1, | |
'operationcontextadapter.php' => 1, | |
'odataurlrule.php' => 1, | |
'queryprovider.php' => 1, | |
'basequeryprovider.php' => 1, | |
'listingfilter.php' => 1, | |
'baseentity.php' => 1, | |
'basedataservice.php' => 1, | |
'qcumbeerbreadcrumbsbundle.php' => 1, | |
'shops.dist.json' => 1, | |
'ee7.php' => 1, | |
'ee.php' => 1, | |
'qbttranslationbundle.php' => 1, | |
'qbankapi.php' => 1, | |
'credentials.php' => 1, | |
'cachepolicy.php' => 1, | |
'radiohitsbundle.php' => 1, | |
'deejaypoolbundle.php' => 1, | |
'deejayfilesorganizerbundle.php' => 1, | |
'websitebundle.php' => 1, | |
'uploadmodel.php' => 1, | |
'bano-24.csv' => 1, | |
'bano-10.csv' => 1, | |
'bano-23.csv' => 1, | |
'bano-22.csv' => 1, | |
'bano-21.csv' => 1, | |
'bano-19.csv' => 1, | |
'bano-18.csv' => 1, | |
'bano-17.csv' => 1, | |
'bano-16.csv' => 1, | |
'bano-15.csv' => 1, | |
'bano-14.csv' => 1, | |
'bano-13.csv' => 1, | |
'bano-12.csv' => 1, | |
'bano-11.csv' => 1, | |
'bano-09.csv' => 1, | |
'qbrepobundle.php' => 1, | |
'bano-08.csv' => 1, | |
'bano-07.csv' => 1, | |
'bano-06.csv' => 1, | |
'bano-05.csv' => 1, | |
'bano-04.csv' => 1, | |
'bano-03.csv' => 1, | |
'bano-02.csv' => 1, | |
'bano-01.csv' => 1, | |
'1_statistiques_rapprochement_voirie' => 1, | |
'searchresultproviderfactory.php' => 1, | |
'searchresultprovider.php' => 1, | |
'searchresultfilter.php' => 1, | |
'searchprovider.php' => 1, | |
'autoload_test_register.php' => 1, | |
'csconfig.php_cs' => 1, | |
'oreadespaymentpayplugbundle.php' => 1, | |
'analystsconfigurator.example.php' => 1, | |
'docomo.php' => 1, | |
'deployer.yml' => 1, | |
'couchreplicator.php' => 1, | |
'couchdocument.php' => 1, | |
'couchclient.php' => 1, | |
'couchadmin.php' => 1, | |
'couch.php' => 1, | |
'classmap-generator.sh' => 1, | |
'ioccontainer.php' => 1, | |
'anna.php' => 1, | |
'anna.bat' => 1, | |
'anna' => 1, | |
'payu.php' => 1, | |
'loggly-new-input.png' => 1, | |
'mysql-connector-license' => 1, | |
'mysql-connector-java-5.1.18-bin.jar' => 1, | |
'aniscommercebundle.php' => 1, | |
'uploadcropimagebundle.php' => 1, | |
'animedb' => 1, | |
'pandoradoctrinegeneratorbundle.php' => 1, | |
'include_file_template.php' => 1, | |
'cake.php' => 1, | |
'envswitcher.php' => 1, | |
'model' => 1, | |
'standards.xml' => 1, | |
'easygit.php' => 1, | |
'create-tables.sql' => 1, | |
'loggly-shell.png' => 1, | |
'create-language-detector' => 1, | |
'upgrade-2.0.2' => 1, | |
'wp-libre-form.php' => 1, | |
'woocommerce-clean-orphaned-variations.php' => 1, | |
'pusher.sublime-project' => 1, | |
'antqaajaxautocompletebundle.php' => 1, | |
'gate.php' => 1, | |
'amocrm.php' => 1, | |
'vkapi.php' => 1, | |
'antkowiakvalidationbundle.php' => 1, | |
'readme_pl' => 1, | |
'mongodbmigrationsbundle.php' => 1, | |
'upgrade-2.0.4' => 1, | |
'upgrade-2.0.3' => 1, | |
'upgrade-2.0.1' => 1, | |
'ansuserbundle.php' => 1, | |
'rules.mk' => 1, | |
'afs_version.php' => 1, | |
'afs_lib.php' => 1, | |
'afs_lib.doxygen' => 1, | |
'dlr' => 1, | |
'arvblogservices.php' => 1, | |
'arvblogroles.php' => 1, | |
'arvblogparameters.php' => 1, | |
'arvblogbundle.php' => 1, | |
'afdonttranslatebundle.php' => 1, | |
'patchwork.php' => 1, | |
'generate-phar.php' => 1, | |
'antaresaccessiblebundle.php' => 1, | |
'detect-language' => 1, | |
'extension-install.sh' => 1, | |
'wp-pdf-templates.php' => 1, | |
'bubblesoap.class.php' => 1, | |
'andresmontanezfragmentcachebundle.php' => 1, | |
'wysihtml5.php' => 1, | |
'coreimage.php' => 1, | |
'yammerstrategy.php' => 1, | |
'schematic.phar' => 1, | |
'.schematic.yaml' => 1, | |
'wp-represent-map.php' => 1, | |
'cover.jpeg' => 1, | |
'bootstrap-phpunit.php' => 1, | |
'utilizando_o_composer_no_windows' => 1, | |
'exemplo-estados' => 1, | |
'exemplo-datas' => 1, | |
'ususcryptpasswordencoderbundle.php' => 1, | |
'andresmontanezuseragentstringbundle.php' => 1, | |
'billabletrait.php' => 1, | |
'gravatarpresentertrait.php' => 1, | |
'abkquerybundle.php' => 1, | |
'phpjunitmerge' => 1, | |
'andreasglasernotifybundle.php' => 1, | |
'andreasglaserdceventbundle.php' => 1, | |
'andreasglaserdoctrinefilebundle.php' => 1, | |
'commit-msg' => 1, | |
'try_schema_tool.php' => 1, | |
'migration-to-2.1' => 1, | |
'migration-to-2.0' => 1, | |
'htaccess-example' => 1, | |
'potatodb.sq3' => 1, | |
'andresmontanezrecommendationsbundle.php' => 1, | |
'googleurlshortener.php' => 1, | |
'acknowledgement' => 1, | |
'nooppagerbundle.php' => 1, | |
'mhttohtml.php' => 1, | |
'gerrie' => 1, | |
'license 2' => 1, | |
'.env.production.php' => 1, | |
'simplify.php' => 1, | |
'run_webpage.php' => 1, | |
'run_servicepage.php' => 1, | |
'run_script.php' => 1, | |
'run_init.php' => 1, | |
'nooptwitterbootstrapbundle.php' => 1, | |
'noopstopforumspambundle.php' => 1, | |
'noopparserbundle.php' => 1, | |
'noopformfieldsbundle.php' => 1, | |
'datatrait.php' => 1, | |
'attached-post-field-cmb2.php' => 1, | |
'contactformwidget.php' => 1, | |
'provisioner' => 1, | |
'financial' => 1, | |
'security_ruleset.xml' => 1, | |
'creditcardnumber.php' => 1, | |
'creditcardexpiry.php' => 1, | |
'creditcardcvcode.php' => 1, | |
'creditcardasset.php' => 1, | |
'featherlightgalleryasset.php' => 1, | |
'featherlightgallery.php' => 1, | |
'featherlightasset.php' => 1, | |
'featherlight.php' => 1, | |
'index-pdf.php' => 1, | |
'wp-post-acl.php' => 1, | |
'host=localhost:33060;dbname=potato' => 1, | |
'aqarmaputilitybundle.php' => 1, | |
'arcanacontentbundle.php' => 1, | |
'optionelement.php' => 1, | |
'errorview.php' => 1, | |
'jada' => 1, | |
'unittests' => 1, | |
'fromgit.php' => 1, | |
'ipreserver.php' => 1, | |
'cmsdiff.php' => 1, | |
'lightframework.sql' => 1, | |
'ahomestead' => 1, | |
'composer-nette_2.2.json' => 1, | |
'thumbnailconfig.php' => 1, | |
'multiregionbundle.php' => 1, | |
'slotmachineslotbundle.php' => 1, | |
'apruve.php' => 1, | |
'culabsjquerybundle.php' => 1, | |
'culabstestingbundle.php' => 1, | |
'culabsilluminatebundle.php' => 1, | |
'culabscontactbundle.php' => 1, | |
'bugcatch.services.yml' => 1, | |
'bugcatch.info.yml' => 1, | |
'culabsbugcatchbundle.php' => 1, | |
'culabsadminbundle.php' => 1, | |
'apresellerclubbundle.php' => 1, | |
'testupload.png' => 1, | |
'test_add_data.zip' => 1, | |
'archerclickatellbundle.php' => 1, | |
'schema.solr5.xml' => 1, | |
'virtual-host.xml' => 1, | |
'armetizfacebookbundle.php' => 1, | |
'aygondoctrinemigrationsbundle.php' => 1, | |
'aygondatabaseconfigbundle.php' => 1, | |
'aygondatalistbundle.php' => 1, | |
'albtwigshellbundle.php' => 1, | |
'albtwigreflectionbundle.php' => 1, | |
'mthamlengine.php' => 1, | |
'mthamlbundle.php' => 1, | |
'alboauth2serverbundle.php' => 1, | |
'repo-stats' => 1, | |
'armetizmediabundle.php' => 1, | |
'armetizformextensionbundle.php' => 1, | |
'facebooksessionpersistence.php' => 1, | |
'armazon' => 1, | |
'atadminbundle.php' => 1, | |
'simple_acf_options.php' => 1, | |
'j3telquerybundle.php' => 1, | |
'j3telpagerbundle.php' => 1, | |
'argentumtranslationbundle.php' => 1, | |
'readme.md.example' => 1, | |
'yaf.php' => 1, | |
'generate_namespaces.php' => 1, | |
'v8js.php' => 1, | |
'simplecws.php' => 1, | |
'oauthparams-dist.php' => 1, | |
'morana.sublime-workspace' => 1, | |
'atuserbundle.php' => 1, | |
'atcmsbundle.php' => 1, | |
'sdsidebar.php' => 1, | |
'common.win.properties' => 1, | |
'apisocialbundle.php' => 1, | |
'dryrun.php' => 1, | |
'aws-eb-newrelic-deploynotify.sh' => 1, | |
'xmllint.sh' => 1, | |
'systemstorage_import.sh' => 1, | |
'phplint.sh' => 1, | |
'opsworks_updateapp.sh' => 1, | |
'opsworks_deployment.sh' => 1, | |
'apply_patches.sh' => 1, | |
'blueprints.example.yml' => 1, | |
'locallang_db.php' => 1, | |
'class.tx_staticpub_fe.php' => 1, | |
'class.tx_staticpub_export.php' => 1, | |
'class.tx_staticpub.php' => 1, | |
'apply.php' => 1, | |
'oraclelogin.php' => 1, | |
'scheduler_cron.sh' => 1, | |
'lci.php' => 1, | |
'api2.php' => 1, | |
'logingatebundle.php' => 1, | |
'antsocialrestbundle.php' => 1, | |
'antphotorestbundle.php' => 1, | |
'metadatabundle.php' => 1, | |
'helpbundle.php' => 1, | |
'antfotobundle.php' => 1, | |
'.project~' => 1, | |
'chateasecurebundle.php' => 1, | |
'chateaclientbundle.php' => 1, | |
'antbadgebundle.php' => 1, | |
'oci8dbconnection.php' => 1, | |
'generate-doc.bat' => 1, | |
'common.mac.properties' => 1, | |
'apoutchikamediabundle.php' => 1, | |
'common.linux.properties' => 1, | |
'upgrade-1.1.1' => 1, | |
'upgrade-1.1.0' => 1, | |
'upgrade-1.0.6' => 1, | |
'upgrade-1.0.5' => 1, | |
'upgrade-1.0.4' => 1, | |
'upgrade-1.0.3' => 1, | |
'upgrade-1.0.2' => 1, | |
'dateintlfacade.php' => 1, | |
'dateintlbuilder.php' => 1, | |
'readme-pl' => 1, | |
'traceviewbundle.php' => 1, | |
'apoutchikaloremipsumbundle.php' => 1, | |
'expiringhash.php' => 1, | |
'pull-hub-updates.bat' => 1, | |
'aplazame.php' => 1, | |
'watchngo.config' => 1, | |
'watchngo' => 1, | |
'mp' => 1, | |
'migrator.php' => 1, | |
'fixturenator.php' => 1, | |
'cfg' => 1, | |
'configmagic.php' => 1, | |
'climax' => 1, | |
'testclasses.php' => 1, | |
'climaxcontrollertest.php' => 1, | |
'climax.php' => 1, | |
'potato.db' => 1, | |
'view-application-form.php' => 1, | |
'aygonformhandlerbundle.php' => 1, | |
'debrilrssatombundle.php' => 1, | |
'simplistic-nav-menus.php' => 1, | |
'alexkomaralexfilesearchbundle.php' => 1, | |
'asynctweetsbundle.php' => 1, | |
'script.sql' => 1, | |
'shell.sh' => 1, | |
'readmerussian' => 1, | |
'gittest2.core' => 1, | |
'gittest' => 1, | |
'aldoapibundle.php' => 1, | |
'example.dcr.yml' => 1, | |
'dcr' => 1, | |
'.jscsrc.drupal' => 1, | |
'phpunit-feeds.xml' => 1, | |
'polyutil.php' => 1, | |
'debrilfeediobundle.php' => 1, | |
'persons.png' => 1, | |
'curriculum.png' => 1, | |
'alexwebbundle.php' => 1, | |
'phped' => 1, | |
'grammar' => 1, | |
'alexpaginationbundle.php' => 1, | |
'alexmultisitebundle.php' => 1, | |
'alexdoctrineextrabundle.php' => 1, | |
'alexasseticextrabundle.php' => 1, | |
'twofactor_gauthenticator_form.js' => 1, | |
'twofactor_gauthenticator.php' => 1, | |
'mathutil.php' => 1, | |
'sphericalutil.php' => 1, | |
'qrcode.min.js' => 1, | |
'settingsasset.php' => 1, | |
'erro.html' => 1, | |
'reflectsandcleanspropertiesaftertesttrait.php' => 1, | |
'iscontrollertesttrait.php' => 1, | |
'closesconnectionsaftertesttrait.php' => 1, | |
'apihelperstrait.php' => 1, | |
'newsstickerasset.php' => 1, | |
'newssticker.php' => 1, | |
'phunction.php' => 1, | |
'testdummy' => 1, | |
'align-lib-doc.pdf' => 1, | |
'filternet' => 1, | |
'uploadfilesbehavior.php' => 1, | |
'algolia_algoliasearch.xml' => 1, | |
'isup' => 1, | |
'contacts.json' => 1, | |
'algoliasearch.php' => 1, | |
'skeletonclass.php' => 1, | |
'mypackageserviceprovider.php' => 1, | |
'ab_useparentmediafiles.sublime-project' => 1, | |
'cougar.php' => 1, | |
'microremoteservicebundle.php' => 1, | |
'microclientbundle.php' => 1, | |
'microbaseservicebundle.php' => 1, | |
'ratyasset.php' => 1, | |
'raty.php' => 1, | |
'nf_pp.php' => 1, | |
'tiny_ssi.php' => 1, | |
'twofactor_gauthenticator.js' => 1, | |
'2fa_qr_code.js' => 1, | |
'phpunit-auth-example.json' => 1, | |
'localization.html.php' => 1, | |
'templateenginecache.php' => 1, | |
'templates.ru.json' => 1, | |
'templates.json' => 1, | |
'templates.html.php' => 1, | |
'simple.ru.json' => 1, | |
'simple.json' => 1, | |
'pages.ru.json' => 1, | |
'pages.php' => 1, | |
'pages.html.php' => 1, | |
'localization.ru.json' => 1, | |
'localization.php' => 1, | |
'localization.json' => 1, | |
'index.ru.json' => 1, | |
'templateenginenull.php' => 1, | |
'index.json' => 1, | |
'global.ru.json' => 1, | |
'global.json' => 1, | |
'elements.ru.json' => 1, | |
'elements.json' => 1, | |
'elements.html.php' => 1, | |
'debug.ru.json' => 1, | |
'debug.json' => 1, | |
'debug.html.php' => 1, | |
'controls.ru.json' => 1, | |
'controls.php' => 1, | |
'controls.json' => 1, | |
'controls.html.php' => 1, | |
'templateenginefactory.module' => 1, | |
'templateengineprocesswire.module' => 1, | |
'scrypt.php' => 1, | |
'adminltecrudgenerator.sublime-project' => 1, | |
'devicedetect.php' => 1, | |
'vcdeploy' => 1, | |
'config.inc.php.dist2' => 1, | |
'l91suluwebsiteuserbundle.php' => 1, | |
'l91suluformbundle.php' => 1, | |
'l91sulubackendbundle.php' => 1, | |
'techfinancialsclient.php' => 1, | |
'commoner.xml' => 1, | |
'alestecrudgeneratorbundle.php' => 1, | |
'alestegeneratorbundle.php' => 1, | |
'adminltegeneratorbundle.php' => 1, | |
'adminltecrudgenerator.sublime-workspace' => 1, | |
'dependentdropdown.php' => 1, | |
'license.twig' => 1, | |
'modalloaderasset.php' => 1, | |
'modalloader.php' => 1, | |
'languageboxasset.php' => 1, | |
'languagebox.php' => 1, | |
'famfamfamflagsasset.php' => 1, | |
'cookiesasset.php' => 1, | |
'.flooignore' => 1, | |
'jquerytranslatorasset.php' => 1, | |
'circulartabsasset.php' => 1, | |
'circulartabs.php' => 1, | |
'titlebehavior.php' => 1, | |
'i18ntrait.php' => 1, | |
'controllerhelper.php' => 1, | |
'mg' => 1, | |
'timeslot.php' => 1, | |
'view-application-data.php' => 1, | |
'amiairbrakebundle.php' => 1, | |
'reverseproxy.php' => 1, | |
'phperror-gui.php' => 1, | |
'thumbnails.php' => 1, | |
'entropy' => 1, | |
'twitterfeed.php' => 1, | |
'detailview4col.php' => 1, | |
'aerospikesessionhandler.php' => 1, | |
'tempmail_example.php' => 1, | |
'tempmail.class.php' => 1, | |
'zarinpal.php' => 1, | |
'awzetacachebundle.php' => 1, | |
'awezpfetchbundle.php' => 1, | |
'sequencejsasset.php' => 1, | |
'pingerbundle.php' => 1, | |
'nivosliderasset.php' => 1, | |
'elevatezoomasset.php' => 1, | |
'elevatezoom.php' => 1, | |
'moneyasset.php' => 1, | |
'adrcassandrabundle.php' => 1, | |
'jpgraph_logo.jpg' => 1, | |
'amysql.php' => 1, | |
'ambtadoctrineencryptbundle.php' => 1, | |
'uploadsaktiwidgetasset.php' => 1, | |
'uploadsaktitrait.php' => 1, | |
'uploadsaktiasset.php' => 1, | |
'uploadsakti.php' => 1, | |
'amaxlabformbundle.php' => 1, | |
'messentebundle.php' => 1, | |
'checkvendors.sh' => 1, | |
'timezones' => 1, | |
'edit-application-form.php' => 1, | |
'view-all-applications.php' => 1, | |
'terms_condition.php' => 1, | |
'switchery.min.js' => 1, | |
'switchery.min.css' => 1, | |
'renewal_notification.php' => 1, | |
'register-application-form.php' => 1, | |
'new-application-list.php' => 1, | |
'my_companies.php' => 1, | |
'my-invoices-list.php' => 1, | |
'manage_templates_role.php' => 1, | |
'ias-documents.php' => 1, | |
'edited-application-list.php' => 1, | |
'company_users.php' => 1, | |
'jqueuebundle.php' => 1, | |
'change-password.php' => 1, | |
'certificate_listing.php' => 1, | |
'approved-application-list.php' => 1, | |
'application_form.php' => 1, | |
'application-form.css' => 1, | |
'app-diff.php' => 1, | |
'all_companies.php' => 1, | |
'add_users.php' => 1, | |
'jqueryajaxenxbundle.php' => 1, | |
'_example.php' => 1, | |
'_auto_example.php' => 1, | |
'lescript.php' => 1, | |
'sonatamediawebcamproviderbundle.php' => 1, | |
'backenddesignbundle.php' => 1, | |
'amsearchplugin.php' => 1, | |
'assetmon' => 1, | |
'data_manager.php' => 1, | |
'businessdropcapbundle.php' => 1, | |
'businesscarouselbundle.php' => 1, | |
'alphalemonbootstrapbundle.php' => 1, | |
'love alphalemoncms (powered by link)' => 1, | |
'gpl2' => 1, | |
'alphalemoncmsbundle.php' => 1, | |
'alvalumuploaderbundle.php' => 1, | |
'uinames.class.php' => 1, | |
'instagram-helper.php' => 1, | |
'posts_store.php' => 1, | |
'notice_manager.php' => 1, | |
'instagram_factory.php' => 1, | |
'carbon_helper.php' => 1, | |
'businesssliderbundle.php' => 1, | |
'env_example' => 1, | |
'entity_decorator_finder.class.inc' => 1, | |
'entity_decorator.module' => 1, | |
'entity_decorator.info' => 1, | |
'measure.php' => 1, | |
'weirdbundle.php' => 1, | |
'lexrants.libraries.yml' => 1, | |
'lexrants.info.yml' => 1, | |
'lexrants.breakpoints.yml' => 1, | |
'registry.functions.php' => 1, | |
'empir' => 1, | |
'assetmon.php' => 1, | |
'assetmon.json' => 1, | |
'businessmenubundle.php' => 1, | |
'businesswebsitethemebundle.php' => 1, | |
'amnavplugin.php' => 1, | |
'symfony.php' => 1, | |
'amformsplugin.php' => 1, | |
'oathtoken.php' => 1, | |
'alyxgrayoathtokenbundle.php' => 1, | |
'logviewbundle.php' => 1, | |
'.twgit_features_subject' => 1, | |
'readme.mdwn' => 1, | |
'alterphpdeveloperbundle.php' => 1, | |
'alterphpbitformbundle.php' => 1, | |
'alter' => 1, | |
'alsarmonologextensionsbundle.php' => 1, | |
'convertibleinterface.php' => 1, | |
'autoboxtype.php' => 1, | |
'alpixeluserbundle.php' => 1, | |
'alphalemonelfinderbundle.php' => 1, | |
'seobundle.php' => 1, | |
'alpixelmenubundle.php' => 1, | |
'alpixelmediabundle.php' => 1, | |
'alpixelelasticaquerysorterbundle.php' => 1, | |
'alpixelcustomerbridgebundle.php' => 1, | |
'alpixelcmsbundle.php' => 1, | |
'alpixelassetversionbundle.php' => 1, | |
'fix-generated-themes' => 1, | |
'alphalemonthemeenginebundle.php' => 1, | |
'socialsdkbundle.php' => 1, | |
'alphalemonpagetreebundle.php' => 1, | |
'markdowngeshibundle.php' => 1, | |
'alphalemonfrontendbundle.php' => 1, | |
'aygonfilterbundle.php' => 1, | |
'config_readme' => 1, | |
'nemiro.webforms.php.phpproj.user' => 1, | |
'htpasswd.php' => 1, | |
'docmethod.php' => 1, | |
'docclass.php' => 1, | |
'lambda.php' => 1, | |
'numerics.php' => 1, | |
'tagslist.php' => 1, | |
'htmlminifier.php' => 1, | |
'named.php' => 1, | |
'lazyfield.php' => 1, | |
'lazycontainer.php' => 1, | |
'arraywrapper.php' => 1, | |
'arraymagic.php' => 1, | |
'passwordfile.php' => 1, | |
'realfile.php' => 1, | |
'posgenerated.php' => 1, | |
'fs.php' => 1, | |
'windows.php' => 1, | |
'posix.php' => 1, | |
'ifile.php' => 1, | |
'ifs.php' => 1, | |
'superglobals.php' => 1, | |
'evil.php' => 1, | |
'typingerror.php' => 1, | |
'requiresoverride.php' => 1, | |
'propertyreadonly.php' => 1, | |
'pointless.php' => 1, | |
'opts.php' => 1, | |
'docvar.php' => 1, | |
'posmap.php' => 1, | |
'notinstalled.php' => 1, | |
'quick_start' => 1, | |
'minify.module' => 1, | |
'minify.install' => 1, | |
'minify.info' => 1, | |
'minify.admin.inc' => 1, | |
'azure_blob.streamwrappers.inc' => 1, | |
'azure_blob.module' => 1, | |
'azure_blob.install' => 1, | |
'azure_blob.info' => 1, | |
'azure_blob.drush.inc' => 1, | |
'simpleapp.php' => 1, | |
'azinegeoblockingbundle.php' => 1, | |
'usage_examples' => 1, | |
'azineemailbundle.php' => 1, | |
'possource.php' => 1, | |
'azinesocialbarbundle.php' => 1, | |
'azinemailgunwebhooksbundle.php' => 1, | |
'azinehybridauthbundle.php' => 1, | |
'raskoh.php' => 1, | |
'code-capture.png' => 1, | |
'loop-tests' => 1, | |
'azatyanarmenianlocalebundle.php' => 1, | |
'sv.po' => 1, | |
'php-xgettext' => 1, | |
'pgettext.php' => 1, | |
'recentplaces.lnk' => 1, | |
'ifactory.php' => 1, | |
'sourcemap.php' => 1, | |
'notvalid.php' => 1, | |
'notinited.php' => 1, | |
'bmltwigswiftmailerbundle.php' => 1, | |
'issuu.php' => 1, | |
'calendaruplifts.php' => 1, | |
'suppliers.php' => 1, | |
'roomservice.php' => 1, | |
'products.php' => 1, | |
'orders.php' => 1, | |
'customers.php' => 1, | |
'drinkmenu.php' => 1, | |
'modules' => 1, | |
'extend' => 1, | |
'beverage' => 1, | |
'logrest' => 1, | |
'shutterfly.php' => 1, | |
'curlclass.php' => 1, | |
'omnipay.php' => 1, | |
'mysql2sqlite.sh' => 1, | |
'mysql2sqlite.php' => 1, | |
'database-str-replace.php' => 1, | |
'database-prefix.php' => 1, | |
'database-browser.php' => 1, | |
'cities_states.php' => 1, | |
'index.sample.php' => 1, | |
'avooserializertranslationbundle.php' => 1, | |
'avooinstallerbundle.php' => 1, | |
'avoogeneratorbundle.php' => 1, | |
'avooelobundle.php' => 1, | |
'elopoint.php' => 1, | |
'avooachievementbundle.php' => 1, | |
'custompayment.php' => 1, | |
'moventprofilerbundle.php' => 1, | |
'notfound.php' => 1, | |
'actionnotallowed.php' => 1, | |
'logic.php' => 1, | |
'itemnotfound.php' => 1, | |
'invalidvalue.php' => 1, | |
'invalidformat.php' => 1, | |
'invalidconfig.php' => 1, | |
'forbidden.php' => 1, | |
'fieldnotexist.php' => 1, | |
'disabled.php' => 1, | |
'dependencyerror.php' => 1, | |
'containerreadonly.php' => 1, | |
'alreadyinited.php' => 1, | |
'adapternotdefined.php' => 1, | |
'setter.php' => 1, | |
'awildeepdisquebundle.php' => 1, | |
'joblist.php' => 1, | |
'exp.php' => 1, | |
'subs.php' => 1, | |
'lazy.php' => 1, | |
'irootnode.php' => 1, | |
'inode.php' => 1, | |
'exceptiontrace.php' => 1, | |
'phpunit.xml.desc' => 1, | |
'axsytransactionalbundle.php' => 1, | |
'axsydoctrineshardingbundle.php' => 1, | |
'herbertextrabootstrap.php' => 1, | |
'.codeception.yml' => 1, | |
'.codeception.coverage.yml' => 1, | |
'build-example.xml' => 1, | |
'scaffold' => 1, | |
'payload.json' => 1, | |
'dotenvplugin.php' => 1, | |
'classbasednametrait.php' => 1, | |
'bangpoundinvokerbundle.php' => 1, | |
'bangpoundguzzleproxybundle.php' => 1, | |
'commonsgenderbundle.php' => 1, | |
'bangpoundfinitebundle.php' => 1, | |
'druplex.php' => 1, | |
'drupalserviceprovider.php' => 1, | |
'pseudokernel.php' => 1, | |
'drupalsessionhandler.php' => 1, | |
'bangpounddrupalbundle.php' => 1, | |
'bangpounddocumentcloudbundle.php' => 1, | |
'debugbarserviceprovider.php' => 1, | |
'constantsplugin.php' => 1, | |
'standardconfigtrait.php' => 1, | |
'bangpoundcastlebundle.php' => 1, | |
'callablecompilerpass.php' => 1, | |
'bangpoundatomdatabundle.php' => 1, | |
'asseticserviceprovider.php' => 1, | |
'codekitcoffeescriptfilter.php' => 1, | |
'sculpinoembedbundle.php' => 1, | |
'legacyphphttpkernelprovider.php' => 1, | |
'ezid.php' => 1, | |
'php-bandwidth' => 1, | |
'rm-subs' => 1, | |
'catapultdb.sql' => 1, | |
'exec.php' => 1, | |
'minimalconfigtrait.php' => 1, | |
'variablefilesystemtrait.php' => 1, | |
'rkpostformat.php' => 1, | |
'dynamodb_local_schema.js' => 1, | |
'githubmodel.php' => 1, | |
'eventbootstrap.php' => 1, | |
'urltest.php' => 1, | |
'unittest.php' => 1, | |
'methodparser.php' => 1, | |
'codeceptionaction.php' => 1, | |
'clicktest.php' => 1, | |
'configbootstrap.php' => 1, | |
'html2csv.php' => 1, | |
'cgkintbundle.php' => 1, | |
'barbondevpaymentpaypointhostedbundle.php' => 1, | |
'fast' => 1, | |
'dynamodb_local_init.db' => 1, | |
'yamlenvironmenttrait.php' => 1, | |
'bangpoundtwitterstreamingbundle.php' => 1, | |
'symfony_test.module' => 1, | |
'symfony_test.info' => 1, | |
'symfony.module' => 1, | |
'symfony.info' => 1, | |
'session.inc' => 1, | |
'jsonxmlelement.php' => 1, | |
'bangpoundpubsubbundle.php' => 1, | |
'phirehoseevents.php' => 1, | |
'bangpoundphirehosebundle.php' => 1, | |
'mediawiki-parser.php' => 1, | |
'ladybugserviceprovider.php' => 1, | |
'ladybugextension.php' => 1, | |
'phploy.ini' => 1, | |
'symfony-autocomplete' => 1, | |
'bb-twitterfeed.php' => 1, | |
'layoutbuilder.php' => 1, | |
'twigrender.php' => 1, | |
'urlgeneratorinterface.php' => 1, | |
'requestcontextinterface.php' => 1, | |
'flashinterface.php' => 1, | |
'dependencyinjectioncontainerinterface.php' => 1, | |
'callbackinterface.php' => 1, | |
'callbackfactoryinterface.php' => 1, | |
'bindingfactoryinterface.php' => 1, | |
'authenticatorinterface.php' => 1, | |
'numeric.php' => 1, | |
'backbee.bat' => 1, | |
'toolbar.php' => 1, | |
'crop.php' => 1, | |
'backendwebgeneratorbundle.php' => 1, | |
'bbapplication.php' => 1, | |
'bacbox_license' => 1, | |
'bacbox_author' => 1, | |
'taglistextension.php' => 1, | |
'taglisteventsubscriber.php' => 1, | |
'fastnavextension.php' => 1, | |
'fastnaveventsubscriber.php' => 1, | |
'blogrollextension.php' => 1, | |
'blogrolleventsubscriber.php' => 1, | |
'bablogentriesbundle.php' => 1, | |
'babaganoushgridsterbundle.php' => 1, | |
'babaganoushfoundationbundle.php' => 1, | |
'babaganoushdatatablesbundle.php' => 1, | |
'backenderepiceditorbundle.php' => 1, | |
'errorfinder.php' => 1, | |
'brsignedrequestbundle.php' => 1, | |
'rollbarerrorhandler.php' => 1, | |
'notostest' => 1, | |
'uapiasset.php' => 1, | |
'baiy.php' => 1, | |
'baitpollbundle.php' => 1, | |
'sqlite_simple_store.php' => 1, | |
'php-hooks.php' => 1, | |
'sign_sample.php' => 1, | |
'sampleconf.php' => 1, | |
'bosclientsample.php' => 1, | |
'withpayload.php' => 1, | |
'measurementprotocol.php' => 1, | |
'rollbarlogroute.php' => 1, | |
'rollbarcomponent.php' => 1, | |
'badge-poser.svg' => 1, | |
'mailgunyii2.php' => 1, | |
'mailgunyii.php' => 1, | |
'mailgununsubscribe.php' => 1, | |
'mailgunroute.php' => 1, | |
'mailgunmessage.php' => 1, | |
'mailgunlistmember.php' => 1, | |
'mailgunlist.php' => 1, | |
'mailguncomplaint.php' => 1, | |
'mailgunbounce.php' => 1, | |
'mailgunapi.php' => 1, | |
'baetmaendqlbundle.php' => 1, | |
'today-dark.svg' => 1, | |
'i_m-badge.svg' => 1, | |
'achievement.php' => 1, | |
'hookdeploy.php' => 1, | |
'arodissxlsbundle.php' => 1, | |
'multipleimagesfield.php' => 1, | |
'lambdacontroller.php' => 1, | |
'httpfile.php' => 1, | |
'cookiemanager.php' => 1, | |
'hookabletrait.php' => 1, | |
'hookmanagerinterface.php' => 1, | |
'hookmanager.php' => 1, | |
'hookcontainer.php' => 1, | |
'chain.php' => 1, | |
'widgetmanagerinterface.php' => 1, | |
'widgetfactoryinterface.php' => 1, | |
'groupinterface.php' => 1, | |
'dynamicgroup.php' => 1, | |
'imageswidget.php' => 1, | |
'migrationmanagerinterface.php' => 1, | |
'imagewidget.php' => 1, | |
'imageproperty.php' => 1, | |
'entityforminterface.php' => 1, | |
'entityform.php' => 1, | |
'entityfieldsolverinterface.php' => 1, | |
'entityfieldsolver.php' => 1, | |
'relationsbehavior.php' => 1, | |
'persistencebehavior.php' => 1, | |
'manycollection.php' => 1, | |
'entityexceptioninterface.php' => 1, | |
'swiftmessage.php' => 1, | |
'swiftemail.php' => 1, | |
'dbmigration.php' => 1, | |
'collectionorm.php' => 1, | |
'psrexception.php' => 1, | |
'testbuilder.php' => 1, | |
'wkebayapi.php' => 1, | |
'wkdhlapibundle.php' => 1, | |
'wkbasebundle.php' => 1, | |
'wkamazonmwsapi.php' => 1, | |
'wkafterbuyapibundle.php' => 1, | |
'validatorfactoryinterface.php' => 1, | |
'validatorfactory.php' => 1, | |
'rulesregistryinterface.php' => 1, | |
'rulesregistry.php' => 1, | |
'inputbag.php' => 1, | |
'testsgenerator.php' => 1, | |
'testbuilderinterface.php' => 1, | |
'results.php' => 1, | |
'collectionormfactory.php' => 1, | |
'curlconverter.php' => 1, | |
'viewabletrait.php' => 1, | |
'templateenginefactoryinterface.php' => 1, | |
'sqlpropertytransformerinterface.php' => 1, | |
'polymorphiccollectionorm.php' => 1, | |
'ormmigrations.php' => 1, | |
'orminterface.php' => 1, | |
'ormfactoryinterface.php' => 1, | |
'ormfactory.php' => 1, | |
'ormbehavior.php' => 1, | |
'entityrelation.php' => 1, | |
'collectionorminterface.php' => 1, | |
'collectionormfactoryinterface.php' => 1, | |
'fakeemail.php' => 1, | |
'sqlite_functions.php' => 1, | |
'wkgooglespreadsheetbundle.php' => 1, | |
'phpunit.example.xml' => 1, | |
'paramscodecbundle.php' => 1, | |
'artseldopeninviterbundle.php' => 1, | |
'asfwebsitebundle.php' => 1, | |
'asfuserbundle.php' => 1, | |
'asfschedulerbundle.php' => 1, | |
'asfproductbundle.php' => 1, | |
'asfdocumentbundle.php' => 1, | |
'asfcontactbundle.php' => 1, | |
'asfblogbundle.php' => 1, | |
'asfbackendbundle.php' => 1, | |
'artprimajsendbundle.php' => 1, | |
'artprimaformsextrabundle.php' => 1, | |
'konektsyliussyncbundle.php' => 1, | |
'dateconverterbundle.php' => 1, | |
'studio' => 1, | |
'moocsybundle.php' => 1, | |
'flashersbundle.php' => 1, | |
'artesanusevents.php' => 1, | |
'artesanusbundle.php' => 1, | |
'aclbundle.php' => 1, | |
'states.php' => 1, | |
'sasshandler.php' => 1, | |
'extendedscssc.php' => 1, | |
'elivejournal.php' => 1, | |
'badsignatureexception.php' => 1, | |
'php-ext-checker' => 1, | |
'linode.png' => 1, | |
'documentorbundle.php' => 1, | |
'eassy.php' => 1, | |
'schematable.php' => 1, | |
'publishbehavior.php' => 1, | |
'schemainterface.php' => 1, | |
'dbinterface.php' => 1, | |
'bundleloader.php' => 1, | |
'bundleinstallerplugin.php' => 1, | |
'bundleinstaller.php' => 1, | |
'paginatorfactoryinterface.php' => 1, | |
'paginatorfactory.php' => 1, | |
'datetimeinterface.php' => 1, | |
'baginterface.php' => 1, | |
'nullcache.php' => 1, | |
'timestampsbehavior.php' => 1, | |
'slugifybehavior.php' => 1, | |
'metasbehavior.php' => 1, | |
'settings.json-dist' => 1, | |
'notauthenticatedexception.php' => 1, | |
'monofont.ttf' => 1, | |
'bitpaypayments.php' => 1, | |
'modelcsv' => 1, | |
'as3modlrbundle.php' => 1, | |
'arzzzencmsbundle.php' => 1, | |
'cana' => 1, | |
'macaddrvalidator.php' => 1, | |
'htmlutils.php' => 1, | |
'dateutils.php' => 1, | |
'arturdoruchpaginatorbundle.php' => 1, | |
'requesthandler.php' => 1, | |
'arturdoruchflashmessagebundle.php' => 1, | |
'wkemarsysapi.php' => 1, | |
'wkguzzlecommandclient.php' => 1, | |
'test-phantom.sh' => 1, | |
'wordpress-custom-fields-permalink-plugin.php' => 1, | |
'devicedetectorbundle.php' => 1, | |
'wrapperimperaviredactorpluginasset.php' => 1, | |
'referenceimperaviredactorpluginasset.php' => 1, | |
'pdfimperaviredactorpluginasset.php' => 1, | |
'blueimperaviredactorpluginasset.php' => 1, | |
'psqgridview.php' => 1, | |
'testbench' => 1, | |
'make.utilities.inc' => 1, | |
'about' => 1, | |
'atoumatoumbundle.php' => 1, | |
'atl15googleanalyticsbundle.php' => 1, | |
'atolye15slackexceptionbundle.php' => 1, | |
'twigextension' => 1, | |
'siteplatformbundle.php' => 1, | |
'.devtools' => 1, | |
'demo-builder.php' => 1, | |
'demo-builder-lib.php' => 1, | |
'config.markdown.php' => 1, | |
'localize.class.php' => 1, | |
'entityhintefqexception.php' => 1, | |
'entityhintefq.php' => 1, | |
'at_base.module' => 1, | |
'at_base.missing.inc' => 1, | |
'at_base.make' => 1, | |
'at_base.install' => 1, | |
'at_base.info' => 1, | |
'at_base.hooks.inc' => 1, | |
'semaphoresmsbundle.php' => 1, | |
'siteutilitybundle.php' => 1, | |
'at_base.drush.inc' => 1, | |
'example_ccform.php' => 1, | |
'activefield - copy.php' => 1, | |
'rangecomparevalidatorasset.php' => 1, | |
'rangecomparevalidator.php' => 1, | |
'intltelinputvalidator.php' => 1, | |
'intltelinput.php' => 1, | |
'datetimerangecomparevalidatorasset.php' => 1, | |
'datetimerangecomparevalidator.php' => 1, | |
'runtest' => 1, | |
'receiver.php' => 1, | |
'codes.php' => 1, | |
'xinjiaspainvalidatorbundle.php' => 1, | |
'avegaochartjsbundle.php' => 1, | |
'avanzutransformerbundle.php' => 1, | |
'readme-forms' => 1, | |
'avanzudoctrineprefixbundle.php' => 1, | |
'avanzuprofilebundle.php' => 1, | |
'avanzujsonrequestbundle.php' => 1, | |
'avanzuadminthemebundle.php' => 1, | |
'endpoints.json.default' => 1, | |
'avangatejsonrpcclient.php' => 1, | |
'sapphp.xml' => 1, | |
'ddl-postgresql.sql' => 1, | |
'dist.sql' => 1, | |
'authy.php' => 1, | |
'readme-response' => 1, | |
'readme-request' => 1, | |
'readme-helpers' => 1, | |
'at_base.hack.inc' => 1, | |
'test_active_record_class.sql' => 1, | |
'wkicecatapi.php' => 1, | |
'natika' => 1, | |
'selectortest.php' => 1, | |
'optionstest.php' => 1, | |
'license - copy' => 1, | |
'domtest.php' => 1, | |
'contenttest.php' => 1, | |
'collectiontest.php' => 1, | |
'andreaspregabreadcrumbbundle.php' => 1, | |
'asposecloudbundle.php' => 1, | |
'wp-deblogify.php' => 1, | |
'wp-ip.php' => 1, | |
'style.phtml' => 1, | |
'assymfonydiextends.php' => 1, | |
'angularjqasset.php' => 1, | |
'index-01.php' => 1, | |
'sideuser.php' => 1, | |
'ioniconasset.php' => 1, | |
'icheckasset.php' => 1, | |
'adminlteskinasset.php' => 1, | |
'translituk.php' => 1, | |
'translitka.php' => 1, | |
'translitbe.php' => 1, | |
'translitascii.php' => 1, | |
'wkversionbundle.php' => 1, | |
'wkshopifyapi.php' => 1, | |
'wkschutzklickapi.php' => 1, | |
'wkklarnaapibundle.php' => 1, | |
'wkimageserviceclient.php' => 1, | |
'staticdomtest.php' => 1, | |
'assetcontroller.php' => 1, | |
'example-set.php' => 1, | |
'astinamoneybundle.php' => 1, | |
'example-hook.php' => 1, | |
'example-getupdatescli.php' => 1, | |
'doctrineloggerbundle.php' => 1, | |
'config.inc.sample.php' => 1, | |
'astinatranslationbundle.php' => 1, | |
'astinatradedoublerbundle.php' => 1, | |
'astinasolvencybundle.php' => 1, | |
'astinasociallinksbundle.php' => 1, | |
'astinaseobundle.php' => 1, | |
'astinaredirectmanagerbundle.php' => 1, | |
'astinaquillbundle.php' => 1, | |
'astinapaymentbundle.php' => 1, | |
'astinalabelsbundle.php' => 1, | |
'robotstxt.php' => 1, | |
'astinainjectionbundle.php' => 1, | |
'astinafotoliabundle.php' => 1, | |
'astinadomaineventsbundle.php' => 1, | |
'astinadeadlinkbundle.php' => 1, | |
'migratelibchart.php' => 1, | |
'phpunit_loader.php' => 1, | |
'laraeval-travis-build.sh' => 1, | |
'sysexits.php' => 1, | |
'sociallikes.php' => 1, | |
'socialassetjs.php' => 1, | |
'socialassetflat.php' => 1, | |
'socialassetclassic.php' => 1, | |
'socialassetbirman.php' => 1, | |
'nemiro.webforms.php.sln' => 1, | |
'nemiro.webforms.php.phpproj' => 1, | |
'usf-ca-chain.pem' => 1, | |
'wiakoweformbundle.php' => 1, | |
'woopra_tracker.php' => 1, | |
'wp-local-config-sample.php' => 1, | |
'wguniversaldatatablebundle.php' => 1, | |
'argumentscheck.php' => 1, | |
'cli_daemon' => 1, | |
'wildphp.php' => 1, | |
'main.modules' => 1, | |
'config.example.neon' => 1, | |
'easyrdf.php' => 1, | |
'pubsubhubbubsubscriber.php' => 1, | |
'pubsubhubbubsubscriber.i18n.php' => 1, | |
'wiakowemandrillbundle.php' => 1, | |
'wiakowebreadcrumbbundle.php' => 1, | |
'project.ruleset.xml.example' => 1, | |
'wiakowedoctrinetableprefixbundle.php' => 1, | |
'wihocaptchabundle.php' => 1, | |
'rafie.php' => 1, | |
'configuration.ini-dist' => 1, | |
'white.php' => 1, | |
'backpack' => 1, | |
'weysandoctrineimgbundle.php' => 1, | |
'werkspotstatsdbundle.php' => 1, | |
'werkspotsitemapbundle.php' => 1, | |
'werkintmemcachedbundle.php' => 1, | |
'wellcommercewishlistbundle.php' => 1, | |
'wellcommerceunitbundle.php' => 1, | |
'wordpoints.php' => 1, | |
'getclientip.php' => 1, | |
'wellcommercetaxbundle.php' => 1, | |
'asynccurler.php' => 1, | |
'composerrunner.php' => 1, | |
'xtainunitconverterbundle.php' => 1, | |
'readme_google' => 1, | |
'googledriveexample.php' => 1, | |
'x4dsbadmin2bundle.php' => 1, | |
'travis-event-loops.sh' => 1, | |
'repository-template-compare.yml' => 1, | |
'phunin-node.yml' => 1, | |
'phunin-node' => 1, | |
'htmlscraper.php' => 1, | |
'consumessitemap.php' => 1, | |
'curler_license' => 1, | |
'jquerypostcodeswidget.php' => 1, | |
'unescapeplugin.php' => 1, | |
'jquerypostcodesasset.php' => 1, | |
'ordermodelcolumn.php' => 1, | |
'ordermodelaction.php' => 1, | |
'orderbehavior.php' => 1, | |
'wsdltophp.yml.dist' => 1, | |
'cases' => 1, | |
'wgopeniduserbundle.php' => 1, | |
'ciscosystemsauditbundle.php' => 1, | |
'fred.php' => 1, | |
'decres.php' => 1, | |
'decres.bat' => 1, | |
'virtualbundle.php' => 1, | |
'appfocusedkernel.php' => 1, | |
'wellcommercethemebundle.php' => 1, | |
'wellcommerceshopbundle.php' => 1, | |
'kinit.php' => 1, | |
'wsgeneratorbundle.php' => 1, | |
'breadcrumbitemcollection.php' => 1, | |
'breadcrumbitem.php' => 1, | |
'wellcommerceavailabilitybundle.php' => 1, | |
'wellcommerceattributebundle.php' => 1, | |
'wellcommerceappbundle.php' => 1, | |
'wellcommerceapibundle.php' => 1, | |
'wellcommerceadminbundle.php' => 1, | |
'commonmodel.php' => 1, | |
'weidealdocbundle.php' => 1, | |
'aldocexception.php' => 1, | |
'aldoc.php' => 1, | |
'wsjsformvalidatorbundle.php' => 1, | |
'wsformbundle.php' => 1, | |
'breadcrumbiteminterface.php' => 1, | |
'wsexceptionsbundle.php' => 1, | |
'nonsensebundle.php' => 1, | |
'doctrinefixturesgeneratorbundle.php' => 1, | |
'font.html' => 1, | |
'webmakerssettingbundle.php' => 1, | |
'shoppingcartcomponent.php' => 1, | |
'cartvoucherinterface.php' => 1, | |
'cartofferinterface.php' => 1, | |
'rightsmodule.php' => 1, | |
'.hg_archival' => 1, | |
'twitteroauthuser.php' => 1, | |
'twitteroauthloader.php' => 1, | |
'templateenginetrait.php' => 1, | |
'breadcrumbitemcollectioninterface.php' => 1, | |
'wellcommercecartbundle.php' => 1, | |
'wellcommerceshippingbundle.php' => 1, | |
'wellcommercemediabundle.php' => 1, | |
'wellcommercesearchbundle.php' => 1, | |
'wellcommerceroutingbundle.php' => 1, | |
'wellcommercereviewbundle.php' => 1, | |
'wellcommercereportbundle.php' => 1, | |
'wellcommerceproductstatusbundle.php' => 1, | |
'wellcommerceproductbundle.php' => 1, | |
'wellcommerceproducerbundle.php' => 1, | |
'wellcommercepaymentbundle.php' => 1, | |
'wellcommercepagebundle.php' => 1, | |
'wellcommerceorderbundle.php' => 1, | |
'wellcommerceoauthbundle.php' => 1, | |
'wellcommercenewsbundle.php' => 1, | |
'wellcommercelocalebundle.php' => 1, | |
'wellcommercecategorybundle.php' => 1, | |
'wellcommercelayoutbundle.php' => 1, | |
'wellcommercelayerednavigationbundle.php' => 1, | |
'wellcommercedoctrinebundle.php' => 1, | |
'wellcommercedistributionbundle.php' => 1, | |
'wellcommercedictionarybundle.php' => 1, | |
'wellcommercedelivererbundle.php' => 1, | |
'wellcommercecurrencybundle.php' => 1, | |
'wellcommercecouponbundle.php' => 1, | |
'wellcommercecountrybundle.php' => 1, | |
'wellcommercecorebundle.php' => 1, | |
'wellcommercecontactbundle.php' => 1, | |
'wellcommercecompanybundle.php' => 1, | |
'wellcommerceclientbundle.php' => 1, | |
'xvenginesymfonybridgebundle.php' => 1, | |
'testauth.php' => 1, | |
'templateengineexception.php' => 1, | |
'yadminbundle.php' => 1, | |
'youwefilemanagerbundle.php' => 1, | |
'ysapiparameters.ini.dist' => 1, | |
'uploadablebundle.php' => 1, | |
'tokenauthenticationbundle.php' => 1, | |
'ysettingsbundle.php' => 1, | |
'youshidosecurityuserbundle.php' => 1, | |
'ymessagesbundle.php' => 1, | |
'youshidoencryptionbundle.php' => 1, | |
'youshidodoctrineextensionbundle.php' => 1, | |
'ycmsbundle.php' => 1, | |
'youshidoblogbundle.php' => 1, | |
'apiimagesbundle.php' => 1, | |
'yotpo.phar' => 1, | |
'wannaspeakbundle.php' => 1, | |
'yosimitsoworkingforumbundle.php' => 1, | |
'test-sniff-doc.sh' => 1, | |
'nexmoverify.php' => 1, | |
'i18n-module.php' => 1, | |
'class-api-libs.php' => 1, | |
'class-api-google.php' => 1, | |
'class-api-google-client.php' => 1, | |
'class-update-manager.php' => 1, | |
'class-theme-update-manager.php' => 1, | |
'class-theme-license-manager.php' => 1, | |
'class-product.php' => 1, | |
'class-plugin-update-manager.php' => 1, | |
'youwefilemanagerevents.php' => 1, | |
'responsefilter.php' => 1, | |
'class-license-manager.php' => 1, | |
'images.php' => 1, | |
'zensideckeditorbundle.php' => 1, | |
'plugin.yaml' => 1, | |
'pusherplugin.php' => 1, | |
'pushereventpusher.php' => 1, | |
'notormtracypanel.php' => 1, | |
'srusearch.php' => 1, | |
'zeichen32gitlabapibundle.php' => 1, | |
'zeeroutelistbundle.php' => 1, | |
'zeemobiledetectservicebundle.php' => 1, | |
'zeecapifonydeployinfobundle.php' => 1, | |
'punit_bootstrap.php.dist.php' => 1, | |
'woocommerce.php' => 1, | |
'header-searchform.php' => 1, | |
'yllyassetdependencybundle.php' => 1, | |
'readme-pt_pt' => 1, | |
'simple-phpexcel-reader.iml' => 1, | |
'composer-setup.php' => 1, | |
'wp_scan.yml.dist' => 1, | |
'travis.config.sh' => 1, | |
'yammerbundle.php' => 1, | |
'targetprocessbundle.php' => 1, | |
'vdm.raml' => 1, | |
'diagram_school_persons_simple.png' => 1, | |
'diagram_school_persons.png' => 1, | |
'diagram_school_curriculum_simple.png' => 1, | |
'diagram_school_curriculum.png' => 1, | |
'blurb' => 1, | |
'class-plugin-license-manager.php' => 1, | |
'class-api-request.php' => 1, | |
'cakephp3features' => 1, | |
'xidearestbundle.php' => 1, | |
'abimusfetchbundle.php' => 1, | |
'globaldebug.php' => 1, | |
'phpxiphehtml.sublime-snippet' => 1, | |
'_html.php' => 1, | |
'marker_shadow.png' => 1, | |
'gmapsmarker.php' => 1, | |
'xideauserbundle.php' => 1, | |
'xideaurlbundle.php' => 1, | |
'xideatwitterbootstrapbundle.php' => 1, | |
'xideatemplatebundle.php' => 1, | |
'xideastuffbundle.php' => 1, | |
'xideastatusbundle.php' => 1, | |
'xideaproductbundle.php' => 1, | |
'controllerrouter.php' => 1, | |
'productevents.php' => 1, | |
'xideaprioritybundle.php' => 1, | |
'xideanotificationbundle.php' => 1, | |
'xideajquerybundle.php' => 1, | |
'xideadataflowbundle.php' => 1, | |
'xideacommentbundle.php' => 1, | |
'commentevents.php' => 1, | |
'xideacategorybundle.php' => 1, | |
'xideabookbundle.php' => 1, | |
'bookevents.php' => 1, | |
'xideabasebundle.php' => 1, | |
'dataflowinterface.php' => 1, | |
'abstractdataflow.php' => 1, | |
'dps-pxpay.php' => 1, | |
'interfacerouter.php' => 1, | |
'.gitigore' => 1, | |
'importfilewidget.php' => 1, | |
'phpdoccrontab.php' => 1, | |
'leftright.php' => 1, | |
'ydleuserbundle.php' => 1, | |
'ydlesettingsbundle.php' => 1, | |
'ydleroombundle.php' => 1, | |
'ydlenodesbundle.php' => 1, | |
'ydlelogsbundle.php' => 1, | |
'ydlehubbundle.php' => 1, | |
'ydlecorebundle.php' => 1, | |
'ydleapibundle.php' => 1, | |
'fablabmanagerbundle.php' => 1, | |
'importlogwidget.php' => 1, | |
'importbehavior.php' => 1, | |
'interfaceviewloader.php' => 1, | |
'github-checker.php' => 1, | |
'tablerow.php' => 1, | |
'yourls-loader.php' => 1, | |
'yourls-infos.php' => 1, | |
'yourls-go.php' => 1, | |
'yourls-api.php' => 1, | |
'sample-robots' => 1, | |
'sample-remote-api-call' => 1, | |
'sample-public-front-page' => 1, | |
'sample-public-api' => 1, | |
'gom.php' => 1, | |
'viewloader.php' => 1, | |
'onesapp.php' => 1, | |
'templateengineloader.php' => 1, | |
'storagetrait.php' => 1, | |
'zensidesonataimagebundle.php' => 1, | |
'vesaxrestclientbundle.php' => 1, | |
'siduseavbootstrapbundle.php' => 1, | |
'sidusdatagridbundle.php' => 1, | |
'sidusadminbundle.php' => 1, | |
'vbeesettingbundle.php' => 1, | |
'realwork' => 1, | |
'barcodegeneratorassets.php' => 1, | |
'barcodegenerator.php' => 1, | |
'alkwebbundle.php' => 1, | |
'organizer.js' => 1, | |
'bisect' => 1, | |
'plugins.sql' => 1, | |
'vesaxseobundle.php' => 1, | |
'vesaxrelationbundle.php' => 1, | |
'siduseavfilterbundle.php' => 1, | |
'maintenance_handler.php' => 1, | |
'vesaxmaintenancebundle.php' => 1, | |
'vesaxhttpkernelloggerbundle.php' => 1, | |
'vesaxguzzlebundle.php' => 1, | |
'vesaxfavoritebundle.php' => 1, | |
'favoritemanager.php' => 1, | |
'vesaxajaxcrossdomainsessionbundle.php' => 1, | |
'vesaxadminextrabundle.php' => 1, | |
'prepare' => 1, | |
'static.json' => 1, | |
'velvelreportbundle.php' => 1, | |
'search_api_elasticsearch.views.inc' => 1, | |
'siduseavdatagridbundle.php' => 1, | |
'siduseavmodelbundle.php' => 1, | |
'search_api_elasticsearch.install' => 1, | |
'ebootstrapalert.php' => 1, | |
'ebootstraplistview.php' => 1, | |
'ebootstraplinkpager.php' => 1, | |
'ebootstraphero.php' => 1, | |
'ebootstrapgridview.php' => 1, | |
'ebootstrapflashmessages.php' => 1, | |
'ebootstrapdetailview.php' => 1, | |
'ebootstrapcollapse.php' => 1, | |
'ebootstrapcode.php' => 1, | |
'ebootstrapcarousel.php' => 1, | |
'ebootstrapbuttoncolumn.php' => 1, | |
'ebootstrapbutton.php' => 1, | |
'ebootstrapbreadcrumbs.php' => 1, | |
'ebootstrapactiveform.php' => 1, | |
'siduseavvariantbundle.php' => 1, | |
'ebootstrap.php' => 1, | |
'visithor.yml.dist' => 1, | |
'visithorbundle.php' => 1, | |
'vlibtemplate.php' => 1, | |
'vlibini.php' => 1, | |
'vlibdate.php' => 1, | |
'virmytuserrefererbundle.php' => 1, | |
'auth.todo' => 1, | |
'oauth' => 1, | |
'siduspublishingbundle.php' => 1, | |
'sidusfilterbundle.php' => 1, | |
'sidusfileuploadbundle.php' => 1, | |
'sidusencryptionbundle.php' => 1, | |
'search_api_elasticsearch.module' => 1, | |
'search_api_elasticsearch.info' => 1, | |
'ebootstrapmodal.php' => 1, | |
'unialteritagbundle.php' => 1, | |
'useradapted.js' => 1, | |
'ads.js' => 1, | |
'leafletsearchasset.php' => 1, | |
'leafletsearch.php' => 1, | |
'sk_lib_i.php' => 1, | |
'phphypher.php' => 1, | |
'wp-php-console.php' => 1, | |
'moneytest.php' => 1, | |
'sample-data.json' => 1, | |
'mesh.php' => 1, | |
'databasetable.php' => 1, | |
'uniquelibsemberdataserializerbundle.php' => 1, | |
'cmediatagbundle.php' => 1, | |
'lib-doc.html' => 1, | |
'fixturegenerator.php' => 1, | |
'undeletelikesbundle.php' => 1, | |
'undeletebtceapibundle.php' => 1, | |
'patches.png' => 1, | |
'viewtwigextension.php' => 1, | |
'twigtemplateengine.php' => 1, | |
'templatingtwigextension.php' => 1, | |
'tmonologaware.php' => 1, | |
'dendecommonbundle.php' => 1, | |
'release-clone.php' => 1, | |
'get-phing.sh' => 1, | |
'classgenerator.php' => 1, | |
'readme-release' => 1, | |
'example_builder.php' => 1, | |
'objrefexamplebundle.php' => 1, | |
'opcache.module' => 1, | |
'symfonycommand.php' => 1, | |
'opcache.install' => 1, | |
'opcache.info' => 1, | |
'opcache.drush.inc' => 1, | |
'opcache.admin.inc' => 1, | |
'commerce_taxcloud.rules.inc' => 1, | |
'commerce_taxcloud.module' => 1, | |
'commerce_taxcloud.install' => 1, | |
'commerce_taxcloud.info' => 1, | |
'commerce_taxcloud.api.php' => 1, | |
'commerce_taxcloud.admin.inc' => 1, | |
'veganmenubundle.php' => 1, | |
'dunitconfig.example' => 1, | |
'vardiususerbundle.php' => 1, | |
'objrefremotebundle.php' => 1, | |
'vardiussecuritybundle.php' => 1, | |
'vardiusmenubundle.php' => 1, | |
'vardiusinvoicebundle.php' => 1, | |
'vardiusadminbundle.php' => 1, | |
'valondeeglebundle.php' => 1, | |
'valantirforumbundle.php' => 1, | |
'ajaxenginebundle.php' => 1, | |
'vvssecuritybundle.php' => 1, | |
'exttest.php' => 1, | |
'taxcloud.wsdl' => 1, | |
'project-readme' => 1, | |
'vlabsamazonmwsbundle.php' => 1, | |
'mwsclient.php' => 1, | |
'ebootstraplistviewitem.php' => 1, | |
'ebootstrapmodaltrigger.php' => 1, | |
'storageexception.php' => 1, | |
'cachestorage.php' => 1, | |
'httptrait.php' => 1, | |
'eventprocessor.php' => 1, | |
'eventmanagerexception.php' => 1, | |
'entitypool.php' => 1, | |
'entitydataextractor.php' => 1, | |
'entitycollection.php' => 1, | |
'entityattributebuilder.php' => 1, | |
'entityabstract.php' => 1, | |
'crypttrait.php' => 1, | |
'cryptexception.php' => 1, | |
'configtrait.php' => 1, | |
'configobject.php' => 1, | |
'bootstrapexception.php' => 1, | |
'imagetrait.php' => 1, | |
'sampleconfig.yaml' => 1, | |
'annotationstrait.php' => 1, | |
'webilityentityresourcebundle.php' => 1, | |
'resourcebundletrait.php' => 1, | |
'invite.php' => 1, | |
'webultdpayupaymentbundle.php' => 1, | |
'rubedo.sh' => 1, | |
'rubedo.bat' => 1, | |
'mongo.ini' => 1, | |
'composer.front.json' => 1, | |
'composer.extensions.json.dist' => 1, | |
'example-field-setup.php' => 1, | |
'cmb2-attached-posts-field.php' => 1, | |
'imageloader.php' => 1, | |
'loggertrait.php' => 1, | |
'wds-wp-rest-api-connect.php' => 1, | |
'securitytrait.php' => 1, | |
'storageevent.php' => 1, | |
'validatortrait.php' => 1, | |
'stdobjecttrait.php' => 1, | |
'stdlibtrait.php' => 1, | |
'factoryloadertrait.php' => 1, | |
'servicescope.php' => 1, | |
'servicemanagertrait.php' => 1, | |
'servicemanagerexception.php' => 1, | |
'servicecreator.php' => 1, | |
'serviceconfig.php' => 1, | |
'factoryargument.php' => 1, | |
'configcompiler.php' => 1, | |
'routertrait.php' => 1, | |
'mailerexception.php' => 1, | |
'resttrait.php' => 1, | |
'resterrorexception.php' => 1, | |
'serverabstract.php' => 1, | |
'oauth2user.php' => 1, | |
'oauth2request.php' => 1, | |
'oauth2loader.php' => 1, | |
'oauth2exception.php' => 1, | |
'mongotrait.php' => 1, | |
'mongoresult.php' => 1, | |
'mongointerface.php' => 1, | |
'mongoexception.php' => 1, | |
'mongocollection.php' => 1, | |
'mailertrait.php' => 1, | |
'attached-posts-field.png' => 1, | |
'wds-customizer-css.php' => 1, | |
'ebootstrapnavigation.php' => 1, | |
'scu_sort_available.php' => 1, | |
'volleyballfixturesbundle.php' => 1, | |
'volleyballfacilitybundle.php' => 1, | |
'volleyballenrollmentbundle.php' => 1, | |
'volleyballcoursebundle.php' => 1, | |
'vxipfieldtypebundle.php' => 1, | |
'vitrephpconsolebundle.php' => 1, | |
'limitrule.php' => 1, | |
'xml_parse.php' => 1, | |
'viewed_product.php' => 1, | |
'sort_scu.php' => 1, | |
'sestrenskyihlclass.php' => 1, | |
'sestrenskyiclass.php' => 1, | |
'script_check_comment.js' => 1, | |
'volleyballpasselbundle.php' => 1, | |
'js_examples.js' => 1, | |
'git_commands' => 1, | |
'createsmartfilterseoxml.php' => 1, | |
'bitrix_server_test.php' => 1, | |
'hl.php' => 1, | |
'angulartimeagoasset.php' => 1, | |
'ebootstrapwidget.php' => 1, | |
'ebootstraptabwrapper.php' => 1, | |
'ebootstraptabnavigation.php' => 1, | |
'ebootstraptabcontentwrapper.php' => 1, | |
'ebootstraptabcontent.php' => 1, | |
'ebootstrapsidebar.php' => 1, | |
'ebootstrapprogressbar.php' => 1, | |
'volleyballorganizationbundle.php' => 1, | |
'volleyballreportbundle.php' => 1, | |
'cmb2-user-select.php' => 1, | |
'wecodepixelspremailerbundle.php' => 1, | |
'post-search-field.png' => 1, | |
'post-search-dialog.png' => 1, | |
'cmb2_post_search_field.php' => 1, | |
'to_php_54.php' => 1, | |
'webconsulebayapibundle.php' => 1, | |
'createdoc.sh' => 1, | |
'console.neon' => 1, | |
'parameter.sql' => 1, | |
'create.jar' => 1, | |
'downloadandcompilelua.sh' => 1, | |
'testpush.php' => 1, | |
'weavingthewebframeworkextrabundle.php' => 1, | |
'premailer.php' => 1, | |
'volleyballuserbundle.php' => 1, | |
'silla' => 1, | |
'warrantylifeapiexamplebundle.php' => 1, | |
'sample-sender.php' => 1, | |
'sample-receiver.php' => 1, | |
'wuild.php' => 1, | |
'stubs.sqlite' => 1, | |
'stubs-generator.php' => 1, | |
'sliderrevolution.php' => 1, | |
'magnify-core.php' => 1, | |
'basic-auth.php' => 1, | |
'wdueditor.php' => 1, | |
'tweetarticlesbundle.php' => 1, | |
'projectpunchclockcorebundle.php' => 1, | |
'zensidecorebundle.php' => 1, | |
'cli-commands.png' => 1, | |
'directivetype.php' => 1, | |
'jobs.php' => 1, | |
'httpmessagesnewrelicmiddlewareplugin.php' => 1, | |
'httpmessagesfractalmiddlewareplugin.php' => 1, | |
'httpmessagescommercemiddlewareplugin.php' => 1, | |
'httpmessagescachemiddlewareplugin.php' => 1, | |
'httpmessagesplugin.php' => 1, | |
'helloworld.php~' => 1, | |
'related3.png' => 1, | |
'related2.png' => 1, | |
'related1.png' => 1, | |
'iveecoreinit.php' => 1, | |
'view.html' => 1, | |
'aimeosshopbundle.php' => 1, | |
'vkbundle.php' => 1, | |
'httpmessagesvalidationmiddlewareplugin.php' => 1, | |
'vkapihelperbundle.php' => 1, | |
'okbundle.php' => 1, | |
'ailovefacebookbundle.php' => 1, | |
'ailoveckeditorbundle.php' => 1, | |
'abstractsocialbundle.php' => 1, | |
'phpcs-validate.sh' => 1, | |
'tinymcepluginasset.php' => 1, | |
'pianosoloweatherbundle.php' => 1, | |
'fontawesome-markers.min.js' => 1, | |
'fontawesome-markers.json' => 1, | |
'helloworldwidget.php' => 1, | |
'slideshowpluginbundle.php' => 1, | |
'httpmessagesrestmiddlewareplugin.php' => 1, | |
'aivusresizerbundle.php' => 1, | |
'ahspushnotificationspluginbundle.php' => 1, | |
'asana-oauth.php' => 1, | |
'pimenterpriseclassificationrulebundle.php' => 1, | |
'tests.cmd' => 1, | |
'.cocomoignore' => 1, | |
'zehir.php' => 1, | |
'tokenfieldasset.php' => 1, | |
'tokenfield.php' => 1, | |
'jqueryuiasset.php' => 1, | |
'ajstudionestedsetbundle.php' => 1, | |
'ajstudioinflectbundle.php' => 1, | |
'ajstudiocentralbankbundle.php' => 1, | |
'mongosearchbundle.php' => 1, | |
'datafaker.sql' => 1, | |
'ajglvalidatoresbundle.php' => 1, | |
'gulpbusterbundle.php' => 1, | |
'nievalidator.php' => 1, | |
'dnivalidator.php' => 1, | |
'cifvalidator.php' => 1, | |
'checksumvalidator.php' => 1, | |
'cccvalidator.php' => 1, | |
'ajgltwigextensionsbundle.php' => 1, | |
'ajgljqgridbundle.php' => 1, | |
'ajgljqueryuibundle.php' => 1, | |
'ajgljquerybundle.php' => 1, | |
'ajglh5bpbundle.php' => 1, | |
'ajglcpmbundle.php' => 1, | |
'transformation_trait_docs.html' => 1, | |
'paymentgatewaybundle.php' => 1, | |
'newscoopslideshowpluginbundle.php' => 1, | |
'ahspersonabundle.php' => 1, | |
'pimdirecttomongodbbundle.php' => 1, | |
'lti_tool_provider.php' => 1, | |
'testphpconfig.ini' => 1, | |
'aegisjwtauthenticationbundle.php' => 1, | |
'license-manager' => 1, | |
'stundenplan' => 1, | |
'portfolio.php' => 1, | |
'pamm.php' => 1, | |
'active.php' => 1, | |
'advancingustripesubscriptionbundle.php' => 1, | |
'lti-tables-oracle.sql' => 1, | |
'lti-tables-oracle-pdo.sql' => 1, | |
'lti-tables-mysql.sql' => 1, | |
'lti-tables-mssql.sql' => 1, | |
'lti_data_connector_pdo.php' => 1, | |
'madalynnplumbundle.php' => 1, | |
'lti_data_connector_oci.php' => 1, | |
'lti_data_connector_none.php' => 1, | |
'lti_data_connector_mysqli.php' => 1, | |
'lti_data_connector_mysql.php' => 1, | |
'retrieval.php' => 1, | |
'adticketmediabackendimagehostingbundle.php' => 1, | |
'adticketgeonamesbundle.php' => 1, | |
'adrotecwebapibundle.php' => 1, | |
'leyertranslationadditionbundle.php' => 1, | |
'abanalyzer' => 1, | |
'silexbundle.php' => 1, | |
'aboauth2facebookgrantbundle.php' => 1, | |
'aotranslationbundle.php' => 1, | |
'aequasimemcachedbundle.php' => 1, | |
'plum.php' => 1, | |
'ahsweatherpluginbundle.php' => 1, | |
'agentsibcrontabbundle.php' => 1, | |
'ahsbelferpluginbundle.php' => 1, | |
'platform-util' => 1, | |
'openpayu_php' => 1, | |
'first.php' => 1, | |
'sharkformloggerbundle.php' => 1, | |
'agitprofilebundle.php' => 1, | |
'agitpagebundle.php' => 1, | |
'agitcronbundle.php' => 1, | |
'agitapibundle.php' => 1, | |
'agitadminbundle.php' => 1, | |
'agentsibsphinxbundle.php' => 1, | |
'jsonrpcbundle.php' => 1, | |
'agazzirestclientauthenticatorbundle.php' => 1, | |
'codeigniterinstallerplugin.php' => 1, | |
'grunthashassetsbundle.php' => 1, | |
'wpasseticbootstrap.php' => 1, | |
'test_hardened.sh' => 1, | |
'phpunit.hardened.xml' => 1, | |
'afrihostbasecommandbundle.php' => 1, | |
'github-updater.php' => 1, | |
'routertest.php' => 1, | |
'gatewaymodule.php' => 1, | |
'ferrandinixhprofbundle.php' => 1, | |
'ferrandinipdosessionbundle.php' => 1, | |
'ferrandinidisablebundle.php' => 1, | |
'gpl-v.2.0' => 1, | |
'custominstaller.php' => 1, | |
'pimdevtoolboxbundle.php' => 1, | |
'pimenhancedconnectorbundle.php' => 1, | |
'subsiteadminextension.php' => 1, | |
'vector.php' => 1, | |
'afmasseticamazons3bundle.php' => 1, | |
'module.zpm' => 1, | |
'mailmaster.php' => 1, | |
'historizer.php' => 1, | |
'schema-oracle.sql' => 1, | |
'clickatellhttp.php' => 1, | |
'ahistorizer.php' => 1, | |
'alazjjsimplebootstrapbundle.php' => 1, | |
'horus.php' => 1, | |
'html-index.png' => 1, | |
'science.php' => 1, | |
'vectorinterface.php' => 1, | |
'length.php' => 1, | |
'sitestatuscheckerbundle.php' => 1, | |
'encrypterinterface.php' => 1, | |
'decrypterinterface.php' => 1, | |
'alamedadoctrineextensionsbundle.php' => 1, | |
'dateinterval.php' => 1, | |
'bomifier.php' => 1, | |
'alk13bomifierbundle.php' => 1, | |
'const.php' => 1, | |
'quicks' => 1, | |
'extended_parse_url' => 1, | |
'bank.php' => 1, | |
'git_pull_example.sh' => 1, | |
'loft_data_grids.info' => 1, | |
'kit_php.info' => 1, | |
'jpnforphpbundle.php' => 1, | |
'afmtranslatableroutepathbundle.php' => 1, | |
'user.mail.tpl' => 1, | |
'generate-soap' => 1, | |
'tdbclient.php' => 1, | |
'pgstmt.php' => 1, | |
'pgexception.php' => 1, | |
'nemiro.data.php.sln' => 1, | |
'nemiro.data.php.phpproj' => 1, | |
'idbclient.php' => 1, | |
'dbparametertype.php' => 1, | |
'dbparametercollection.php' => 1, | |
'dbparameter.php' => 1, | |
'connectionmode.php' => 1, | |
'excel-column-iterator.php' => 1, | |
'rurupay.config-dist.php' => 1, | |
'hi.php' => 1, | |
'.gitginore' => 1, | |
'authsubscriber.php' => 1, | |
'iso3166test.php' => 1, | |
'iso3166.php' => 1, | |
'exiftool.exe' => 1, | |
'emailhelper.php' => 1, | |
'onpath.php' => 1, | |
'alcalynpayplugbundle.php' => 1, | |
'jsvars.php' => 1, | |
'alcalynflushonkernelterminatebundle.php' => 1, | |
'casuser.php' => 1, | |
'casinterface.php' => 1, | |
'experientbundle.php' => 1, | |
'tltanerpvbundle.php' => 1, | |
'user.tpl' => 1, | |
'user.layer.json' => 1, | |
'changelog-1.6' => 1, | |
'showcontacts.js' => 1, | |
'noimg.jpg' => 1, | |
'noimage.psd' => 1, | |
'noimage.png' => 1, | |
'mark.psd' => 1, | |
'manual.mht' => 1, | |
'manual.docx' => 1, | |
'imager.php' => 1, | |
'imager.inc.php' => 1, | |
'empty.png' => 1, | |
'.mark.png' => 1, | |
'xlsx.php' => 1, | |
'mht.php' => 1, | |
'contacts.tpl' => 1, | |
'infrajs.php' => 1, | |
'contacts.layer.json' => 1, | |
'contacts.css' => 1, | |
'cont.php' => 1, | |
'cont.mail.tpl' => 1, | |
'builddocsontravis.sh' => 1, | |
'akeneomeasurebundle.php' => 1, | |
'pimmagentoconnectorbundle.php' => 1, | |
'pimicecatdemobundle.php' => 1, | |
'pimdeltaexportbundle.php' => 1, | |
'pimconnectormappingbundle.php' => 1, | |
'akeneobatchbundle.php' => 1, | |
'demoextensionbundle.php' => 1, | |
'pimexcelconnectorbundle.php' => 1, | |
'.test.js' => 1, | |
'infrajs.js' => 1, | |
'user.js' => 1, | |
'metrika.tpl' => 1, | |
'sentemail.php' => 1, | |
'sitemap.tpl' => 1, | |
'seo.tpl' => 1, | |
'seo.layer.js' => 1, | |
'seo.js' => 1, | |
'seo.inc.php' => 1, | |
'seo.ext.js' => 1, | |
'rss.tpl' => 1, | |
'pages.css' => 1, | |
'mht.json' => 1, | |
'rambler.tpl' => 1, | |
'rambler.layer.js' => 1, | |
'metrika.layer.js' => 1, | |
'initjs.php' => 1, | |
'mail.layer.js' => 1, | |
'liveinternet.tpl' => 1, | |
'liveinternet.layer.js' => 1, | |
'counters.tpl' => 1, | |
'counters.layer.php' => 1, | |
'counters.layer.js' => 1, | |
'counters.json' => 1, | |
'analytics.tpl' => 1, | |
'analytics.layer.js' => 1, | |
'version.tpl' => 1, | |
'make.js' => 1, | |
'loader-red.gif' => 1, | |
'loader-green.gif' => 1, | |
'subsitemodelextension.php' => 1, | |
'adpapiuserinfo.class.php' => 1, | |
'zephyreditablebundle.php' => 1, | |
'osrssbundle.php' => 1, | |
'ably-loader.php' => 1, | |
'ably-common' => 1, | |
'kyelabundle.php' => 1, | |
'imagemagic.php' => 1, | |
'mail.blade.php' => 1, | |
'installermodule.php' => 1, | |
'coderefactorbundle.php' => 1, | |
'expandedcollectionbundle.php' => 1, | |
'ostoolsbundle.php' => 1, | |
'osormadapter.php' => 1, | |
'ossitemapbundle.php' => 1, | |
'rssgenerator.php' => 1, | |
'tcclass3-2011.pem' => 1, | |
'abcjobbundle.php' => 1, | |
'ospaymentbundle.php' => 1, | |
'openskysitemapbundle.php' => 1, | |
'osexcelbundle.php' => 1, | |
'oshookbundle.php' => 1, | |
'oscompanyreportsbundle.php' => 1, | |
'companyreports.php' => 1, | |
'instapush.class.php' => 1, | |
'maskedinputdatepicker.php' => 1, | |
'extendedhighcharts.php' => 1, | |
'formitemsfacade.php' => 1, | |
'slimsavant.php' => 1, | |
'savant.php' => 1, | |
'resolve_url.php' => 1, | |
'abcprocesscontrolbundle.php' => 1, | |
'wpenv.php' => 1, | |
'predefinedwordlistresourcehandle.php' => 1, | |
'wordlistnormalizerinterface.php' => 1, | |
'wordlistnormalizerawareproxytrait.php' => 1, | |
'wordlistnormalizerawareinterface.php' => 1, | |
'wordlistnormalizer.php' => 1, | |
'wordlistinterface.php' => 1, | |
'wordlistcomparatorinterface.php' => 1, | |
'wordlistcomparatorawareinterface.php' => 1, | |
'wordlistanalyzerinterface.php' => 1, | |
'wordlistanalyzerawareinterface.php' => 1, | |
'wordlist.php' => 1, | |
'sieveinterface.php' => 1, | |
'sieveawareinterface.php' => 1, | |
'overallsimilaritywordlistcomparator.php' => 1, | |
'abcresourcelockbundle.php' => 1, | |
'genericmatchertrait.php' => 1, | |
'fullcoveragewordlistcomparator.php' => 1, | |
'aggregatedsieveinterface.php' => 1, | |
'aggregatedmatcherinterface.php' => 1, | |
'aggregatedmatcher.php' => 1, | |
'example_config.xml' => 1, | |
'example-warning.ico' => 1, | |
'example-unknown.ico' => 1, | |
'example-ok.ico' => 1, | |
'example-critical.ico' => 1, | |
'doku.pdf' => 1, | |
'abcsequencebundle.php' => 1, | |
'abcschedulerbundle.php' => 1, | |
'grunt.js' => 1, | |
'.wpenv.example.yml' => 1, | |
'guidproviderawareinterface.php' => 1, | |
'cachecleanerbundle.php' => 1, | |
'zorbusgallerybundle.php' => 1, | |
'zorbusfaqbundle.php' => 1, | |
'zorbusdocumentbundle.php' => 1, | |
'zorbuscontactbundle.php' => 1, | |
'zorbusbannerbundle.php' => 1, | |
'zorbusarticlebundle.php' => 1, | |
'ircconnection.php' => 1, | |
'irceventlistener.php' => 1, | |
'template.class.php' => 1, | |
'ovhbundle.php' => 1, | |
'ovhapi.php' => 1, | |
'gatekeeperbundle.php' => 1, | |
'php-json-server' => 1, | |
'zorbuslinkbundle.php' => 1, | |
'ziiwebfrontendbundle.php' => 1, | |
'ziggeo.php' => 1, | |
'zzseotk.php' => 1, | |
'hreflang-canonical-image.jpg' => 1, | |
'zzcleanurls.php' => 1, | |
'formextrabundle.php' => 1, | |
'galleryimagemodel.php' => 1, | |
'synchronize-github-drupal.bat' => 1, | |
'media_mediahaven.module' => 1, | |
'media_mediahaven.info' => 1, | |
'media_mediahaven.css' => 1, | |
'zertzphotobundle.php' => 1, | |
'prepros.cfg' => 1, | |
'zorbusglossarybundle.php' => 1, | |
'zorbusmenubundle.php' => 1, | |
'wp-cli-updates-command.php' => 1, | |
'baconuserbundle.php' => 1, | |
'pl2x-remote-purge.php' => 1, | |
'page.gamma.php' => 1, | |
'page.epsilon.php' => 1, | |
'page.delta.php' => 1, | |
'page.beta.php' => 1, | |
'page.alpha.php' => 1, | |
'pagelines-developer.php' => 1, | |
'nag-squelcher.php' => 1, | |
'thumb.png' => 1, | |
'container.config.php' => 1, | |
'a2lixtranslationformbundle.php' => 1, | |
'a2lixi18ndoctrinebundle.php' => 1, | |
'bacontranslationformbundle.php' => 1, | |
'zorbusnewsletterbundle.php' => 1, | |
'baconrdstationbundle.php' => 1, | |
'baconmenubundle.php' => 1, | |
'baconlanguagebundle.php' => 1, | |
'bacongeneratorbundle.php' => 1, | |
'baconcorebundle.php' => 1, | |
'blinker_test.php' => 1, | |
'array-converter.php' => 1, | |
'zzvalidationextrabundle.php' => 1, | |
'zzcorebundle.php' => 1, | |
'zzchezzzortellbundle.php' => 1, | |
'zrgisanewrelicbundle.php' => 1, | |
'zorbustrafficbundle.php' => 1, | |
'zorbuspollbundle.php' => 1, | |
'guidprovider.php' => 1, | |
'guidproviderawaretrait.php' => 1, | |
'adpapiutility.class.php' => 1, | |
'acseobaserestbundle.php' => 1, | |
'alswaggeruibundle.php' => 1, | |
'example-self-hosted.php' => 1, | |
'example-cloud.php' => 1, | |
'activdevnoclinebundle.php' => 1, | |
'xmlrpcs.inc.php' => 1, | |
'xmlrpc_wrappers.inc' => 1, | |
'xmlrpc.inc.php' => 1, | |
'acseosqlserverbundle.php' => 1, | |
'acseographicbundle.php' => 1, | |
'acseofastshowgeneratorbundle.php' => 1, | |
'acseodynamicformbundle.php' => 1, | |
'acseochangepasswordbundle.php' => 1, | |
'php-fmt.sh' => 1, | |
'quick-start' => 1, | |
'derivedkey.php' => 1, | |
'acquiasearchservice.php' => 1, | |
'acquiasearchclient.php' => 1, | |
'acquiasearchauthplugin.php' => 1, | |
'signatureabstract.php' => 1, | |
'servicemanageraware.php' => 1, | |
'randomstringnoncer.php' => 1, | |
'noncerinterface.php' => 1, | |
'noncerabstract.php' => 1, | |
'acquianetworkclient.php' => 1, | |
'jsoninterface.php' => 1, | |
'environmentinterface.php' => 1, | |
'memcacheserviceinterface.php' => 1, | |
'actualysdrupalcommerceconnectorbundle.php' => 1, | |
'dxf colortable.ods' => 1, | |
'memcachecredentials.php' => 1, | |
'aww.php' => 1, | |
'adpapiconnection.class.php' => 1, | |
'fcgiget.php' => 1, | |
'adnsummernotebundle.php' => 1, | |
'pitechkernelinterface.php' => 1, | |
'pitechkernel.php' => 1, | |
'pitechbundleinterface.php' => 1, | |
'pitechbundle.php' => 1, | |
'install_apps.sh' => 1, | |
'expressofoobundle.php' => 1, | |
'defterdar.php' => 1, | |
'aefeaturebundle.php' => 1, | |
'deruweslugifybundle.php' => 1, | |
'aww' => 1, | |
'linetype.php' => 1, | |
'example.lock.php' => 1, | |
'histogram.php' => 1, | |
'gauge.php' => 1, | |
'adanfmbeonpopapibundle.php' => 1, | |
'adamquailefieldsetbundle.php' => 1, | |
'flatbase.json' => 1, | |
'flatbase' => 1, | |
'cli-demo.gif' => 1, | |
'phpunit_functional.xml' => 1, | |
'env-example.php' => 1, | |
'regex.json' => 1, | |
'sculpin.lock' => 1, | |
'sculpin.json' => 1, | |
'memcacheservice.php' => 1, | |
'localenvironment.php' => 1, | |
'guidproviderinterface.php' => 1, | |
'llum' => 1, | |
'accestoinstallerbundle.php' => 1, | |
'setpayu.php' => 1, | |
'payupaymentfactory.php' => 1, | |
'payugatewayfactory.php' => 1, | |
'openpayuwrapper.php' => 1, | |
'workerbundleevents.php' => 1, | |
'workerbundle.php' => 1, | |
'remoteserverbundle.php' => 1, | |
'dispatcherbundle.php' => 1, | |
'acfwurflbundle.php' => 1, | |
'test_teardown.sh' => 1, | |
'test_setup.sh' => 1, | |
'old-readme' => 1, | |
'_composer.json' => 1, | |
'adminlte-laravel' => 1, | |
'test-with-adminlte.sh' => 1, | |
'sandbox_setup_withadminlte.sh' => 1, | |
'laravoole' => 1, | |
'imagist' => 1, | |
'testkernel.php' => 1, | |
'memorysessionstorage.php' => 1, | |
'kerneltestcase.php' => 1, | |
'customcallbackcompilerpass.php' => 1, | |
'accessdeniedlistener.php' => 1, | |
'reflectionmethodhelper.php' => 1, | |
'namegeneratortrait.php' => 1, | |
'nameawareinterface.php' => 1, | |
'_readme' => 1, | |
'_phpunit.xml.dist' => 1, | |
'cloudenvironmentinterface.php' => 1, | |
'modifier.php' => 1, | |
'cloudenvironmentaware.php' => 1, | |
'cloudenvironment.php' => 1, | |
'databaseserviceinterface.php' => 1, | |
'databasecredentials.php' => 1, | |
'cloudapiclient.php' => 1, | |
'cloudapiauthplugin.php' => 1, | |
'composer_travis.json' => 1, | |
'acmephpbundle.php' => 1, | |
'sample_captcha.php' => 1, | |
'lwihdbundle.php' => 1, | |
'entryinterface.php' => 1, | |
'ac_module_internals.png' => 1, | |
'zmcimagebundle.php' => 1, | |
'_travis.yml' => 1, | |
'aciliaviewcounterbundle.php' => 1, | |
'aciliavideoproviderbundle.php' => 1, | |
'aciliatranslationbundle.php' => 1, | |
'aciliasearchenginebundle.php' => 1, | |
'aciliaratingbundle.php' => 1, | |
'aciliaoauth2bundle.php' => 1, | |
'aciliametatagsbundle.php' => 1, | |
'aciliadbloggerbundle.php' => 1, | |
'aciliacorebundle.php' => 1, | |
'aciliabannerbundle.php' => 1, | |
'receivdata.php' => 1, | |
'ftpupload.php' => 1, | |
'webanalytics.local.php.dist' => 1, | |
'phoreman' => 1, | |
'orbitaletranslationbundle.php' => 1, | |
'i18n.php.example' => 1, | |
'phpresquebundle.php' => 1, | |
'cekurtemailerbundle.php' => 1, | |
'cekurtelivebuzzbundle.php' => 1, | |
'cekurteinsightlytaskbundle.php' => 1, | |
'cekurteinsightlybundle.php' => 1, | |
'cekurtegoogleapibundle.php' => 1, | |
'cekurtegeneratorbundle.php' => 1, | |
'cekurtefixturesbundle.php' => 1, | |
'cavejatoshlbundle.php' => 1, | |
'default-template.odt' => 1, | |
'default-template.ods' => 1, | |
'default-template-with-replaces.odt' => 1, | |
'spreadsheet.php' => 1, | |
'phpresque.php' => 1, | |
'cekurteuploaderbundle.php' => 1, | |
'kdbparametersbundle.php' => 1, | |
'res.7z' => 1, | |
'prepare.bash' => 1, | |
'integrationtest.xml' => 1, | |
'loadfail.php' => 1, | |
'errorhandling.php' => 1, | |
'canaltptyrbundle.php' => 1, | |
'canaltpsammonitoringbundle.php' => 1, | |
'canaltpsamecoreusermanagerbundle.php' => 1, | |
'canaltpsamecoresecuritybundle.php' => 1, | |
'commonbusinessinterface.php' => 1, | |
'canaltpsamecoreapplicationmanagerbundle.php' => 1, | |
'cekurtepagebundle.php' => 1, | |
'cekurteuserbundle.php' => 1, | |
'canaltpsamcorebundle.php' => 1, | |
'engines.ini.dist' => 1, | |
'opengraphprotocol.php' => 1, | |
'library.json' => 1, | |
'instance.sh' => 1, | |
'ec2-attached-volumes-snapshot.php' => 1, | |
'ec2-attached-volumes-prune.php' => 1, | |
'backup.sh.default' => 1, | |
'parsepowermail.php' => 1, | |
'chmatexcelbundle.php' => 1, | |
'go.bat' => 1, | |
'doxygen.ini.dist' => 1, | |
'doc.xml.dist' => 1, | |
'cmclasses.ini.dist' => 1, | |
'doc.xml' => 1, | |
'sepadirectdebitfile.php' => 1, | |
'mail.ini' => 1, | |
'setrights.sh' => 1, | |
'index.php5' => 1, | |
'checkfilepermissions.php' => 1, | |
'boot.php5' => 1, | |
'.htpasswd' => 1, | |
'doc-creator.php' => 1, | |
'doc-creator.xml' => 1, | |
'compat.php' => 1, | |
'autoload.php5' => 1, | |
'common.ini' => 1, | |
'cethyworkszopimchatbundle.php' => 1, | |
'cssparsed.css' => 1, | |
'slugify.php' => 1, | |
'canaltpsamcorebridgebundle.php' => 1, | |
'task_restart.php' => 1, | |
'campaignchaincampaignscheduledcampaignbundle.php' => 1, | |
'campaignchaindistributioncebundle.php' => 1, | |
'campaignchaincorebundle.php' => 1, | |
'campaignchainchannelwebsitebundle.php' => 1, | |
'campaignchainchanneltwitterbundle.php' => 1, | |
'campaignchainchannellinkedinbundle.php' => 1, | |
'campaignchainchannelgoogleanalyticsbundle.php' => 1, | |
'campaignchainchannelfacebookbundle.php' => 1, | |
'campaignchainchannelezplatformbundle.php' => 1, | |
'campaignchainchannelcitrixbundle.php' => 1, | |
'changelog-1.0.0-beta' => 1, | |
'changelog-1.0.0-alpha' => 1, | |
'campaignchaincampaigntemplatebundle.php' => 1, | |
'campaignchaincampaignrepeatingbundle.php' => 1, | |
'campaignchainhookassigneebundle.php' => 1, | |
'campaignchainactivitytwitterbundle.php' => 1, | |
'campaignchainactivitysocialmediabundle.php' => 1, | |
'campaignchainactivitymailchimpbundle.php' => 1, | |
'campaignchainactivitylinkedinbundle.php' => 1, | |
'campaignchainactivitygotowebinarbundle.php' => 1, | |
'campaignchainactivityfacebookbundle.php' => 1, | |
'campaignchainactivityezplatformbundle.php' => 1, | |
'client-map' => 1, | |
'aeria.php' => 1, | |
'aeria-activator.php' => 1, | |
'alexpsocialauthbundle.php' => 1, | |
'stravastrategy.php' => 1, | |
'license.rtf' => 1, | |
'campaignchaindochtmlbundle.php' => 1, | |
'campaignchainhookdaterepeatbundle.php' => 1, | |
'canaltpnmmportalbundle.php' => 1, | |
'campaignchainoperationmailchimpbundle.php' => 1, | |
'canaltpnmmportalbridgebundle.php' => 1, | |
'navitiaprofilerbundle.php' => 1, | |
'navitiaexceptionfactory.php' => 1, | |
'abstractfactory.php' => 1, | |
'canaltpmediamanagerbundle.php' => 1, | |
'campaignchainsecurityauthenticationserveroauthbundle.php' => 1, | |
'campaignchainsecurityauthenticationclientoauthbundle.php' => 1, | |
'campaignchainreportgoogleanalyticsbundle.php' => 1, | |
'campaignchainreportanalyticsmetricsperactivitybundle.php' => 1, | |
'campaignchainreportanalyticsctatrackingbundle.php' => 1, | |
'campaignchainoperationtwitterbundle.php' => 1, | |
'campaignchainoperationsocialmediabundle.php' => 1, | |
'campaignchainoperationlinkedinbundle.php' => 1, | |
'campaignchainhookduebundle.php' => 1, | |
'campaignchainoperationgotowebinarbundle.php' => 1, | |
'campaignchainoperationfacebookbundle.php' => 1, | |
'campaignchainoperationezplatformbundle.php' => 1, | |
'campaignchainmilestonescheduledmilestonebundle.php' => 1, | |
'campaignchainlocationwebsitebundle.php' => 1, | |
'campaignchainlocationtwitterbundle.php' => 1, | |
'campaignchainlocationlinkedinbundle.php' => 1, | |
'campaignchainlocationgoogleanalyticsbundle.php' => 1, | |
'campaignchainlocationfacebookbundle.php' => 1, | |
'campaignchainlocationezplatformbundle.php' => 1, | |
'campaignchainlocationcitrixbundle.php' => 1, | |
'campaignchainhooktimespanbundle.php' => 1, | |
'campaignchainhookdurationbundle.php' => 1, | |
'yandextranslatorbundle.php' => 1, | |
'worker_restart.php' => 1, | |
'cpalexsurchargebundlebundle.php' => 1, | |
'doctrine1.php' => 1, | |
'barrating.php' => 1, | |
'pharer.php' => 1, | |
'style_guide.php' => 1, | |
'coderspottingtoastmessagebundle.php' => 1, | |
'delorean' => 1, | |
'twig_gear.services.yml' => 1, | |
'twig_gear.module' => 1, | |
'twig_gear.info.yml' => 1, | |
'angulasil.theme' => 1, | |
'angulasil.libraries.yml' => 1, | |
'angulasil.info.yml' => 1, | |
'script.robo' => 1, | |
'ffmpegmovie.php' => 1, | |
'barratingpluginasset.php' => 1, | |
'ffmpegframe.php' => 1, | |
'ffmpegautoloader.php' => 1, | |
'ffmpeganimatedgif.php' => 1, | |
'repositoryaliasbundle.php' => 1, | |
'rulesenginefactory.php' => 1, | |
'rulesengine.php' => 1, | |
'codememerulesbundle.php' => 1, | |
'codememeironmqbundle.php' => 1, | |
'codeloversloggingbundle.php' => 1, | |
'codeloversjshintbundle.php' => 1, | |
'codeloversrestbundle.php' => 1, | |
'codeloversphpstormbundle.php' => 1, | |
'barratingasset.php' => 1, | |
'guielement.php' => 1, | |
'codeloversdoctrineencryptbundle.php' => 1, | |
'iobject.php' => 1, | |
'frontcontrollerinterface.php' => 1, | |
'errorhandlinginterface.php' => 1, | |
'dateinterface.php' => 1, | |
'code-generator.php' => 1, | |
'negotiation.php' => 1, | |
'http-verbs.php' => 1, | |
'first-example.php' => 1, | |
'objectsinglecollection.php' => 1, | |
'objectmulticollection.php' => 1, | |
'iobjectsinglecollection.php' => 1, | |
'iobjectmulticollection.php' => 1, | |
'iobjectcollection.php' => 1, | |
'idb.php' => 1, | |
'guiframe.php' => 1, | |
'abstractdb.php' => 1, | |
'viewscontroller.php' => 1, | |
'methodscontroller.php' => 1, | |
'localconfig.php' => 1, | |
'idynamiccollection.php' => 1, | |
'dynamiccollection.php' => 1, | |
'responsetype.php' => 1, | |
'requesttype.php' => 1, | |
'calltype.php' => 1, | |
'guistring.php' => 1, | |
'guiscrollablewindow.php' => 1, | |
'guiresizeevent.php' => 1, | |
'guiprogressbar.php' => 1, | |
'typename.php' => 1, | |
'codeloversangularbundle.php' => 1, | |
'chokapixjcropimagebundle.php' => 1, | |
'acf-modules-setup.json' => 1, | |
'organismtemplate.php' => 1, | |
'atomtemplate.php' => 1, | |
'cnp-molecule-builder.php' => 1, | |
'queried-object-parser.php' => 1, | |
'print-on-present.php' => 1, | |
'p2p-connections.php' => 1, | |
'nav-filters.php' => 1, | |
'inline-svg.php' => 1, | |
'human-timing.php' => 1, | |
'highest-ancestor.php' => 1, | |
'add-favicon.php' => 1, | |
'acf-modules.php' => 1, | |
'haversine.php' => 1, | |
'application_enter.php' => 1, | |
'cnp-atom-builder.php' => 1, | |
'ciscajabugminerestbundle.php' => 1, | |
'circleutilitybundle.php' => 1, | |
'circlerestclientbundle.php' => 1, | |
'cimusgeobundle.php' => 1, | |
'cimusgearmanbundle.php' => 1, | |
'timelinejsbundle.php' => 1, | |
'mercurialnode.php' => 1, | |
'mercurialmanager.php' => 1, | |
'interkassabundle.php' => 1, | |
'christianvermeulenpostalcodebundle.php' => 1, | |
'christianriesenpasswordhashbundle.php' => 1, | |
'ckrupahubicapibundle.php' => 1, | |
'includes.php' => 1, | |
'config_social_default.php' => 1, | |
'codeloversaclbundle.php' => 1, | |
'.cleantalk.class.php.swp' => 1, | |
'init.production.php' => 1, | |
'init.development.php' => 1, | |
'encryption.key' => 1, | |
'codagrestfabricationbundle.php' => 1, | |
'codagpredictioniobundle.php' => 1, | |
'codagalchemyapibundle.php' => 1, | |
'optionallocalebundle.php' => 1, | |
'db_example.sql' => 1, | |
'clickandmortarimportbundle.php' => 1, | |
'cleeng_api.php' => 1, | |
'cleantalkvalidator.php' => 1, | |
'cleantalkapi.php' => 1, | |
'clasticuserbundle.php' => 1, | |
'classpreloader.php' => 1, | |
'clastictextbundle.php' => 1, | |
'clastictaxonomybundle.php' => 1, | |
'clasticsecuritybundle.php' => 1, | |
'clasticnodebundle.php' => 1, | |
'clasticgeneratorbundle.php' => 1, | |
'clasticfrontbundle.php' => 1, | |
'nodeevents.php' => 1, | |
'clasticcorebundle.php' => 1, | |
'clasticblockbundle.php' => 1, | |
'clasticnewsbundle.php' => 1, | |
'clastichttpcachebundle.php' => 1, | |
'clasticgoogleanalyticsbundle.php' => 1, | |
'clasticblogbundle.php' => 1, | |
'testwidgetbundle.php' => 1, | |
'moukmoukibundle.php' => 1, | |
'randomstringinterface.php' => 1, | |
'yamm.php' => 1, | |
'yiiquickswapmodule.php' => 1, | |
'merrorhandler.php' => 1, | |
'bdkenquirybundle.php' => 1, | |
'bdkasyncdispatcherbundle.php' => 1, | |
'bobrdschedulerbundle.php' => 1, | |
'processmanager.phar' => 1, | |
'bobrdmessagebusbundle.php' => 1, | |
'architect-composer.sublime-project' => 1, | |
'yandexmoneygatewayfactory.php' => 1, | |
'graythemeasset.php' => 1, | |
'bluethemeasset.php' => 1, | |
'yammasset.php' => 1, | |
'blueteapushnotificationsbundle.php' => 1, | |
'iactivate.php' => 1, | |
'blueteajirarestapibundle.php' => 1, | |
'blueteaimportevents.php' => 1, | |
'blueteaimportbundle.php' => 1, | |
'blueteaexportevents.php' => 1, | |
'blueteaexportbundle.php' => 1, | |
'blueteacrowdauthenticationbundle.php' => 1, | |
'testdox-output' => 1, | |
'create-sqlite.sql' => 1, | |
'create-pgsql.sql' => 1, | |
'create-mysql.sql' => 1, | |
'test results' => 1, | |
'pubspec.yaml' => 1, | |
'admin.info' => 1, | |
'data_tools.info' => 1, | |
'bloghovenjekyllproviderbundle.php' => 1, | |
'botanickserializerbundle.php' => 1, | |
'woocommerce-role-based-coupons.php' => 1, | |
'bs-unset-free.php' => 1, | |
'divi_cpt_builder.php' => 1, | |
'.php.tags' => 1, | |
'bbitsqscommandqueuebundle.php' => 1, | |
'subtree.sh' => 1, | |
'bbitblogbundle.php' => 1, | |
'bbitauditlogbundle.php' => 1, | |
'bbitasyncdispatcherbundle.php' => 1, | |
'branchbitairgrambundle.php' => 1, | |
'cortex-plugin.php' => 1, | |
'.envrc' => 1, | |
'expect.php' => 1, | |
'data_tools.php' => 1, | |
'imagsimplecachebundle.php' => 1, | |
'imagnotifierbundle.php' => 1, | |
'bomoicalbundle.php' => 1, | |
'imagfilesbundle.php' => 1, | |
'imagetherpadbundle.php' => 1, | |
'imagcsvbundle.php' => 1, | |
'toolsconvert.php' => 1, | |
'toolsblanknode.php' => 1, | |
'parserturtle.php' => 1, | |
'parsersparqlresult.php' => 1, | |
'conversionmimetype.php' => 1, | |
'eyiipdf.php' => 1, | |
'downloader.php' => 1, | |
'bluebearbasebundle.php' => 1, | |
'bloghovenblosxomdirproviderbundle.php' => 1, | |
'todo.dev' => 1, | |
'module-payment.csv' => 1, | |
'module-sales-sequence.csv' => 1, | |
'module-sales-rule.csv' => 1, | |
'module-rule.csv' => 1, | |
'module-rss.csv' => 1, | |
'module-review.csv' => 1, | |
'module-require-js.csv' => 1, | |
'module-reports.csv' => 1, | |
'module-quote.csv' => 1, | |
'module-product-video.csv' => 1, | |
'module-product-alert.csv' => 1, | |
'module-persistent.csv' => 1, | |
'module-paypal.csv' => 1, | |
'module-page-cache.csv' => 1, | |
'module-search.csv' => 1, | |
'module-offline-shipping.csv' => 1, | |
'module-offline-payments.csv' => 1, | |
'module-newsletter.csv' => 1, | |
'module-multishipping.csv' => 1, | |
'module-msrp.csv' => 1, | |
'module-media-storage.csv' => 1, | |
'module-marketplace.csv' => 1, | |
'module-layered-navigation.csv' => 1, | |
'module-integration.csv' => 1, | |
'module-indexer.csv' => 1, | |
'module-import-export.csv' => 1, | |
'module-grouped-product.csv' => 1, | |
'module-grouped-import-export.csv' => 1, | |
'module-sales.csv' => 1, | |
'module-send-friend.csv' => 1, | |
'bloghovenblogbundle.php' => 1, | |
'module-webapi.csv' => 1, | |
'bloghovenabstractthemebundle.php' => 1, | |
'phpdoccheck' => 1, | |
'pluginconfig.php.example' => 1, | |
'loggerconfig.php.example' => 1, | |
'daemonise' => 1, | |
'.phpci.yml' => 1, | |
'octocmd' => 1, | |
'theme-frontend-luma.csv' => 1, | |
'theme-frontend-blank.csv' => 1, | |
'module-wishlist.csv' => 1, | |
'module-widget.csv' => 1, | |
'module-weee.csv' => 1, | |
'module-version.csv' => 1, | |
'module-shipping.csv' => 1, | |
'module-variable.csv' => 1, | |
'module-usps.csv' => 1, | |
'module-user.csv' => 1, | |
'module-url-rewrite.csv' => 1, | |
'module-ups.csv' => 1, | |
'module-ui.csv' => 1, | |
'module-translation.csv' => 1, | |
'module-theme.csv' => 1, | |
'module-tax.csv' => 1, | |
'module-tax-import-export.csv' => 1, | |
'module-swatches.csv' => 1, | |
'module-store.csv' => 1, | |
'module-sitemap.csv' => 1, | |
'woocommerce-referralcandy.php' => 1, | |
'bfosbrasilbundle.php' => 1, | |
'cpalexdashboardbundle.php' => 1, | |
'bureaupieperstoreebundle.php' => 1, | |
'media_bynder.install' => 1, | |
'media_bynder.info' => 1, | |
'media_bynder.css' => 1, | |
'bushidoioqrcodebundle.php' => 1, | |
'bushidoiopdfbundle.php' => 1, | |
'wsdl.php' => 1, | |
'autodiscover.php' => 1, | |
'part.php' => 1, | |
'glaze-old.php' => 1, | |
'keyvaluecontainer.php' => 1, | |
'burgovkeyvalueformbundle.php' => 1, | |
'burgovcmsbundle.php' => 1, | |
'thunder.profile' => 1, | |
'eventmapper.php' => 1, | |
'thunder.install' => 1, | |
'thunder.info.yml' => 1, | |
'premake.sh' => 1, | |
'drupal-org.make.yml' => 1, | |
'drupal-org-core.make.yml' => 1, | |
'drupal-org-core.make' => 1, | |
'develop.make.yml' => 1, | |
'develop.make' => 1, | |
'build-thunder.make.yml' => 1, | |
'build-thunder.make' => 1, | |
'ivw_integration.tokens.inc' => 1, | |
'ivw_integration.services.yml' => 1, | |
'ivw_integration.routing.yml' => 1, | |
'media_bynder.module' => 1, | |
'ccetcerrorreportbundle.php' => 1, | |
'ivw_integration.links.menu.yml' => 1, | |
'update_production.sh' => 1, | |
'simucpabundle.php' => 1, | |
'simusantechatbundle.php' => 1, | |
'convconvbundle.php' => 1, | |
'cpasimusanteexoverridebundle.php' => 1, | |
'cpasimusantesimusanteoverridebundle.php' => 1, | |
'cpasimusantesimupollbundle.php' => 1, | |
'cpasimusanteprocompetencybundle.php' => 1, | |
'cpasimusanteitemselectorbundle.php' => 1, | |
'cpasimusanteclarolinelayoutoverridebundle.php' => 1, | |
'cpasimusanteclacoadminbundle.php' => 1, | |
'cpasimusantechartnewbundle.php' => 1, | |
'cpasimusantechartjsbundle.php' => 1, | |
'management_utils.sh' => 1, | |
'ccetcdirectorybundle.php' => 1, | |
'install_config.sh' => 1, | |
'env_config.base' => 1, | |
'email_config.base' => 1, | |
'db_config.base' => 1, | |
'schemasyncwrapper.sh' => 1, | |
'config.autoload.dao.orm.global.php' => 1, | |
'config.autoload.auth.page.local.php' => 1, | |
'config.autoload.auth.login.local.php' => 1, | |
'ngen_ant.xml' => 1, | |
'certunlpngenbundle.php' => 1, | |
'libkml.php' => 1, | |
'ccetcimportbundle.php' => 1, | |
'ccetcdirectoryuserbundle.php' => 1, | |
'ivw_integration.module' => 1, | |
'ivw_integration.install' => 1, | |
'bfosfretebraspressbundle.php' => 1, | |
'aceadminjqgridasset.php' => 1, | |
'scehma' => 1, | |
'configuration.yml' => 1, | |
'broutouspageeditorbundle.php' => 1, | |
'pulseconnect.php' => 1, | |
'briteapicontact.php' => 1, | |
'briteapiclient.php' => 1, | |
'default.ini' => 1, | |
'restsdk.php' => 1, | |
'enabledinterface.php' => 1, | |
'example-layout.php' => 1, | |
'aceadminwysiwygasset.php' => 1, | |
'aceadminwizardasset.php' => 1, | |
'aceadminasset.php' => 1, | |
'smarthome.php' => 1, | |
'skin.json' => 1, | |
'script.sh' => 1, | |
'refreshed.skin.php' => 1, | |
'brein-api-library-php.iml' => 1, | |
'bfostwigextensionsbundle.php' => 1, | |
'bfossynccontentbundle.php' => 1, | |
'bfossettingsmanagementbundle.php' => 1, | |
'bfospagsegurobundle.php' => 1, | |
'bfospagamentodigitalbundle.php' => 1, | |
'bfospagamentobundle.php' => 1, | |
'bfosnotafiscalbundle.php' => 1, | |
'bfosgatewaylocawebbundle.php' => 1, | |
'bfosfretebundle.php' => 1, | |
'mysqli.php' => 1, | |
'cltr.php' => 1, | |
'ivw_integration.info.yml' => 1, | |
'bukashk0zzztimestamptypebundle.php' => 1, | |
'breakpoint_js_settings.routing.yml' => 1, | |
'breakpoint_js_settings.module' => 1, | |
'breakpoint_js_settings.links.menu.yml' => 1, | |
'breakpoint_js_settings.info.yml' => 1, | |
'ad_integration.tokens.inc' => 1, | |
'ad_integration.services.yml' => 1, | |
'ad_integration.routing.yml' => 1, | |
'ad_integration.module' => 1, | |
'ad_integration.links.menu.yml' => 1, | |
'ad_integration.libraries.yml' => 1, | |
'ad_integration.install' => 1, | |
'ad_integration.info.yml' => 1, | |
'sample-microbilt.php' => 1, | |
'vk_methods' => 1, | |
'microbiltwsdlclass.php' => 1, | |
'microbiltclassmap.php' => 1, | |
'microbiltautoload.php' => 1, | |
'bukashk0zzzliipimagineserializationbundle.php' => 1, | |
'bukashk0zzzhellosignbundle.php' => 1, | |
'bukashk0zzzfilterbundle.php' => 1, | |
'file2add' => 1, | |
'default.xlf' => 1, | |
'branch_beta' => 1, | |
'modulebotstatisticsversion.php' => 1, | |
'composer.json.back' => 1, | |
'yadr.php' => 1, | |
'vkdr.php' => 1, | |
'numbertotextinterface.php' => 1, | |
'siteinterface.php' => 1, | |
'module-google-analytics.csv' => 1, | |
'eccube_install.sh' => 1, | |
'egyg33kcsvbundle.php' => 1, | |
'eetestsgeneratorbundle.php' => 1, | |
'eetysbundle.php' => 1, | |
'eelightuserbundle.php' => 1, | |
'eeextramailerbundle.php' => 1, | |
'eeexceptionjsbundle.php' => 1, | |
'eeembedlybundle.php' => 1, | |
'eedataexporterbundle.php' => 1, | |
'edsitechsirtrevorbundle.php' => 1, | |
'saferedisclient.php' => 1, | |
'redisguzzlecache.php' => 1, | |
'edsitechgandibundle.php' => 1, | |
'campaigncommandernotificationmessagingexception.php' => 1, | |
'epicr2riobundle.php' => 1, | |
'campaigncommandernotificationmessaging.php' => 1, | |
'campaigncommandermemberexception.php' => 1, | |
'campaigncommandermember.php' => 1, | |
'evencesoftdeleteableextensionbundle.php' => 1, | |
'evencegridbundle.php' => 1, | |
'voicesofpoll.php' => 1, | |
'polldb.php' => 1, | |
'dwollaswagger.php' => 1, | |
'dbsr_gui_bootstrapper.php' => 1, | |
'dbsr_gui.php' => 1, | |
'dbsr_cli_bootstrapper.php' => 1, | |
'dbsr_cli.php' => 1, | |
'egyg33kdomainparserbundle.php' => 1, | |
'esnesnbundle.php' => 1, | |
'dudytzdoctrineuuidbundle.php' => 1, | |
'workerregistry.php' => 1, | |
'poi.php' => 1, | |
'voice.php' => 1, | |
'transfer.php' => 1, | |
'shortvideo.php' => 1, | |
'music.php' => 1, | |
'encryptionexception.php' => 1, | |
'devicehttpexception.php' => 1, | |
'init-error-handling.php' => 1, | |
'init-environment.php' => 1, | |
'.ppi-settings.json' => 1, | |
'.ppi-settings-metadata.json' => 1, | |
'.eipi.json' => 1, | |
'serviceawareworkerfactory.php' => 1, | |
'etsechosignbundle.php' => 1, | |
'exsystworkerbundle.php' => 1, | |
'workerpool.php' => 1, | |
'workerfactory.php' => 1, | |
'sharedworkerimplementationinterface.php' => 1, | |
'sharedworker.php' => 1, | |
'rawworkerimplementationinterface.php' => 1, | |
'eventedworkerimplementationinterface.php' => 1, | |
'exsystsecuritybundle.php' => 1, | |
'stateinterface.php' => 1, | |
'sink.php' => 1, | |
'selectableinterface.php' => 1, | |
'exsystapibundle.php' => 1, | |
'etspaymentdotpaybundle.php' => 1, | |
'dbsr.php' => 1, | |
'dzcronmanagerbundle.php' => 1, | |
'badrequestexception.php' => 1, | |
'difanecontentpartbundle.php' => 1, | |
'divipropelloggerbundle.php' => 1, | |
'orkestraapcbundle.php' => 1, | |
'diviajaxloginbundle.php' => 1, | |
'ddgetdocuments_snippet.php' => 1, | |
'modx.ddtools.class.php' => 1, | |
'displore.json' => 1, | |
'deploymentbundle.php' => 1, | |
'dildenfeedbackasset.php' => 1, | |
'dildenfeedback.php' => 1, | |
'mikepearceeasybacklogapibundle.php' => 1, | |
'helper.less' => 1, | |
'difanetwigdatabasebundle.php' => 1, | |
'robin.class.php' => 1, | |
'exiguousecommerceitem.php' => 1, | |
'yiidisquswidget.php' => 1, | |
'actionplugin.php' => 1, | |
'aclpath.php' => 1, | |
'consoledemo.php' => 1, | |
'console-php.php' => 1, | |
'ecommerce.xsd' => 1, | |
'entitygeneratorbundle.php' => 1, | |
'hofplexexportbundle.php' => 1, | |
'treenodesreorderaction.php' => 1, | |
'treenodemoveaction.php' => 1, | |
'jstreeassetbundle.php' => 1, | |
'contextmenuhelper.php' => 1, | |
'adjacencyfulltreedataaction.php' => 1, | |
'basketitem.php' => 1, | |
'djamygooglecalendarbundle.php' => 1, | |
'rootca' => 1, | |
'_before_test.php' => 1, | |
'drensoicalbundle.php' => 1, | |
'example.html.php' => 1, | |
'sqls.iml' => 1, | |
'typo3.xml' => 1, | |
'qa.xml' => 1, | |
'ladder.json.sample' => 1, | |
'license-orig' => 1, | |
'naith.php' => 1, | |
'naith' => 1, | |
'naithjunitreport.class.php' => 1, | |
'naithclirunner.class.php' => 1, | |
'naithclireport.class.php' => 1, | |
'templator.php' => 1, | |
'davidjegatasseticminifierbundle.php' => 1, | |
'templator.js' => 1, | |
'devreadme' => 1, | |
'logintemplate.tpl' => 1, | |
'commonjs.php' => 1, | |
'beforeaftercontrollershooksbundle.php' => 1, | |
'dwdqiniusdkbundle.php' => 1, | |
'dowdowleagueoflegendsapibundle.php' => 1, | |
'src.zip' => 1, | |
'mysheet.tar' => 1, | |
'sam.json.example' => 1, | |
'.scutinizer.yml' => 1, | |
'djegjambundle.php' => 1, | |
'davidjegatjimportbundle.php' => 1, | |
'semantic.php' => 1, | |
'guard.php' => 1, | |
'activerecordbehavior.php' => 1, | |
'pure' => 1, | |
'elorfinresourcebundle.php' => 1, | |
'elorfinjsonapibundle.php' => 1, | |
'oxidfactory.php' => 1, | |
'oxidawaretrait.php' => 1, | |
'oxidawareinterface.php' => 1, | |
'oxidaware.php' => 1, | |
'databaseinstaller.php' => 1, | |
'assettransitions.php' => 1, | |
'search_hooks.php' => 1, | |
'icondirect.php' => 1, | |
'topicposts.php' => 1, | |
'elgg.xml' => 1, | |
'console.config.php.example' => 1, | |
'elsassseeraiweresarticlebundle.php' => 1, | |
'monologfluentdbundle.php' => 1, | |
'elendevwidgetbundle.php' => 1, | |
'elendevroxyfilemanbundle.php' => 1, | |
'simpleimageproxyfactory.php' => 1, | |
'simpleimageproxy.php' => 1, | |
'nofileimageproxy.php' => 1, | |
'imageproxyfactory.php' => 1, | |
'imageproxy.php' => 1, | |
'elendevimagebundle.php' => 1, | |
'elendevcheckoutbundle.php' => 1, | |
'checkoutserviceprovider.php' => 1, | |
'checkoutservice.php' => 1, | |
'elorfinuserbundle.php' => 1, | |
'elsassseeraiweresbarbundle.php' => 1, | |
'elasticpushbundle.php' => 1, | |
'omnidesk.php' => 1, | |
'modelguidbase.php' => 1, | |
'managerbase.php' => 1, | |
'componentbase.php' => 1, | |
'epdoctrinelockbundle.php' => 1, | |
'epdisplaybundle.php' => 1, | |
'epasynceventdispatcherbundle.php' => 1, | |
'basebox' => 1, | |
'frisbee-demo.gif' => 1, | |
'plafile.yml' => 1, | |
'phpsql.php' => 1, | |
'oneline.php' => 1, | |
'phpa2o.php' => 1, | |
'cachesubscriber.php' => 1, | |
'elsassseeraiweresmenubundle.php' => 1, | |
'twiginflectionbundle.php' => 1, | |
'twigcachebundle.php' => 1, | |
'simplearraybundle.php' => 1, | |
'placeholditprovider.php' => 1, | |
'gravatarbundle.php' => 1, | |
'fakerserviceprovider.php' => 1, | |
'fakerbundle.php' => 1, | |
'embedlyserviceprovider.php' => 1, | |
'embedlybundle.php' => 1, | |
'emagistermemcachedbundle.php' => 1, | |
'tabular.php' => 1, | |
'composer.json.meow' => 1, | |
'elsassseeraiweresuserbundle.php' => 1, | |
'checkoutresult.php' => 1, | |
'webprofilerextrabundle.php' => 1, | |
'staff.php' => 1, | |
'suggestions.php' => 1, | |
'zipcodevalidator.php' => 1, | |
'pricevalidator.php' => 1, | |
'paymentresponse.php' => 1, | |
'omnikassa.php' => 1, | |
'.phpqa.yml' => 1, | |
'edgetexybundle.php' => 1, | |
'overseer.php' => 1, | |
'edgeanalyticsbundle.php' => 1, | |
'edge5appbackendbundle.php' => 1, | |
'stringtype.php' => 1, | |
'arraytype.php' => 1, | |
'tweets.php' => 1, | |
'streaming.php' => 1, | |
'psyduck.php' => 1, | |
'saved.php' => 1, | |
'friends.php' => 1, | |
'directmessage.php' => 1, | |
'fql.php' => 1, | |
'venue.php' => 1, | |
'organizer.php' => 1, | |
'fileoperations.php' => 1, | |
'accounts.php' => 1, | |
'generatedcodebar.php' => 1, | |
'config.rb.dst' => 1, | |
'phpspec.travis.yml' => 1, | |
'propel.yml' => 1, | |
'easytekdoctrinecacheinvalidatorbundle.php' => 1, | |
'eduardtrayanfaststoragebundle.php' => 1, | |
'hasherinterface.php' => 1, | |
'twigprofilerengine.php' => 1, | |
'cli-dom' => 1, | |
'elaoerrornotifierbundle.php' => 1, | |
'elaothemetwitterbootstrap3bundle.php' => 1, | |
'elaoparameterizerbundle.php' => 1, | |
'elaojsonhttpformbundle.php' => 1, | |
'elaoformtranslationbundle.php' => 1, | |
'elaoformbundle.php' => 1, | |
'elaobrowserdetectorbundle.php' => 1, | |
'elaoadminbundle.php' => 1, | |
'elaocmsslotbundle.php' => 1, | |
'notes tbd' => 1, | |
'cli-xed' => 1, | |
'hls-downloader-cli' => 1, | |
'xpath-cli' => 1, | |
'hashertrait.php' => 1, | |
'ua.list' => 1, | |
'cli-cache' => 1, | |
'cache-cli' => 1, | |
'phpunit_1.xml' => 1, | |
'.gitignore_1' => 1, | |
'uricomponentinterface.php' => 1, | |
'tld.php' => 1, | |
'schemes.php' => 1, | |
'httpscheme.php' => 1, | |
'constantstrait.php' => 1, | |
'standarddeshasher.php' => 1, | |
'saltinterface.php' => 1, | |
'hashes.php' => 1, | |
'aqlexpression.php' => 1, | |
'acehelper.php' => 1, | |
'textinterface.php' => 1, | |
'phplinqprovider.sln' => 1, | |
'croncronbundle.php' => 1, | |
'installhandler.php' => 1, | |
'templates' => 1, | |
'courtyardforumbundle.php' => 1, | |
'inkstandplugintestbundle.php' => 1, | |
'basic-example.php' => 1, | |
'twigprofiledengine.php' => 1, | |
'corespheretwigprofilerbundle.php' => 1, | |
'controllerserviceprovider.php' => 1, | |
'controllerinspector.php' => 1, | |
'randlib.c.patch' => 1, | |
'phplinqprovider.v12.suo' => 1, | |
'wordpress.sh' => 1, | |
'crossknowledgedevicedetectbundle.php' => 1, | |
'speed-up-essentials-plugin.php' => 1, | |
'screenshot_categories.jpg' => 1, | |
'screenshot_access_rights.jpg' => 1, | |
'screenshot_categories_view.jpg' => 1, | |
'screenshot_backend_view.jpg' => 1, | |
'tiersarchivagemap.php' => 1, | |
'tiersarchivage.php' => 1, | |
'ecoffrefort.php' => 1, | |
'consoneoecoffrefortbundle.php' => 1, | |
'coffremap.php' => 1, | |
'coffre.php' => 1, | |
'connectsbtranslationbundle.php' => 1, | |
'crossknowledgedatatablebundle.php' => 1, | |
'crowdreactivecloudresizerbundle.php' => 1, | |
'connecthollandpiccolocontentbundle.php' => 1, | |
'audittrailmodule.php' => 1, | |
'd2personmodule.php' => 1, | |
'd2messagesmodule.php' => 1, | |
'd2mailermodule.php' => 1, | |
'd2fixrmodule.php' => 1, | |
'd2finvmodule.php' => 1, | |
'd2filesmodule.php' => 1, | |
'd2companymodule.php' => 1, | |
'd2calendarmodule.php' => 1, | |
'd1statusmodule.php' => 1, | |
'd1filesmodule.php' => 1, | |
'translation_app.php' => 1, | |
'd1companymodule.php' => 1, | |
'personal_finance_level_data.sql' => 1, | |
'spell' => 1, | |
'd1systemmodule.php' => 1, | |
'edifactdatamodule.php' => 1, | |
'dbdiff' => 1, | |
'flitch' => 1, | |
'dabsquaredmssqlbundle.php' => 1, | |
'dabsquaredpushnotificationsbundle.php' => 1, | |
'cydopresenterbundle.php' => 1, | |
'cuteninjapersonabundle.php' => 1, | |
'cuteninjaparabolabundle.php' => 1, | |
'cuteninjamemoriabundle.php' => 1, | |
'cscorebundle.php' => 1, | |
'xmltemp.xml' => 1, | |
'xmlgenerator.php' => 1, | |
'tulipapibundle.php' => 1, | |
'connecthollandpiccolocmsbundle.php' => 1, | |
'finvmodule.php' => 1, | |
'lengthexception.php' => 1, | |
'handleresponseinterface.php' => 1, | |
'formatinterface.php' => 1, | |
'fieldhandlerusagetrait.php' => 1, | |
'fieldhandlerinterface.php' => 1, | |
'constraintinterface.php' => 1, | |
'unexpectedvalueexception.php' => 1, | |
'underflowexception.php' => 1, | |
'rangeexception.php' => 1, | |
'overflowexception.php' => 1, | |
'outofrangeexception.php' => 1, | |
'outofboundsexception.php' => 1, | |
'logicexception.php' => 1, | |
'exceptioninterface.php' => 1, | |
'redirectinterface.php' => 1, | |
'exceptionhandlerinterface.php' => 1, | |
'errorthrownasexception.php' => 1, | |
'domainexception.php' => 1, | |
'badfunctioncallexception.php' => 1, | |
'usereventinterface.php' => 1, | |
'updateeventinterface.php' => 1, | |
'triggerinterface.php' => 1, | |
'systemeventinterface.php' => 1, | |
'readeventinterface.php' => 1, | |
'initialiseeventinterface.php' => 1, | |
'displayeventinterface.php' => 1, | |
'deleteeventinterface.php' => 1, | |
'createeventinterface.php' => 1, | |
'validateresponseinterface.php' => 1, | |
'uploadinterface.php' => 1, | |
'urlhistorybehavior.php' => 1, | |
'paginationinterface.php' => 1, | |
'urlhistory.php' => 1, | |
'userdatainterface.php' => 1, | |
'messagesinterface.php' => 1, | |
'flashmessageinterface.php' => 1, | |
'encryptinterface.php' => 1, | |
'cookieinterface.php' => 1, | |
'authorisationinterface.php' => 1, | |
'authenticationinterface.php' => 1, | |
'activityinterface.php' => 1, | |
'namespaceinterface.php' => 1, | |
'classloaderinterface.php' => 1, | |
'parseinterface.php' => 1, | |
'updatemodelinterface.php' => 1, | |
'factorybatchinterface.php' => 1, | |
'updatecontrollerinterface.php' => 1, | |
'readmodelinterface.php' => 1, | |
'readcontrollerinterface.php' => 1, | |
'queryusagetrait.php' => 1, | |
'modelregistryinterface.php' => 1, | |
'initialisecontrollerinterface.php' => 1, | |
'deletemodelinterface.php' => 1, | |
'deletecontrollerinterface.php' => 1, | |
'createmodelinterface.php' => 1, | |
'createcontrollerinterface.php' => 1, | |
'translateinterface.php' => 1, | |
'captureuntranslatedstringinterface.php' => 1, | |
'scheduleinterface.php' => 1, | |
'd2tasksmodule.php' => 1, | |
'personmodule.php' => 1, | |
'aceasset.php' => 1, | |
'datavalues.php' => 1, | |
'decibel.config.php' => 1, | |
'mustache.php' => 1, | |
'preview.jpg' => 1, | |
'ajaxpageloading.js' => 1, | |
'trovitapi.php' => 1, | |
'paris-generator' => 1, | |
'shellstartup.php' => 1, | |
'davidmikesimonbotticellibundle.php' => 1, | |
'davidforestimgbundle.php' => 1, | |
'davidbadurafixturesbundle.php' => 1, | |
'davidbadurafakerbundle.php' => 1, | |
'cf.php' => 1, | |
'datavalues.mw.php' => 1, | |
'decibel.manifest.xml' => 1, | |
'datavalues.i18n.php' => 1, | |
'dolldapbundle.php' => 1, | |
'darvinwebmaillinkerbundle.php' => 1, | |
'darvinutilsbundle.php' => 1, | |
'darvinuserbundle.php' => 1, | |
'darvinsitemapbundle.php' => 1, | |
'darvinimagebundle.php' => 1, | |
'darvincontentbundle.php' => 1, | |
'darvinbotdetectorbundle.php' => 1, | |
'nntmux' => 1, | |
'nnbase.php' => 1, | |
'two.php' => 1, | |
'three.php' => 1, | |
'decibel.info.php' => 1, | |
'decibel.php' => 1, | |
'wallposterbundle.php' => 1, | |
'derstoffelcarreraloggerbundle.php' => 1, | |
'ace.php' => 1, | |
'aureolmanagerbundle.php' => 1, | |
'd4mebaybundle.php' => 1, | |
'permissiontrait.php' => 1, | |
'laravelpermissionrolesserviceprovider.php' => 1, | |
'cli-install.php' => 1, | |
'deskpro-api.php' => 1, | |
'dprepobundle.php' => 1, | |
'exportation_documentation' => 1, | |
'license.jscookmenu' => 1, | |
'readme.php-saml' => 1, | |
'license.php-saml' => 1, | |
'apiauth.php' => 1, | |
'decibel.tables.xml' => 1, | |
'recordreplacer.php' => 1, | |
'kmjzillowbundle.php' => 1, | |
'kmjupdatebundle.php' => 1, | |
'kmjtoolkitbundle.php' => 1, | |
'kmjsyncbundle.php' => 1, | |
'kmjpaypalbridgebundle.php' => 1, | |
'kmjcronbundle.php' => 1, | |
'kmjchanneladvisorbundle.php' => 1, | |
'kmjawsbundle.php' => 1, | |
'calendarlinks.php' => 1, | |
'defaultvalueakeneoinlineeditbundle.php' => 1, | |
'deepomatic.php' => 1, | |
'decibeluninstaller.php' => 1, | |
'one.php' => 1, | |
'recaptchabundle.php' => 1, | |
'tlbexcel.php' => 1, | |
'srceen_shot_list_settings.png' => 1, | |
'formatnum.i18n.magic.php' => 1, | |
'formatnum.hooks.php' => 1, | |
'dzunkeslackbundle.php' => 1, | |
'dzunkefeatureflagsbundle.php' => 1, | |
'genconfig.php' => 1, | |
'iocapp' => 1, | |
'test-steam-api-key.php_sample' => 1, | |
'treeassets.php' => 1, | |
'tcpdi_parser.php' => 1, | |
'tcpdi.php' => 1, | |
'selenium-server.jar' => 1, | |
'dhorchlersympatchbundle.php' => 1, | |
'srceen_shot_edit_multiplechoice_setting.png' => 1, | |
'formatnum.php' => 1, | |
'srceen_shot_edit_integer_setting.png' => 1, | |
'srceen_shot_edit_date_setting.png' => 1, | |
'dhorchlerconfigbundle.php' => 1, | |
'schedulerhelperdate.php' => 1, | |
'schedulerhelperconnector.php' => 1, | |
'schedulerhelper.php' => 1, | |
'recurringtype.php' => 1, | |
'dhtmlxasset.php' => 1, | |
'dgoptimizedaccessdecisionmanagerbundle.php' => 1, | |
'jqplotgraphwidget.php' => 1, | |
'wikimodule.php' => 1, | |
'trucksmodule.php' => 1, | |
'tlbexcelview.php' => 1, | |
'formatnum.i18n.php' => 1, | |
'piwik.hooks.php' => 1, | |
'alice' => 1, | |
'mongomodel.php' => 1, | |
'userbitcoinaddresses.settings.php' => 1, | |
'userbitcoinaddresses.php' => 1, | |
'userbitcoinaddresses.i18n.aliases.php' => 1, | |
'wsdltoclass' => 1, | |
'travis-after.sh' => 1, | |
'example_cache.php' => 1, | |
'quandl.php' => 1, | |
'rust.php' => 1, | |
'reset-symlinks.sh' => 1, | |
'gekko-shortener.sublime-project' => 1, | |
'.example.env.php' => 1, | |
'elements.sublime-workspace' => 1, | |
'mongodoc.php' => 1, | |
'localhostbrowser.php' => 1, | |
'mongodbconnection.php' => 1, | |
'runttest.php' => 1, | |
'php.js' => 1, | |
'lowmemoryclassloader.php' => 1, | |
'releaseinfo.php' => 1, | |
'phpstorm.meta.php' => 1, | |
'gravatario.php' => 1, | |
'daminoushkasimplejqueryvalidationbundle.php' => 1, | |
'damdamdbootstrapbundle.php' => 1, | |
'daemonsimplifybundle.php' => 1, | |
'daemongallerybundle.php' => 1, | |
'daemonfilestoragebundle.php' => 1, | |
'filesfinderbundle.php' => 1, | |
'module-google-optimizer.csv' => 1, | |
'module-google-adwords.csv' => 1, | |
'repositorybase.php' => 1, | |
'doxygenlayout.xml' => 1, | |
'ampisoftdeploybundle.php' => 1, | |
'autogettersettertrait.php' => 1, | |
'arrayfactorytrait.php' => 1, | |
'annotationreaderfetcher.php' => 1, | |
'annotatedgettersettertrait.php' => 1, | |
'abstractgettersettertrait.php' => 1, | |
'acmodeltraitsbundle.php' => 1, | |
'acloginconveniencebundle.php' => 1, | |
'testwatch' => 1, | |
'containerawareroleauthorizer.php' => 1, | |
'ackalinkabundle.php' => 1, | |
'doxygen-filter.php' => 1, | |
'acfiendishbundle.php' => 1, | |
'fixturesloader.php' => 1, | |
'serviceresponse.php' => 1, | |
'acwebservicesbundle.php' => 1, | |
'actranscodingbundle.php' => 1, | |
'transcoder.php' => 1, | |
'preset.php' => 1, | |
'mimemap.php' => 1, | |
'filehandlerdefinition.php' => 1, | |
'mutate.conf.php' => 1, | |
'mediainfo.php' => 1, | |
'acmediainfobundle.php' => 1, | |
'amenophisprincebundle.php' => 1, | |
'amenophissocialbundle.php' => 1, | |
'ampuserbundle.php' => 1, | |
'gatherer.php' => 1, | |
'wr-dist.ini' => 1, | |
'typo.php' => 1, | |
'cosenary' => 1, | |
'basketinterface.php' => 1, | |
'basketcomponent.php' => 1, | |
'imagesbehavior.php' => 1, | |
'crudactionupdate.php' => 1, | |
'crudactiondelete.php' => 1, | |
'crudactioncreate.php' => 1, | |
'crudactionbase.php' => 1, | |
'checkowner.php' => 1, | |
'catalogadmin.php' => 1, | |
'cryptokey' => 1, | |
'typorules.php' => 1, | |
'rutils.php' => 1, | |
'gathererhelper.php' => 1, | |
'numeral.php' => 1, | |
'dt.php' => 1, | |
'.prjide' => 1, | |
'phpunit_init.php' => 1, | |
'dbmsmodule.php' => 1, | |
'bookmarkmodule.php' => 1, | |
'accessmodule.php' => 1, | |
'selftest.php' => 1, | |
'rar.php' => 1, | |
'fixturesfromdbgenerator.php' => 1, | |
'amstaffixextjsrestcommonbundle.php' => 1, | |
'extjsmodelssaver.php' => 1, | |
'extjsgetallrequestcreator.php' => 1, | |
'wr-test.ini' => 1, | |
'diagrama.png' => 1, | |
'nf.php' => 1, | |
'pmg-cdn.php' => 1, | |
'app.functions.php' => 1, | |
'app.debugmode.php' => 1, | |
'instapush.php' => 1, | |
'votemodule.php' => 1, | |
'akhannstaticpagebundle.php' => 1, | |
'redmine-reminder' => 1, | |
'closuretablebehavior.php' => 1, | |
'hypemailchimpbundle.php' => 1, | |
'hypedynamicdatatablesbundle.php' => 1, | |
'cnertamailingbundle.php' => 1, | |
'cnertabreadcrumbbundle.php' => 1, | |
'cnertabehindaproxybundle.php' => 1, | |
'google-tag-manager.php' => 1, | |
'grumpy-cat-meme-hmmm.jpg' => 1, | |
'fu-autop.php' => 1, | |
'yuzupipelinebundle.php' => 1, | |
'yuzuarcgisbundle.php' => 1, | |
'symclass.php' => 1, | |
'editor-style.css' => 1, | |
'aequivocarestbundle.php' => 1, | |
'thumbnailimage.php' => 1, | |
'aws.global.php.dist' => 1, | |
'signout.php' => 1, | |
'ffaboard.sql' => 1, | |
'createtopic.php' => 1, | |
'shopifybundle.php' => 1, | |
'run_phantomjs.sh' => 1, | |
'app.init.php' => 1, | |
'esngalaxyauthserviceprovider.php' => 1, | |
'diagram.uml' => 1, | |
'mar.php' => 1, | |
'acsacspanelwordpressbundle.php' => 1, | |
'acsacspanelusersbundle.php' => 1, | |
'release.key' => 1, | |
'acsacspanelsettingsbundle.php' => 1, | |
'acsacspanelbundle.php' => 1, | |
'acinst3bundle.php' => 1, | |
'alsatianformbundle.php' => 1, | |
'alphalabspaginationbundle.php' => 1, | |
'alphalabsfoundationbundle.php' => 1, | |
'alphalabsfilterenginebundle.php' => 1, | |
'extendedrights.php' => 1, | |
'testcases.php' => 1, | |
'style' => 1, | |
'theme-sample.php' => 1, | |
'nginxpushstreambundle.php' => 1, | |
'locationbundle.php' => 1, | |
'brixtemplatebundle.php' => 1, | |
'brixcorebundle.php' => 1, | |
'brixadminbundle.php' => 1, | |
'symbolclass.php' => 1, | |
'qevix.php' => 1, | |
'laravel-5.png' => 1, | |
'initdatabase.php' => 1, | |
'timeagoformatter.php' => 1, | |
'alexdpysimpleaclbundle.php' => 1, | |
'alexdpyaclbundle.php' => 1, | |
'phpaudit' => 1, | |
'batch.cmd' => 1, | |
'nf_define.php' => 1, | |
'field_collection.theme.css' => 1, | |
'eventreposity.php' => 1, | |
'guildrank.php' => 1, | |
'guildproperties.php' => 1, | |
'guildmembership.php' => 1, | |
'playerproperties.php' => 1, | |
'playeronline.php' => 1, | |
'accountregistration.php' => 1, | |
'accountproperties.php' => 1, | |
'.stepuprc' => 1, | |
'identity.php' => 1, | |
'anunapress.php' => 1, | |
'speedtest.php' => 1, | |
'gremlin.php' => 1, | |
'basiccron.php' => 1, | |
'creature.php' => 1, | |
'strogeinterface.php' => 1, | |
'stroge.php' => 1, | |
'encryptedstroge.php' => 1, | |
'drivernotfoundexception.php' => 1, | |
'cachesessionhandler.php' => 1, | |
'typehint.php' => 1, | |
'securitykeygenerator.php' => 1, | |
'keygeneratorinterface.php' => 1, | |
'csrftokeninterface.php' => 1, | |
'accesssecurity.php' => 1, | |
'terminateinterface.php' => 1, | |
'routematcherinterface.php' => 1, | |
'newsitem.php' => 1, | |
'gender.php' => 1, | |
'routematchexception.php' => 1, | |
'appventusdatamigrationbundle.php' => 1, | |
'taigabundle.php' => 1, | |
'avpixelartbundle.php' => 1, | |
'avphpdocfillbundle.php' => 1, | |
'avmultidomainbundle.php' => 1, | |
'orderevents.php' => 1, | |
'appventusmangopayevents.php' => 1, | |
'appventusmangopaybundle.php' => 1, | |
'pre-commit.add.sample' => 1, | |
'appventus.pre-commit.tester' => 1, | |
'appventusfacebookgraphbundle.php' => 1, | |
'dybapibundle.php.fix-case' => 1, | |
'dybapibundle.php' => 1, | |
'bankconnector.php' => 1, | |
'spell.php' => 1, | |
'avbootstrapalmanachbundle.php' => 1, | |
'aviarybundle.php' => 1, | |
'avtwitterposterbundle.php' => 1, | |
'avawesomespoolmailerbundle.php' => 1, | |
'avossusbundle.php' => 1, | |
'avlistbundle.php' => 1, | |
'avbitlybundle.php' => 1, | |
'avawesomeshortcutsbundle.php' => 1, | |
'avajaxbundle.php' => 1, | |
'avautoformfillbundle.php' => 1, | |
'avasseticinjectorbundle.php' => 1, | |
'world.php' => 1, | |
'vocation.php' => 1, | |
'routematcher.php' => 1, | |
'routecollector.php' => 1, | |
'nf_functions.php' => 1, | |
'bigmath.php' => 1, | |
'prediscachedriver.php' => 1, | |
'memcachedriver.php' => 1, | |
'flushableinterface.php' => 1, | |
'filecachedriver.php' => 1, | |
'drivernotflushableexception.php' => 1, | |
'driveradapterinterface.php' => 1, | |
'driveradapter.php' => 1, | |
'configrepository.php' => 1, | |
'arraycachedriver.php' => 1, | |
'apccachedriver.php' => 1, | |
'numeralsystem.php' => 1, | |
'bignumber.php' => 1, | |
'threadpool.php' => 1, | |
'rediscachedriver.php' => 1, | |
'thread.php' => 1, | |
'simplethread.php' => 1, | |
'socketstream.php' => 1, | |
'socketreal.php' => 1, | |
'asocket.php' => 1, | |
'phpgen.php' => 1, | |
'iphpgenerable.php' => 1, | |
'customcode.php' => 1, | |
'eventbuffer.php' => 1, | |
'eventbasic.php' => 1, | |
'eventbase.php' => 1, | |
'hookpiwikanalytics.php' => 1, | |
'nfc.php' => 1, | |
'predisclientexception.php' => 1, | |
'xcachedriver.php' => 1, | |
'modeldispatcher.php' => 1, | |
'swiftattachment.php' => 1, | |
'middlewareexception.php' => 1, | |
'filtermatchexception.php' => 1, | |
'filterbag.php' => 1, | |
'controllerdispatcherinterface.php' => 1, | |
'ascollector.php' => 1, | |
'actiondispatcherinterface.php' => 1, | |
'actiondispatcher.php' => 1, | |
'accessdispatcherinterface.php' => 1, | |
'accessdispatcher.php' => 1, | |
'accessbag.php' => 1, | |
'swiftmailerdriver.php' => 1, | |
'swiftattachmentinterface.php' => 1, | |
'phpmailerdriver.php' => 1, | |
'zenddatacache.php' => 1, | |
'phpmailerattachmentinterface.php' => 1, | |
'phpmailerattachment.php' => 1, | |
'attachmentinterface.php' => 1, | |
'serverhttpheaders.php' => 1, | |
'routenotfoundexception.php' => 1, | |
'requestheaders.php' => 1, | |
'redirecturlemptyexception.php' => 1, | |
'httpresponseexception.php' => 1, | |
'filenotuploadedexception.php' => 1, | |
'eventnotfoundexception.php' => 1, | |
'eventnameexception.php' => 1, | |
'eventlistenerexception.php' => 1, | |
'eventcollector.php' => 1, | |
'field_collections-1316162-227.patch' => 1, | |
'field_collection.test' => 1, | |
'appscoassertionvoterbundle.php' => 1, | |
'multiselectlistbox.php' => 1, | |
'buttontableexport.php' => 1, | |
'resourcemanagerinterface.php' => 1, | |
'filesystemresourcemanager.php' => 1, | |
'amazons3resourcemanager.php' => 1, | |
'pjaxfilter.php' => 1, | |
'inboundmessage.php' => 1, | |
'inboundcallbackevent.php' => 1, | |
'inboundcallbackaction.php' => 1, | |
'deliveryreceipt.php' => 1, | |
'deliverycallbackevent.php' => 1, | |
'deliverycallbackaction.php' => 1, | |
'multiselectlistboxasset.php' => 1, | |
'multiselect.php' => 1, | |
'tableexportaction.php' => 1, | |
'togglecolumnasset.php' => 1, | |
'toggleaction.php' => 1, | |
'place.php' => 1, | |
'timezonepicker.php' => 1, | |
'statepicker.php' => 1, | |
'phoneinput.php' => 1, | |
'numberinput.php' => 1, | |
'languagepicker.php' => 1, | |
'googlefontpicker.php' => 1, | |
'fontsizepicker.php' => 1, | |
'fontpicker.php' => 1, | |
'currencypicker.php' => 1, | |
'buttontableexportasset.php' => 1, | |
'translateablebehavior.php' => 1, | |
'colorpicker.php' => 1, | |
'selenium-server-standalone-2.47.1.jar' => 1, | |
'missing-builtins.php' => 1, | |
'inimltest.php' => 1, | |
'iniml.php' => 1, | |
'pdo2test.php' => 1, | |
'pdo2.php' => 1, | |
'archiemltest.php' => 1, | |
'archieml.php' => 1, | |
'init_framework.php' => 1, | |
'init_config_javascript.php' => 1, | |
'licence_cecill-b_v1-fr' => 1, | |
'licence_cecill-b_v1-en' => 1, | |
'towel.php' => 1, | |
'update.ps1' => 1, | |
'basetransliteratorhelper.php' => 1, | |
'fortytwo-2fa.php' => 1, | |
'.rsyncignore' => 1, | |
'tagging.xml' => 1, | |
'idna.php' => 1, | |
'additional.php' => 1, | |
'a3mgrussianpostbundle.php' => 1, | |
'your.log' => 1, | |
'tito.php' => 1, | |
'1.php' => 1, | |
'photoitem.php' => 1, | |
'photocollection.php' => 1, | |
'carbon-pagination.php' => 1, | |
'transliteratorhelper.php' => 1, | |
'countrypicker.php' => 1, | |
'bootstrapformhelperstrait.php' => 1, | |
'tagtest.php' => 1, | |
'helper-functions.php' => 1, | |
'twentystepswemonitbundle.php' => 1, | |
'twentystepsplacetelbundle.php' => 1, | |
'twentystepscommonsensurebundle.php' => 1, | |
'ensureexception.php' => 1, | |
'ensure.php' => 1, | |
'twentystepscollmexbundle.php' => 1, | |
'twentystepsautotablesbundle.php' => 1, | |
'composer-autoload.php' => 1, | |
'contao-sass-watch-settings.png' => 1, | |
'oneupflysystembundle.php' => 1, | |
'oneupaclbundle.php' => 1, | |
'composer-bootstrap.php' => 1, | |
'customizer.php' => 1, | |
'teslaclientbundle.php' => 1, | |
'intaropostgressearchbundle.php' => 1, | |
'intaronativequerybuilderbundle.php' => 1, | |
'intaromemcachedtagsbundle.php' => 1, | |
'slackhookserviceprovider.php' => 1, | |
'htmltotext.php' => 1, | |
'thecsv.php' => 1, | |
'wp_mock.php' => 1, | |
'swiftstream.php' => 1, | |
'hive' => 1, | |
'meuptagcommanderbundle.php' => 1, | |
'meupgeolocationbundle.php' => 1, | |
'osirisdevshortcutsbundle.php' => 1, | |
'application.ini-dist' => 1, | |
'teslaapikeysecuritybundle.php' => 1, | |
'assembler.php' => 1, | |
'bootstrapformhelpersasset.php' => 1, | |
'efeeditemrss2.php' => 1, | |
's3command.php' => 1, | |
's3assetmanager.php' => 1, | |
'cdnassetmanager.php' => 1, | |
'assetmanagertrait.php' => 1, | |
'iresourcemanager.php' => 1, | |
'efsresourcemanager.php' => 1, | |
'eamazons3resourcemanager.php' => 1, | |
'escriptboost.php' => 1, | |
'eclientscriptboost.php' => 1, | |
'eassetmanagerboost.php' => 1, | |
'egeoip.php' => 1, | |
'efeedtag.php' => 1, | |
'efeeditemrss1.php' => 1, | |
'assemblerinterface.php' => 1, | |
'efeeditematom.php' => 1, | |
'efeeditemabstract.php' => 1, | |
'efeed.php' => 1, | |
'.editoconfig' => 1, | |
'zweigrammjqueryuibundle.php' => 1, | |
'zweigrammjquerybundle.php' => 1, | |
'notificationserviceinterface.php' => 1, | |
'notificationreceiverinterface.php' => 1, | |
'abstractnotificationservice.php' => 1, | |
'teslaesyncbundle.php' => 1, | |
'teslawsbundle.php' => 1, | |
'tesladtobundle.php' => 1, | |
'metadatareader.php' => 1, | |
'config-defaults.php' => 1, | |
'fdevsblockbundle.php' => 1, | |
'field_collection.pages.inc' => 1, | |
'picture.php' => 1, | |
'asoccompassomatorbundle.php' => 1, | |
'asocasseticangularjsbundle.php' => 1, | |
'evercookiewidget.php' => 1, | |
'artackmxapi.php' => 1, | |
'artackmxapibundle.php' => 1, | |
'update_package.sh' => 1, | |
'build.bootstrap.xml' => 1, | |
'phpalgo' => 1, | |
'googleplay-api.php' => 1, | |
'krsmailbundle.php' => 1, | |
'license.text' => 1, | |
'servicecontainerbuilder.php' => 1, | |
'authenticationfactory.php' => 1, | |
'basetype.php' => 1, | |
'abmundidatabasecommandsbundle.php' => 1, | |
'projectinventorybundle.php' => 1, | |
'a5syspdfbundle.php' => 1, | |
'overlaybundle.php' => 1, | |
'loggedinredirectionbundle.php' => 1, | |
'easyadminpopupbundle.php' => 1, | |
'doctrinetraitbundle.php' => 1, | |
'soaptest.php' => 1, | |
'test-s3.php' => 1, | |
'test-http.php' => 1, | |
'ergo.php' => 1, | |
'c975lxliffbundle.php' => 1, | |
'phpbb_session_handler.php' => 1, | |
'.gitgnore' => 1, | |
'spsrapi.php' => 1, | |
'phpbbuservalidation.php' => 1, | |
'apyjsformvalidationbundle.php' => 1, | |
'field_collection.module' => 1, | |
'field_collection.migrate.inc' => 1, | |
'field_collection.install.orig' => 1, | |
'field_collection.install' => 1, | |
'field_collection.info.inc' => 1, | |
'field_collection.info' => 1, | |
'field_collection.api.php' => 1, | |
'field_collection.admin.inc' => 1, | |
'field-collection-item.tpl.php' => 1, | |
'accordpostmarkswiftmailerbundle.php' => 1, | |
'radius' => 1, | |
'jsfvevents.php' => 1, | |
'apybreadcrumbtrailbundle.php' => 1, | |
'spsrexception.php' => 1, | |
'triviabot.sql' => 1, | |
'questions.sql.zip' => 1, | |
'andikickboxbundle.php' => 1, | |
'websecurity.php' => 1, | |
'testindex.php' => 1, | |
'request_logging.php' => 1, | |
'ajax-get.php' => 1, | |
'about.php' => 1, | |
'wpcom-legacy-redirector.php' => 1, | |
'page-template-finder.php' => 1, | |
'ms-custom-signup.php' => 1, | |
'xml_synopsis' => 1, | |
'tbs_plugin_opentbs.html' => 1, | |
'phpbbclass.php' => 1, | |
'phpbb.php' => 1, | |
'fdevsbowerphpbundle.php' => 1, | |
'metabuilder.php' => 1, | |
'tagmanagerinterface.php' => 1, | |
'taginterface.php' => 1, | |
'fdevsstaticpagebundle.php' => 1, | |
'fdevssitemapbundle.php' => 1, | |
'fdevsroutingbundle.php' => 1, | |
'fdevspagebundle.php' => 1, | |
'abstractmigration.php' => 1, | |
'fdevsmigrationbundle.php' => 1, | |
'metaregistry.php' => 1, | |
'metainterface.php' => 1, | |
'metafactory.php' => 1, | |
'metabuilderinterface.php' => 1, | |
'fdevsmenuevents.php' => 1, | |
'fdevsfilebundle.php' => 1, | |
'fdevsmenubundle.php' => 1, | |
'translatorpriority.php' => 1, | |
'localetrait.php' => 1, | |
'localetextinterface.php' => 1, | |
'localeinterface.php' => 1, | |
'fdevsgeobundle.php' => 1, | |
'fdevselfinderbundle.php' => 1, | |
'fdevscontactusbundle.php' => 1, | |
'fdevscontactlistbundle.php' => 1, | |
'contactinterface.php' => 1, | |
'contactfactory.php' => 1, | |
'connectinterface.php' => 1, | |
'fdevscatalogbundle.php' => 1, | |
'fdevstagbundle.php' => 1, | |
'fdevslocale.php' => 1, | |
'phpbbwebuser.php' => 1, | |
'emailbundle.php' => 1, | |
'assistbundle.php' => 1, | |
'.samurai' => 1, | |
'sevenmanagerbundle.php' => 1, | |
'gradle.properties' => 1, | |
'shswitchview.iml' => 1, | |
'typo3-probe.php' => 1, | |
'nanawebjapaneseholidaybundle.php' => 1, | |
'nanawebjapaneseformbundle.php' => 1, | |
'chbox.php' => 1, | |
'chbox.js' => 1, | |
'ocf.php' => 1, | |
'emailreader.php' => 1, | |
'withdrawform.php' => 1, | |
'fdevslocalebundle.php' => 1, | |
'arthemgraphqlbundle.php' => 1, | |
'following-diagram.png' => 1, | |
'publishablereadinterface.php' => 1, | |
'publishableinterface.php' => 1, | |
'publishworkflow.php' => 1, | |
'publishtimereadinterface.php' => 1, | |
'publishtimeinterface.php' => 1, | |
'publishstartreadinterface.php' => 1, | |
'publishstartinterface.php' => 1, | |
'publishreadinterface.php' => 1, | |
'publishinterface.php' => 1, | |
'publishendreadinterface.php' => 1, | |
'publishendinterface.php' => 1, | |
'appartincorebundle.php' => 1, | |
'bwccomponentfiribundle.php' => 1, | |
'module-gift-message.csv' => 1, | |
'test-update' => 1, | |
'besimplememcachedbundle.php' => 1, | |
'besimpledoctrinetypesbundle.php' => 1, | |
'baun' => 1, | |
'auto-install.php' => 1, | |
'symfony2locbundle.php' => 1, | |
'filestorage.php' => 1, | |
'server_start.sh' => 1, | |
'twr' => 1, | |
'triggermanager.php' => 1, | |
'processstatushandler.php' => 1, | |
'innmindprovisionerbundle.php' => 1, | |
'decisionmanager.php' => 1, | |
'test-relation' => 1, | |
'soapmessage.php' => 1, | |
'test-insert' => 1, | |
'test-init' => 1, | |
'test-get' => 1, | |
'test-delete' => 1, | |
'bancklehelpdeskbundle.php' => 1, | |
'bancklecrmbundle.php' => 1, | |
'update_info' => 1, | |
'radikal.php' => 1, | |
'range.php' => 1, | |
'clockpicker.php' => 1, | |
'bob.php' => 1, | |
'browseassets.php' => 1, | |
'abstractsoapbuilder.php' => 1, | |
'soaprequestfilter.php' => 1, | |
'.apigen.neon' => 1, | |
'trakio.png' => 1, | |
'beelabsimplepagebundle.php' => 1, | |
'beelabrecaptcha2bundle.php' => 1, | |
'beelabphoneverificationbundle.php' => 1, | |
'beelabpaypalbundle.php' => 1, | |
'beelabmemoryrepositorybundle.php' => 1, | |
'beelablaptypebundle.php' => 1, | |
'becklynstaticrolesbundle.php' => 1, | |
'becklynradbundle.php' => 1, | |
'becklynpagetreebundle.php' => 1, | |
'becklynfacebookbundle.php' => 1, | |
'beatsbundle.php' => 1, | |
'sypexdumper.php' => 1, | |
'remote_url.png' => 1, | |
'soapresponsefilter.php' => 1, | |
'mixpanel.png' => 1, | |
'mailchimp.png' => 1, | |
'jira.png' => 1, | |
'hipchat.png' => 1, | |
'ui-test.php' => 1, | |
'highrise.png' => 1, | |
'constant_contact.png' => 1, | |
'campaignmonitor.png' => 1, | |
'soapserverbuilder.php' => 1, | |
'soapserver.php' => 1, | |
'wsdlhandler.php' => 1, | |
'wssecuritykey.php' => 1, | |
'wssecurityfilterclientserver.php' => 1, | |
'poem.ja' => 1, | |
'nmbtwigextensionsbundle.php' => 1, | |
'beelabtestbundle.php' => 1, | |
'phpdoc.cmd' => 1, | |
'harbourreleasebundle.module.xml' => 1, | |
'harbourmailerbundle.php' => 1, | |
'harbourmailerbundle.module.xml' => 1, | |
'harbourloggerbundle.php' => 1, | |
'harbourloggerbundle.module.xml' => 1, | |
'coralsitebundle.php' => 1, | |
'coralfilebundle.php' => 1, | |
'coralfilebundle.module.xml' => 1, | |
'coralcorebundle.php' => 1, | |
'coralcontentbundle.php' => 1, | |
'coralcontentbundle.module.xml' => 1, | |
'atipikhoawebsocketbundle.php' => 1, | |
'translator.class.php' => 1, | |
'harbourunsubscribebundle.module.xml' => 1, | |
'ashleydawsonsimplepaginationbundle.php' => 1, | |
'adperfilbundle.php' => 1, | |
'addependselectbundle.php' => 1, | |
'adboletabundle.php' => 1, | |
'wxrnewsbundle.php' => 1, | |
'wxrgeobundle.php' => 1, | |
'wxreventbundle.php' => 1, | |
'wxrdirectorybundle.php' => 1, | |
'wxrcontentbundle.php' => 1, | |
'wxrcommonbundle.php' => 1, | |
'wxrcategorybundle.php' => 1, | |
'options.yml' => 1, | |
'artbreadcrumbsbundle.php' => 1, | |
'harbourreleasebundle.php' => 1, | |
'harbourunsubscribebundle.php' => 1, | |
'nmbtinymcebundle.php' => 1, | |
'predict.php' => 1, | |
'iodocsgen' => 1, | |
'update_project_components_statuses.drush.inc' => 1, | |
'variables.sh' => 1, | |
'drupal-builder' => 1, | |
'highcosphinxbundle.php' => 1, | |
'nocsrf.php' => 1, | |
'bear.php' => 1, | |
'php-config.ini' => 1, | |
'cucumber.yml' => 1, | |
'filemoduletrait.php' => 1, | |
'filemodule.php' => 1, | |
'search.xml' => 1, | |
'phpbu.xml_example' => 1, | |
'phpspec.yml.hhvm.7' => 1, | |
'avtonomsemaphorebundle.php' => 1, | |
'avtonommediastorageclientbundle.php' => 1, | |
'avtonomcreolebundle.php' => 1, | |
'thekwastiwikibundle.php' => 1, | |
'formalin.uml' => 1, | |
'autobotposterbundle.php' => 1, | |
'test-sample-codes.sh' => 1, | |
'sample-code-php' => 1, | |
'genclass.sh' => 1, | |
'aitcmsbundle.php' => 1, | |
'aurejajobqueuebundle.php' => 1, | |
'rick.png' => 1, | |
'phpunit_bs.php' => 1, | |
'beelabtagbundle.php' => 1, | |
'beelabuserbundle.php' => 1, | |
'iqsms_json.php' => 1, | |
'symfony2appbundle.php' => 1, | |
'module-bundle.csv' => 1, | |
'module-bundle-import-export.csv' => 1, | |
'module-braintree.csv' => 1, | |
'module-backup.csv' => 1, | |
'module-backend.csv' => 1, | |
'module-authorizenet.csv' => 1, | |
'module-authorization.csv' => 1, | |
'module-advanced-pricing-import-export.csv' => 1, | |
'module-admin-notification.csv' => 1, | |
'ftp.class.php' => 1, | |
'assertions' => 1, | |
'env.ministryplatform' => 1, | |
'blackboxcodepandocontentbundle.php' => 1, | |
'module-captcha.csv' => 1, | |
'webpack.config.js' => 1, | |
'image_moo.php' => 1, | |
'license-grocery-crud' => 1, | |
'examples_database.sql.zip' => 1, | |
'woocommerce-facebook-remarketing.php' => 1, | |
'emails' => 1, | |
'emails.php' => 1, | |
'emails.json' => 1, | |
'design' => 1, | |
'bips' => 1, | |
'birkneralexxenforoauthbundle.php' => 1, | |
'sub-plugins.php' => 1, | |
'ikadockcfinderbundle.php' => 1, | |
'module-cache-invalidate.csv' => 1, | |
'module-catalog-import-export.csv' => 1, | |
'resultobject.php' => 1, | |
'module-cron.csv' => 1, | |
'module-fedex.csv' => 1, | |
'module-encryption-key.csv' => 1, | |
'module-email.csv' => 1, | |
'module-eav.csv' => 1, | |
'module-downloadable.csv' => 1, | |
'module-downloadable-import-export.csv' => 1, | |
'module-directory.csv' => 1, | |
'module-dhl.csv' => 1, | |
'module-developer.csv' => 1, | |
'module-customer.csv' => 1, | |
'module-customer-import-export.csv' => 1, | |
'module-currency-symbol.csv' => 1, | |
'module-cookie.csv' => 1, | |
'module-catalog-inventory.csv' => 1, | |
'module-contact.csv' => 1, | |
'module-configurable-product.csv' => 1, | |
'module-configurable-import-export.csv' => 1, | |
'module-config.csv' => 1, | |
'module-cms.csv' => 1, | |
'module-cms-url-rewrite.csv' => 1, | |
'module-checkout.csv' => 1, | |
'module-checkout-agreements.csv' => 1, | |
'module-catalog.csv' => 1, | |
'module-catalog-widget.csv' => 1, | |
'module-catalog-url-rewrite.csv' => 1, | |
'module-catalog-search.csv' => 1, | |
'module-catalog-rule.csv' => 1, | |
'cleaninstall' => 1, | |
'bigfishuserbundle.php' => 1, | |
'beelabuserpasswordbundle.php' => 1, | |
'stylista-blogger-navigation.php' => 1, | |
'mysql.address.sql' => 1, | |
'bootstrap.tests.php' => 1, | |
'antwebbundle.php' => 1, | |
'antuserbundle.php' => 1, | |
'antmediabundle.php' => 1, | |
'antadminbundle.php' => 1, | |
'white-album-external-header.php' => 1, | |
'wp-s3-must-use.php' => 1, | |
'wp-manual-cu.php' => 1, | |
'wp-cxense.php' => 1, | |
'wa-external-header-v2.php' => 1, | |
'stylista-menu-plugin.php' => 1, | |
'bloggernavigation.php' => 1, | |
'brapibundle.php' => 1, | |
'trapp' => 1, | |
'indexsearch' => 1, | |
'bonnier-admin' => 1, | |
'bencsigeobundle.php' => 1, | |
'pubkey.pem' => 1, | |
'example-quick-configure.json' => 1, | |
'bellashayepaypalbundle.php' => 1, | |
'betaup.jpg' => 1, | |
'modalbasset.php' => 1, | |
'modalb.php' => 1, | |
'libpath.php' => 1, | |
'behatbundle.php' => 1, | |
'bktrackerhubbundle.php' => 1, | |
'salesforcestrategy.php' => 1, | |
'brauthbundle.php' => 1, | |
'nestedmatcher.php' => 1, | |
'eavpersisterevents.php' => 1, | |
'bigfishroutingbundle.php' => 1, | |
'resolveresourceentities.php' => 1, | |
'bigfishresourcebundle.php' => 1, | |
'pagekitgridtypes.php' => 1, | |
'bigfishpagekitbundle.php' => 1, | |
'resolvemediaentities.php' => 1, | |
'mediatypes.php' => 1, | |
'bigfishmediabundle.php' => 1, | |
'resolvelanguageentities.php' => 1, | |
'bigfishlanguagebundle.php' => 1, | |
'bigfishgridbundle.php' => 1, | |
'resolveeaventities.php' => 1, | |
'eavevents.php' => 1, | |
'brtokenbundle.php' => 1, | |
'eavcategories.php' => 1, | |
'bigfisheavbundle.php' => 1, | |
'testrouting.php' => 1, | |
'resolvecoreentities.php' => 1, | |
'bigfishcorebundle.php' => 1, | |
'resolvecontextentities.php' => 1, | |
'bigfishcontextbundle.php' => 1, | |
'bigfishconfigurationbundle.php' => 1, | |
'brspineapplebundle.php' => 1, | |
'ebsco-widget.php' => 1, | |
'bgazeparsedownbundle.php' => 1, | |
'ocok' => 1, | |
'bruserapibundle.php' => 1, | |
'phpunit.example.conf' => 1, | |
'rtf.class.php' => 1, | |
'firi.php' => 1, | |
'movie.rb' => 1, | |
'taxgator.rb' => 1, | |
'stocktickerservlet.rb' => 1, | |
'scratchx' => 1, | |
'queue.rb~' => 1, | |
'queue.rb' => 1, | |
'qaerodiacorp.sav' => 1, | |
'product.rb' => 1, | |
'osstartscreen.py' => 1, | |
'num.rb' => 1, | |
'notakerpro.aia' => 1, | |
'mysqldumper1.24.4.zip' => 1, | |
'movielibrary.rb' => 1, | |
'middleware' => 1, | |
'ticker.rb~' => 1, | |
'middleware.rb' => 1, | |
'mapsly.zip' => 1, | |
'mapsly (3).zip' => 1, | |
'mapsly (2).zip' => 1, | |
'malaika.zip' => 1, | |
'listing.rb' => 1, | |
'f16shell.rb' => 1, | |
'f16mudtape.rb' => 1, | |
'f16mudcockpitservlet.rb' => 1, | |
'chesstize.zip' => 1, | |
'chesstize (2).zip' => 1, | |
'bingcherry.zip' => 1, | |
'ticker.rb' => 1, | |
'weakhash.rb' => 1, | |
'archervmexception.rb' => 1, | |
'american_imperialism2.ppt' => 1, | |
'compiler.py' => 1, | |
'collaborant-0.1.0.gem' => 1, | |
'codecip.py' => 1, | |
'cockpitguess.py' => 1, | |
'cargo.cmd' => 1, | |
'cargo.bat' => 1, | |
'cards.py' => 1, | |
'bucketwise-master.zip' => 1, | |
'autoexec.bat' => 1, | |
'arp.php' => 1, | |
'archersys-logo.png' => 1, | |
'arbylog.rb' => 1, | |
'alarmpy.py' => 1, | |
'wikipage.rb' => 1, | |
'ager.py' => 1, | |
'activate_docs_gen' => 1, | |
'activate_docs_gen.bat' => 1, | |
'acoserver_moodle.sql' => 1, | |
'acoserver_games.sql' => 1, | |
'acoserver_admin.sql' => 1, | |
'acoserver_acoserver.sql' => 1, | |
'acoserver_acoserver (2).sql' => 1, | |
'_.swp' => 1, | |
'_.swo' => 1, | |
'_.swn' => 1, | |
'zlibengine.rb' => 1, | |
'wikipage.rb~' => 1, | |
'bingcherry.bryapp' => 1, | |
'archervmcashewtimeserver.rb~' => 1, | |
'contacts.db' => 1, | |
'158671-owncloud_editdoc.zip' => 1, | |
'.git.cmd.swp' => 1, | |
'.buildinfo' => 1, | |
'.authorize.php.swp' => 1, | |
'.ticker.rb.swp' => 1, | |
'.aerodiaserver.rb.swp' => 1, | |
'.302.html.swp' => 1, | |
'-interactive' => 1, | |
'occ' => 1, | |
'indie.json' => 1, | |
'db_structure.xml' => 1, | |
'copying-agpl' => 1, | |
'160265-ocdashboard_v1.3.1.zip' => 1, | |
'tourlib.js' => 1, | |
'.index.php.swp' => 1, | |
'landing-page.css' => 1, | |
'jquery.hipchat.js' => 1, | |
'canvashoppe-css.css' => 1, | |
'bootstrap-tour.min.js' => 1, | |
'bootstrap-tour.min.css' => 1, | |
'bootstrap-tour.js' => 1, | |
'bootstrap-tour.css' => 1, | |
'bootstrap-tour-tutorial' => 1, | |
'pdfljs.js' => 1, | |
'copy of index.php' => 1, | |
'arcavias.php' => 1, | |
'apichange' => 1, | |
'arachniasfoundationbundle.php' => 1, | |
'.index.php.swo' => 1, | |
'.irb.cmd.swp' => 1, | |
'archervmcashewtimeserver.rb' => 1, | |
'aerodiaserver.rb~' => 1, | |
'archervmcashewlogger.rb~' => 1, | |
'archervmcashewlogger.rb' => 1, | |
'archervmcashewdelegator.rb' => 1, | |
'archersysosoptionsparser.rb~' => 1, | |
'archersysosoptionsparser.rb' => 1, | |
'archersysosdate.rb' => 1, | |
'archersysos.rb' => 1, | |
'archersysos.gemspec' => 1, | |
'archerscript' => 1, | |
'archerdbm.rb' => 1, | |
'archercgi' => 1, | |
'aerodiaserver' => 1, | |
'aerodiaserver.rb' => 1, | |
'.irb_history' => 1, | |
'aerodia2.scn' => 1, | |
'abstractimplementation.rb' => 1, | |
'abstractarrbyklass.rb' => 1, | |
'8_imperialism_by_the_united_states2.ppt' => 1, | |
'7imperialisminjapan2.ppt' => 1, | |
'302.html' => 1, | |
'.vimstarter.bat.swp' => 1, | |
'.taskmanager.py.swp' => 1, | |
'.login.php.swp' => 1, | |
'.login.php.swo' => 1, | |
'.login.php.swn' => 1, | |
'.irbrc~' => 1, | |
'.irbrc' => 1, | |
'conchtack_id.dat' => 1, | |
'contrib-update.cmd' => 1, | |
'webicqpro.class.php' => 1, | |
'tess.py' => 1, | |
'yo' => 1, | |
'wallpaper.php' => 1, | |
'virtphp.phar' => 1, | |
'vimstarter.bat' => 1, | |
'uru_rt.exe' => 1, | |
'uru.ps1.bak' => 1, | |
'uru.ps1' => 1, | |
'uru.bat.bak' => 1, | |
'uru.bat' => 1, | |
'urllib2.py' => 1, | |
'time.html' => 1, | |
'time.css' => 1, | |
'startup.png' => 1, | |
'hello-world.php' => 1, | |
'startscreen.py' => 1, | |
'startscreen.php' => 1, | |
'specs.4.8.gz' => 1, | |
'specs.4.8' => 1, | |
'sinatra-1.4.5.gem' => 1, | |
'setupgit.bat' => 1, | |
'setupgit.ba' => 1, | |
'setup-owncloud.php' => 1, | |
'setup-account.py' => 1, | |
'searchindex.js' => 1, | |
'sample' => 1, | |
'rustc.cmd' => 1, | |
'runestone' => 1, | |
'yo.cmd' => 1, | |
'test-gravatar.php' => 1, | |
'rockpaperscissors.py' => 1, | |
'validcommentaire.php' => 1, | |
'erdiko.php' => 1, | |
'defaultconfiguration.php' => 1, | |
'arrogancemailrelaybundle.php' => 1, | |
'apimethodinterface.php' => 1, | |
'migrator' => 1, | |
'anonymizer' => 1, | |
'reactioncompatible.php' => 1, | |
'reaction.php' => 1, | |
'actioncompatible.php' => 1, | |
'config.sample.yml' => 1, | |
'newstab.php' => 1, | |
'categorybreadcrumb.php' => 1, | |
'testlink.php' => 1, | |
'wp-bird.php' => 1, | |
'resizeimage.php' => 1, | |
'readlog.php' => 1, | |
'maintenance.html' => 1, | |
'indexok.php' => 1, | |
'indexmaintenance2.php' => 1, | |
'imagezoomzone.php' => 1, | |
'getphotosquare.php' => 1, | |
'getphotoredimensionnee.php' => 1, | |
'getphotohome.php' => 1, | |
'findorphans.php' => 1, | |
'copypersons.php' => 1, | |
'mcd archi-strasbourg.mwb' => 1, | |
'archi_v2.sql' => 1, | |
'run_f16.rb' => 1, | |
'riphone.php' => 1, | |
'contrib-update.cmd~' => 1, | |
'git.cmd~' => 1, | |
'latest_specs.4.8.gz' => 1, | |
'latest_specs.4.8' => 1, | |
'irb.cmd~' => 1, | |
'irb.cmd' => 1, | |
'iostarter.py' => 1, | |
'installer_apps.php' => 1, | |
'htdocs.gemspec~' => 1, | |
'htdocs.gemspec' => 1, | |
'histogram.py' => 1, | |
'grillo' => 1, | |
'gitstat.php' => 1, | |
'githubstats.phjp' => 1, | |
'git-lfs.exe' => 1, | |
'meter.js' => 1, | |
'genindex.html' => 1, | |
'game1.py' => 1, | |
'ftpindex.php' => 1, | |
'forum.php' => 1, | |
'f18mud.rb' => 1, | |
'evennia' => 1, | |
'etupgit.bat' => 1, | |
'drupal-7.34.zip' => 1, | |
'dictionary_of_words.db' => 1, | |
'dict.rb' => 1, | |
'desktop-w10.php' => 1, | |
'desktop-modo.php' => 1, | |
'decompiler.py' => 1, | |
'login.php~' => 1, | |
'moodle.sqk' => 1, | |
'radius.py' => 1, | |
'os-mobile.php' => 1, | |
'pyvenv.cfg' => 1, | |
'pygubu-asos.py' => 1, | |
'pyconsole.py' => 1, | |
'puttytel.exe' => 1, | |
'putty.exe' => 1, | |
'pscp.exe' => 1, | |
'profile_weldon.jpg' => 1, | |
'prerelease_specs.4.8.gz' => 1, | |
'prerelease_specs.4.8' => 1, | |
'pip-selfcheck.json' => 1, | |
'phpliteadmin_v1-9-5.zip' => 1, | |
'phpldapadmin-1.2.3.zip' => 1, | |
'os-desktop.php' => 1, | |
'moodle.sql' => 1, | |
'objects.inv' => 1, | |
'npm.cmd' => 1, | |
'npm' => 1, | |
'now.bat' => 1, | |
'notifications-gateway.php' => 1, | |
'nodevars.bat' => 1, | |
'nodejs-portable.bat' => 1, | |
'node_perfctr_provider.man' => 1, | |
'node_etw_provider.man' => 1, | |
'node.exe' => 1, | |
'news.py' => 1, | |
'mud_login.rb' => 1, | |
'movielibrary.rhtml' => 1, | |
'modelkeybase.php' => 1, | |
'retrieveresult.php' => 1, | |
'stg' => 1, | |
'barcode.php' => 1, | |
'lightmakerdynamosessionhandlerbundle.php' => 1, | |
'lightmakercomplexifybundle.php' => 1, | |
'lightmakerawsbundle.php' => 1, | |
'litcvideoplayerbundle.php' => 1, | |
'litctestbundle.php' => 1, | |
'litckeywordbundle.php' => 1, | |
'litcheadbundle.php' => 1, | |
'lextyflashybundle.php' => 1, | |
'timesync.php' => 1, | |
'memory.php' => 1, | |
'gdata.php' => 1, | |
'dojo.php' => 1, | |
'levelabdoctrinediscriminatorbundle.php' => 1, | |
'lilaconceptsbestpracticebundle.php' => 1, | |
'level42notjaxbbundle.php' => 1, | |
'gitlabhookbundle.php' => 1, | |
'dice.php' => 1, | |
'axel.php' => 1, | |
'leobenoistsocketbundle.php' => 1, | |
'swsmapigenericbundle.php' => 1, | |
'alphavisitortrackingbundle.php' => 1, | |
'alphatwigbundle.php' => 1, | |
'alphatagbundle.php' => 1, | |
'gocardlessenterprisebundle.php' => 1, | |
'whoopsbundle.php' => 1, | |
'twitterbundle.php' => 1, | |
'likibuclient.phar' => 1, | |
'limeniusaramblageneratorbundle.php' => 1, | |
'oauthsignaturemethodplaintext.php' => 1, | |
'nodecollection.php' => 1, | |
'altstuvizbundle.php' => 1, | |
'searchaction.php' => 1, | |
'requestquerytrait.php' => 1, | |
'curlevent.php' => 1, | |
'countaction.php' => 1, | |
'locationpicker.php' => 1, | |
'.license_header' => 1, | |
'userserviceprovider.php' => 1, | |
'transserviceprovider.php' => 1, | |
'trans.php' => 1, | |
'languagenegotiator.php' => 1, | |
'assetcontainer.php' => 1, | |
'menuserviceprovider.php' => 1, | |
'limeniusfilesystemrouterbundle.php' => 1, | |
'hashidsserviceprovider.php' => 1, | |
'litgrouphttpclientbundle.php' => 1, | |
'litgroupgearmanbundle.php' => 1, | |
'litgroupeventloopbundle.php' => 1, | |
'litgroupdnsbundle.php' => 1, | |
'service_container.module' => 1, | |
'service_container.install' => 1, | |
'service_container.info' => 1, | |
'hack' => 1, | |
'linkvaluemobilenotifbundle.php' => 1, | |
'dynamicformaware.php' => 1, | |
'filehandlerfactory.php' => 1, | |
'limeniusreactbundle.php' => 1, | |
'oauthsignaturemethodrsasha1.php' => 1, | |
'oauthsignaturemethodhmacsha1.php' => 1, | |
'altstuvizmain.php' => 1, | |
'laravist' => 1, | |
'flowjswidget.php' => 1, | |
'flowjscontroller.php' => 1, | |
'flowjsasset.php' => 1, | |
'flowjs.php' => 1, | |
'skeletondump.sql' => 1, | |
'._license' => 1, | |
'laurentschoolbundle.php' => 1, | |
'laurentpiabundle.php' => 1, | |
'laurentbulletinbundle.php' => 1, | |
'api_details.dist.php' => 1, | |
'laulamanappsodrbundle.php' => 1, | |
'daybreakstudiosairbrakebundle.php' => 1, | |
'lapalabsuserprofilebundle.php' => 1, | |
'megaplanauth.php' => 1, | |
'lapalabsskeletonbundle.php' => 1, | |
'lapalabsratingbundle.php' => 1, | |
'lapalabscurrencybundle.php' => 1, | |
'lapalabscountrybundle.php' => 1, | |
'readme-1.0' => 1, | |
'landmarxuserbundle.php' => 1, | |
'landmarxlocationbundle.php' => 1, | |
'landmarxlandmarkbundle.php' => 1, | |
'lankitjquerybundle.php' => 1, | |
'lankitdatatablesbundle.php' => 1, | |
'netlicensing.php' => 1, | |
'integrationtest.sh' => 1, | |
'lpisearchbundle.php' => 1, | |
'mpauthexception.php' => 1, | |
'refresh.sh' => 1, | |
'modelstate.php' => 1, | |
'funmismsbundle.php' => 1, | |
'lightaccessbundle.php' => 1, | |
'imodel.php' => 1, | |
'generatorbundle.php' => 1, | |
'distributionbundle.php' => 1, | |
'libreoffice.cde' => 1, | |
'convert.cde' => 1, | |
'cde.uname' => 1, | |
'cde.options' => 1, | |
'cde.log' => 1, | |
'cde.full-environment' => 1, | |
'cde-exec' => 1, | |
'smshandler.php' => 1, | |
'responsehandler.php' => 1, | |
'lswautomaticupdatebundle.php' => 1, | |
'funmiresponserbundle.php' => 1, | |
'pagehandler.php' => 1, | |
'funmipaginationbundle.php' => 1, | |
'picturehandler.php' => 1, | |
'funmifilebundle.php' => 1, | |
'ledjinsyliussagepaybundle.php' => 1, | |
'ledjinsagepaybundle.php' => 1, | |
'lswversioninformationbundle.php' => 1, | |
'lswsecurecontrollerbundle.php' => 1, | |
'lswremotetemplatebundle.php' => 1, | |
'lswguzzlebundle.php' => 1, | |
'lswgettexttranslationbundle.php' => 1, | |
'lswdefaultroutingbundle.php' => 1, | |
'altstuvizcolorhelper.php' => 1, | |
'shellcommand.php' => 1, | |
'lpikernelbundle.php' => 1, | |
'mwsimplecrudgeneratorbundle.php' => 1, | |
'banner.jpg' => 1, | |
'test_streamer.php' => 1, | |
'doc_config.ini' => 1, | |
'phpta.xsd' => 1, | |
'phpta.xml' => 1, | |
'phpta' => 1, | |
'aippreferencebundle' => 1, | |
'provisioner.sh' => 1, | |
'ma27apikeyauthenticationevents.php' => 1, | |
'ma27apikeyauthenticationbundle.php' => 1, | |
'mwsimplelinodednsmanagerbundle.php' => 1, | |
'forobundle.php' => 1, | |
'mwsimplecrawlsitebundle.php' => 1, | |
'juidatepicker.php' => 1, | |
'mwsimpleadmincrudbundle.php' => 1, | |
'genfunctions.php' => 1, | |
'my_plugin.php' => 1, | |
'bootstrap-confirmation.js' => 1, | |
'mesduserbundle.php' => 1, | |
'mesdsettingsbundle.php' => 1, | |
'mesdphantasosclientbundle.php' => 1, | |
'mesdjasperreportviewerbundle.php' => 1, | |
'mesdjasperreportbundle.php' => 1, | |
'license-flowl-jasper' => 1, | |
'phpvs' => 1, | |
'subfieldinterface.php' => 1, | |
'bottomline.php' => 1, | |
'juidatepickerasset.php' => 1, | |
'subspecinterface.php' => 1, | |
'streamperklandingbundle.php' => 1, | |
'el_gr.csv' => 1, | |
'da_dk.csv' => 1, | |
'cs_cz.csv' => 1, | |
'ar_sa.csv' => 1, | |
'twigster.phar' => 1, | |
'magloftezmagicbundle.php' => 1, | |
'finfo.php' => 1, | |
'streamperkuserbundle.php' => 1, | |
'streamperkthemebundle.php' => 1, | |
'streamperkserverbundle.php' => 1, | |
'streamperkschedulebundle.php' => 1, | |
'streamperkpollbundle.php' => 1, | |
'streamperkcorebundle.php' => 1, | |
'juidatepickerlanguageasset.php' => 1, | |
'madrakiopersistentcommandbundle.php' => 1, | |
'madrakioextendablepermissionsbundle.php' => 1, | |
'madrakioextendableconfigurationbundle.php' => 1, | |
'madrakioeasyparameterdeploymentbundle.php' => 1, | |
'madrakioeasycrondeploymentbundle.php' => 1, | |
'madrakioeasyadminbundle.php' => 1, | |
'statemachinevisualizationbundle.php' => 1, | |
'pave' => 1, | |
'mactroniquephpcachebundle.php' => 1, | |
'juitimepicker.php' => 1, | |
'juidatetimepickerlanguageasset.php' => 1, | |
'juidatetimepickerasset.php' => 1, | |
'juidatetimepicker.php' => 1, | |
'subfield.php' => 1, | |
'subspec.php' => 1, | |
'shellresult.php' => 1, | |
'.htaccess.alt' => 1, | |
'humanreadablecache.php' => 1, | |
'compose.php' => 1, | |
'commentparser.php' => 1, | |
'pageannotatorbundle.php' => 1, | |
'lumbendilrottentomatoesbundle.php' => 1, | |
'lumbendilsharedroutersbundle.php' => 1, | |
'genetic' => 1, | |
'amp-console.php' => 1, | |
'amp-console' => 1, | |
'.kitchen.yml' => 1, | |
'lukaszmordawskicampaignmonitorbundle.php' => 1, | |
'download-configuration.php' => 1, | |
'luisdeimosencryptbundle.php' => 1, | |
'iauthenticate.php' => 1, | |
'lpfactorynestedsetroutingbundle.php' => 1, | |
'googlecustomsearch.php' => 1, | |
'favoritebundle.php' => 1, | |
'multilingualbegavior.php' => 1, | |
'lorenzschaefhelppagesbundle.php' => 1, | |
'helppages.php' => 1, | |
'lordbainefusionchartsbundle.php' => 1, | |
'lordbaineamchartsbundle.php' => 1, | |
'phpsass.php' => 1, | |
'test.scss' => 1, | |
'l8actioncolumn.php' => 1, | |
'vlchttpbundle.php' => 1, | |
'terminal.php' => 1, | |
'restler.php' => 1, | |
'icompose.php' => 1, | |
'speciterator.php' => 1, | |
'm6webapiexceptionbundle.php' => 1, | |
'positionorrangeinterface.php' => 1, | |
'positionorrange.php' => 1, | |
'marcspecparser.php' => 1, | |
'marcspecinterface.php' => 1, | |
'marcspec.php' => 1, | |
'comparisonstringinterface.php' => 1, | |
'comparisonstring.php' => 1, | |
'wild_combination.php' => 1, | |
'm6webphpprocessmanagerbundle.php' => 1, | |
'm6webfirewallbundle.php' => 1, | |
'm6webdomainuserbundle.php' => 1, | |
'coke' => 1, | |
'm4nuobjectroutebundle.php' => 1, | |
'iidentifyuser.php' => 1, | |
'm4numultidomainbundle.php' => 1, | |
'sqlgeo.php' => 1, | |
'geojsonsql.php' => 1, | |
'nmi3step.php' => 1, | |
'glide.php' => 1, | |
'fpdiext.php' => 1, | |
'git-pre-commit' => 1, | |
'fb-channel.php' => 1, | |
'conversion' => 1, | |
'xero.php' => 1, | |
'appserver.php' => 1, | |
'iuseauthentication.php' => 1, | |
'iprovidemultiversionapi.php' => 1, | |
'lpinewsbundle.php' => 1, | |
'lpifilebundle.php' => 1, | |
'en_us.csv' => 1, | |
'loginnotificatorinterface.php' => 1, | |
'kphoenrulerzbundle.php' => 1, | |
'kphoensmssenderbundle.php' => 1, | |
'kphoencontactbundle.php' => 1, | |
'hoarouterbundle.php' => 1, | |
'kphoendoctrinestatemachinebundle.php' => 1, | |
'justtexts-plugin.js' => 1, | |
'rulematcher.php' => 1, | |
'pagetemplate.php' => 1, | |
'pagegenerator.php' => 1, | |
'flushcache.php' => 1, | |
'userrepositoryinterface.php' => 1, | |
'loginservicetest.php' => 1, | |
'authenticatortest.php' => 1, | |
'janrain-union.php' => 1, | |
'authservicetestbase.php' => 1, | |
'activateservicetest.php' => 1, | |
'checkcwdplugin.php' => 1, | |
'listviewer.php' => 1, | |
'infologbundle.php' => 1, | |
'jjstoolchainbundle.php' => 1, | |
'jjssystemsettingsbundle.php' => 1, | |
'jjsresponseconverterbundle.php' => 1, | |
'joshuaestesgooglebundle.php' => 1, | |
'build.yml' => 1, | |
'joshuaestesamazonbundle.php' => 1, | |
'dutchdigitvalidator.php' => 1, | |
'kphoengaufretteextrasbundle.php' => 1, | |
'dataset.sql' => 1, | |
'jonnnhdynamicbundle.php' => 1, | |
'testovani' => 1, | |
'kfkitbundle.php' => 1, | |
'kfiuploadbundle.php' => 1, | |
'kfigeobundle.php' => 1, | |
'kfiframeworkbundle.php' => 1, | |
'webpageutils.php' => 1, | |
'kficmsbundle.php' => 1, | |
'kfibackupbundle.php' => 1, | |
'wtechrestbundle.php' => 1, | |
'wtechformbundle.php' => 1, | |
'html_icon.svg' => 1, | |
'validatorpanel.php' => 1, | |
'xxxx.blemc' => 1, | |
'somefoo' => 1, | |
'knonetranslatebundle.php' => 1, | |
'x' => 1, | |
'console.json' => 1, | |
'karolnettwigratingfilterbundle.php' => 1, | |
'.updateignore' => 1, | |
'changesfetcher.php' => 1, | |
'changesfetcherbundle.php' => 1, | |
'activpikentitymanagergeneratorbundle.php' => 1, | |
'activpikstompbundle.php' => 1, | |
'activpikfeedbackbundle.php' => 1, | |
'usage_with_anax-mvc' => 1, | |
'connectionpdo.php' => 1, | |
'migration_array.php' => 1, | |
'dbug.doxyfile' => 1, | |
'dutchdigitserviceprovider.php' => 1, | |
'user_recovery_password.sql' => 1, | |
'topdown.php' => 1, | |
'jsondumpdata.php' => 1, | |
'romannumberformatter.php' => 1, | |
'entrypoint.php' => 1, | |
'parserhooks.php' => 1, | |
'parserhooks.i18n.php' => 1, | |
'defaultconfig.php' => 1, | |
'maps_settings.php' => 1, | |
'maps.resources.php' => 1, | |
'maps.php' => 1, | |
'maps.i18n.namespaces.php' => 1, | |
'maps.i18n.magic.php' => 1, | |
'maps.i18n.alias.php' => 1, | |
'maps.hooks.php' => 1, | |
'jazawordpressintegrationbundle.php' => 1, | |
'subpagelist.i18n.magic.php' => 1, | |
'jazadrupalintegrationbundle.php' => 1, | |
'm3d.php' => 1, | |
'env.inc.php' => 1, | |
'triageclient.php' => 1, | |
'composer.json.sample' => 1, | |
'composerscripts.php' => 1, | |
'strip' => 1, | |
'structure.mdj' => 1, | |
'phpthumb.config.php.default' => 1, | |
'var-dump-check.php' => 1, | |
'var-dump-check' => 1, | |
'parallel-lint.php' => 1, | |
'parallel-lint' => 1, | |
'romannumberformattertest.php' => 1, | |
'subpagelist.php' => 1, | |
'user_permission.sql' => 1, | |
'rssitemawareinterface.php' => 1, | |
'jokubasrlithuaniannamesdeclensionbundle.php' => 1, | |
'jpcportfoliobundle.php' => 1, | |
'base-db.sql' => 1, | |
'walt' => 1, | |
'phpspec-coverage.yml' => 1, | |
'qt-faststart' => 1, | |
'ffprobe' => 1, | |
'ffmpeg' => 1, | |
'jmoatiswarrotbootstrapbundle.php' => 1, | |
'jmoatigeneratorbundle.php' => 1, | |
'jmoatiexiftoolbundle.php' => 1, | |
'rssitemawaretrait.php' => 1, | |
'rsschannelawaretrait.php' => 1, | |
'subpagelist.settings.php' => 1, | |
'rsschannelawareinterface.php' => 1, | |
'cmfrssbundle.php' => 1, | |
'jtuserbundle.php' => 1, | |
'jtadsbundle.php' => 1, | |
'gozer_config_template.php' => 1, | |
'create_oauth_tables.sql' => 1, | |
'checkoutruapi.php' => 1, | |
'jquery.masked.datevalidator.min.js' => 1, | |
'jquery.masked.datevalidator.js' => 1, | |
'jhovanictcpdfbundle.php' => 1, | |
'blockmodelsasset.php' => 1, | |
'blockmodels.php' => 1, | |
'validator.i18n.php' => 1, | |
'ongoingsitemapbundle.php' => 1, | |
'compare_schemas.drush.inc' => 1, | |
'lcpdocusignbundle.php' => 1, | |
'kunstmaangeneratorbundle.php' => 1, | |
'kunstmaanseobundle.php' => 1, | |
'kunstmaansearchbundle.php' => 1, | |
'kunstmaanredirectbundle.php' => 1, | |
'kunstmaanpagepartbundle.php' => 1, | |
'kunstmaannodesearchbundle.php' => 1, | |
'kunstmaannodebundle.php' => 1, | |
'kunstmaannewrelicbundle.php' => 1, | |
'kunstmaanmenubundle.php' => 1, | |
'kunstmaanmediapagepartbundle.php' => 1, | |
'kunstmaanlivereloadbundle.php' => 1, | |
'kunstmaanleadgenerationbundle.php' => 1, | |
'kunstmaanlanguagechooserbundle.php' => 1, | |
'kunstmaanformbundle.php' => 1, | |
'kunstmaantaggingbundle.php' => 1, | |
'kunstmaanfixturesbundle.php' => 1, | |
'kunstmaandashboardbundle.php' => 1, | |
'setup_project.sh' => 1, | |
'upgrade-x.x' => 1, | |
'upgrade-3.5' => 1, | |
'kunstmaanbehatbundle.php' => 1, | |
'kunstmaanarticlebundle.php' => 1, | |
'kunstmaanadminnodebundle.php' => 1, | |
'kunstmaanadminlistbundle.php' => 1, | |
'pangu.php' => 1, | |
'pangu-test.php' => 1, | |
'pangu-cli.php' => 1, | |
'config_databases.php' => 1, | |
'kunstmaansitemapbundle.php' => 1, | |
'kunstmaanusermanagementbundle.php' => 1, | |
'personawidget.php' => 1, | |
'lcstudiosqacommandbundle.php' => 1, | |
'lzaztecnotificationbundle.php' => 1, | |
'example-advanced.php' => 1, | |
'lrotherfieldnotificationbundle.php' => 1, | |
'form_example.php' => 1, | |
'example_usage.php' => 1, | |
'lpuploaderbundle.php' => 1, | |
'userscontroller.php' => 1, | |
'wp-config-custom-sample.php' => 1, | |
'robots.txt.dist' => 1, | |
'template-selector.php' => 1, | |
'wpsymfonyform.php' => 1, | |
'reflectionfixturebundle.php' => 1, | |
'lcstudiosmetacommandbundle.php' => 1, | |
'kunstmaanutilitiesbundle.php' => 1, | |
'lcstudiosldapbundle.php' => 1, | |
'mainmigration.php' => 1, | |
'aceeditorwidget.php' => 1, | |
'sortlist.php' => 1, | |
'log_out.php' => 1, | |
'kyoushufoundationbundle.php' => 1, | |
'asseticcontrollersubstitute.php' => 1, | |
'kwrztwigexceptionbundle.php' => 1, | |
'odnoklassnikistrategy.php' => 1, | |
'spaceport' => 1, | |
'gfc' => 1, | |
'kunstmaanvotingbundle.php' => 1, | |
'kunstmaanviewbundle.php' => 1, | |
'to-do' => 1, | |
'personauseridentity.php' => 1, | |
'environment.drush.inc' => 1, | |
'crunchuseradminbundle.php' => 1, | |
'parameters.yml~' => 1, | |
'wellsfargoachbundle.php' => 1, | |
'kitanopelbundle.php' => 1, | |
'kitanopaymentsipsbundle.php' => 1, | |
'kitanopaymentfakebundle.php' => 1, | |
'kitanopaymentcmcicbundle.php' => 1, | |
'paymentexception.php' => 1, | |
'kitanopaymentevents.php' => 1, | |
'kitanopaymentbundle.php' => 1, | |
'kitanocachebundle.php' => 1, | |
'kingboard.zip' => 1, | |
'ccp' => 1, | |
'crunchssibundle.php' => 1, | |
'profilesbehat3drupal.yml.sample' => 1, | |
'crunchcachecontrolbundle.php' => 1, | |
'cache-control.phar' => 1, | |
'kutilbundle.php' => 1, | |
'biogena-data.php' => 1, | |
'kifdoctrinetotypescriptbundle.php' => 1, | |
'enforce.php' => 1, | |
'khaldounvatvalidationbundle.php' => 1, | |
'urlgenerator.class.php' => 1, | |
'sync_tools.drush.inc' => 1, | |
'multidrush.drush.inc' => 1, | |
'multidrush.class.php' => 1, | |
'diagnostics.drush.inc' => 1, | |
'example.env.drushrc.php' => 1, | |
'profiles.yml.sample' => 1, | |
'projects.yml.sample' => 1, | |
'persona.php' => 1, | |
'readme-sk.texy' => 1, | |
'inittool.php' => 1, | |
'kchsmsapibundle.php' => 1, | |
'facebookconnectrestbundle.php' => 1, | |
'pixiv.php' => 1, | |
'kotori.php' => 1, | |
'maxim3.jpg' => 1, | |
'koodimonni-modifications.php' => 1, | |
'yandexmetrikabundle.php' => 1, | |
'readme.rus' => 1, | |
'handlersocketbundle.php' => 1, | |
'asseticstaticgzipbundle.php' => 1, | |
'validate' => 1, | |
'brouziesphinxybundle.php' => 1, | |
'settings.yml.sample' => 1, | |
'brouziecrossdomainauthbundle.php' => 1, | |
'musefactory.php' => 1, | |
'muse.php' => 1, | |
'knptimebundle.php' => 1, | |
'knprevealbundle.php' => 1, | |
'gh-changelog-template.tpl' => 1, | |
'knppaginatorbundle.php' => 1, | |
'knpoauthbundle.php' => 1, | |
'knpmediaexposerbundle.php' => 1, | |
'knpmarkupvalidatorbundle.php' => 1, | |
'knpmailjetbundle.php' => 1, | |
'knplasttweetsbundle.php' => 1, | |
'knpconsoleautocompletebundle.php' => 1, | |
'en_pt.csv' => 1, | |
'es_es.csv' => 1, | |
'yiiquaggaasset.php' => 1, | |
'bmconsole.php' => 1, | |
'bmdataobjectmap.php' => 1, | |
'bmdataobjectfield.php' => 1, | |
'bmdataobject.php' => 1, | |
'bmdaemon.php' => 1, | |
'bmcustomwebsession.php' => 1, | |
'bmcustomuser.php' => 1, | |
'bmcustomtextprocessor.php' => 1, | |
'bmcustomsession.php' => 1, | |
'bmcustomremoteprocedure.php' => 1, | |
'bmcustomcontentprovider.php' => 1, | |
'bmcustomapplication.php' => 1, | |
'bmcurl.php' => 1, | |
'bmcgi.php' => 1, | |
'bmffdata.php' => 1, | |
'bmcachelink.php' => 1, | |
'bmapi.php' => 1, | |
'load_dumps.sh' => 1, | |
'lib' => 1, | |
'ignoredfiles.tar' => 1, | |
'backup.sh' => 1, | |
'nicparrycurlbundle.php' => 1, | |
'codememedaemonbundle.php' => 1, | |
'nibynoolfitbitstoragebundle.php' => 1, | |
'nibynoolfitbitinterfacebundle.php' => 1, | |
'nhacsamdatatablesbundle.php' => 1, | |
'nimworkerbundle.php' => 1, | |
'bmdatetime.php' => 1, | |
'bmffobject.php' => 1, | |
'nimvaccinebundle.php' => 1, | |
'bmreferencefield.php' => 1, | |
'karma' => 1, | |
'vhost.example' => 1, | |
'nicocontactbundle.php' => 1, | |
'corezoid.php' => 1, | |
'sonataextendsbundle' => 1, | |
'lumensonataextendsbundle.php' => 1, | |
'test-runner' => 1, | |
'bmxcache.php' => 1, | |
'bmtools.php' => 1, | |
'bmtextprocessor.php' => 1, | |
'bmstemmer.php' => 1, | |
'bmreferencemap.php' => 1, | |
'bmredis.php' => 1, | |
'bmfilemanager.php' => 1, | |
'bmpersistentcachelink.php' => 1, | |
'bmpage.php' => 1, | |
'bmphpsession.php' => 1, | |
'bmmysqllink.php' => 1, | |
'bmmigration.php' => 1, | |
'bmmetadataobject.php' => 1, | |
'bmmailer.php' => 1, | |
'bmlog.php' => 1, | |
'bmimageresizemodule.php' => 1, | |
'bmimigrate.php' => 1, | |
'bmhtmlpage.php' => 1, | |
'bmgenerator.php' => 1, | |
'bmflashsession.php' => 1, | |
'nimwebbundle.php' => 1, | |
'nimmissionbundle.php' => 1, | |
'filesource.php' => 1, | |
'sugarcrmrestbundle-devdoc-0.2.pdf' => 1, | |
'datatableevents.php' => 1, | |
'netteamdddbundle.php' => 1, | |
'vendors' => 1, | |
'nercuryreverseinjectionbundle.php' => 1, | |
'sample-web.php' => 1, | |
'sample-newsletter.php' => 1, | |
'fresque.ini' => 1, | |
'fresque' => 1, | |
'nxprutilsbundle.php' => 1, | |
'builds' => 1, | |
'neodorksonataredirectbundle.php' => 1, | |
'sugarrestbundle.php' => 1, | |
'nemfontawesomebundle.php' => 1, | |
'abstractcommtoolbuilder.php' => 1, | |
'nemangularjsbundle.php' => 1, | |
'neklandeditionbundle.php' => 1, | |
'neklandbaseadminbundle.php' => 1, | |
'neirda24toolsbundle.php' => 1, | |
'html2canvasproxyevents.php' => 1, | |
'html2canvasproxybundle.php' => 1, | |
'liipthemeprovidertags.php' => 1, | |
'liipthemeproviderbundle.php' => 1, | |
'nebumixrtvalidationbundle.php' => 1, | |
'update_doc.sh' => 1, | |
'sample_data.json' => 1, | |
'dicts.php' => 1, | |
'autocorrect.php' => 1, | |
'netteamdatatablebundle.php' => 1, | |
'campaigncommtool.php' => 1, | |
'nimformbundle.php' => 1, | |
'excelrowinterface.php' => 1, | |
'nimcorebundle.php' => 1, | |
'apache-2.4_vhost.conf' => 1, | |
'newbridgegreenextjsbundle.php' => 1, | |
'bootstrapmarkdown.php' => 1, | |
'composer.sh' => 1, | |
'gendoc.sh' => 1, | |
'netpositivediscriminatormapbundle.php' => 1, | |
'whosonlinebundle.php' => 1, | |
'uploadexcelevents.php' => 1, | |
'uploadexcelbundle.php' => 1, | |
'rowvalidatorinterface.php' => 1, | |
'mivalidador.php' => 1, | |
'excelrow.php' => 1, | |
'commtoolbuilderinterface.php' => 1, | |
'ejemplo.php' => 1, | |
'transactionalsending.php' => 1, | |
'jangomailfosuser.php' => 1, | |
'jangomailbundle.php' => 1, | |
'jangomail.php' => 1, | |
'campaignsending.php' => 1, | |
'abstractsending.php' => 1, | |
'sectionfactory.php' => 1, | |
'commtooltemplatebundle.php' => 1, | |
'templateview.php' => 1, | |
'optimecommtoolbundle.php' => 1, | |
'controlfactory.php' => 1, | |
'commtoolfactory.php' => 1, | |
'solidifier' => 1, | |
'nileadloaderbundle.php' => 1, | |
'iplocation.php' => 1, | |
'unisenderwrapper.php' => 1, | |
'openclassroomscachebundle.php' => 1, | |
'openclassroomsakismetbundle.php' => 1, | |
'.srcutinizer.yml' => 1, | |
'openwidezendcaptchabundle.php' => 1, | |
'openwidesynchronizeldapuserbundle.php' => 1, | |
'openwidepublishservicebundle.php' => 1, | |
'openwideagendabundle.php' => 1, | |
'opaleexternaluribundle.php' => 1, | |
'opaleconsoleexceptionbundle.php' => 1, | |
'timestampmacro.php' => 1, | |
'redis-driver-installer.sh' => 1, | |
'unisender.php' => 1, | |
'olousouzianatlasbundle.php' => 1, | |
'openclassroomsdoctrinecacheextensionbundle.php' => 1, | |
'olousouzianakitabundle.php' => 1, | |
'ngsfformbundle.php' => 1, | |
'mongorevisionbehavior.php' => 1, | |
'winmerge images only.flt' => 1, | |
'winmerge client only.flt' => 1, | |
'fuelstart db.sql' => 1, | |
'fs' => 1, | |
'fuelphp license' => 1, | |
'fuel start license' => 1, | |
'chartistasset.php' => 1, | |
'chartist.php' => 1, | |
'steamio.php' => 1, | |
'openclassroomscustomeriobundle.php' => 1, | |
'openclassroomselasticsearchbundle.php' => 1, | |
'aws_et.php' => 1, | |
'opiferrulesenginebundle.php' => 1, | |
'orbitaleintegrationbundle.php' => 1, | |
'references.php' => 1, | |
'commandresponse.php' => 1, | |
'commandoptions.php' => 1, | |
'orbitalegrypbundle.php' => 1, | |
'orbitalegamebundle.php' => 1, | |
'entitymerger.php' => 1, | |
'emptyclassmetadata.php' => 1, | |
'baseentityrepository.php' => 1, | |
'orbitalecmsbundle.php' => 1, | |
'orbitaleapibundle.php' => 1, | |
'manload.php' => 1, | |
'opiferredirectbundle.php' => 1, | |
'openclassroomsoneskybundle.php' => 1, | |
'opiferformbundle.php' => 1, | |
'opifereavbundle.php' => 1, | |
'opifercrudbundle.php' => 1, | |
'testfile' => 1, | |
'eden.php' => 1, | |
'hafasxmlinterface.xsd' => 1, | |
'leggimi' => 1, | |
'opencontentopenmagazinebundle.php' => 1, | |
'openizijsonwebprofilerbundle.php' => 1, | |
'make_release.sh' => 1, | |
'openclassroomsusecasebundle.php' => 1, | |
'openclassroomstranslationbundle.php' => 1, | |
'openclassroomsserviceproxybundle.php' => 1, | |
'oire_mail.php' => 1, | |
'sendsmscomponent.php' => 1, | |
'basicobject.php' => 1, | |
'eauth.php' => 1, | |
'novaezresponsiveimagesbundle.php' => 1, | |
'notifierbundle.php' => 1, | |
'excelarray.class.php' => 1, | |
'apache.conf' => 1, | |
'iauthservice.php' => 1, | |
'eopenidservice.php' => 1, | |
'eoauthservice.php' => 1, | |
'eoauth2service.php' => 1, | |
'eauthwidget.php' => 1, | |
'eauthuseridentity.php' => 1, | |
'eauthservicebase.php' => 1, | |
'eauthredirectwidget.php' => 1, | |
'example-google_apps.php' => 1, | |
'sf2helperssftpbundle.php' => 1, | |
'__autoload.php' => 1, | |
'nobox' => 1, | |
'nsutilbundle.php' => 1, | |
'nssecuritybundle.php' => 1, | |
'nsflashbundle.php' => 1, | |
'nsfilteredpaginationbundle.php' => 1, | |
'filteredpagination.php' => 1, | |
'nsdistancebundle.php' => 1, | |
'nssonatadoctrineormadminbundle.php' => 1, | |
'nsacesonatabundle.php' => 1, | |
'nsacebundle.php' => 1, | |
'validatingbasicobject.php' => 1, | |
'ibasicobjectmemcache.php' => 1, | |
'novaezseobundle.php' => 1, | |
'nyxisgooglemapbundle.php' => 1, | |
'iconsasset.php' => 1, | |
'init.yml' => 1, | |
'responsetemplate.php' => 1, | |
'octopod.php' => 1, | |
'basehandler.php' => 1, | |
'googleloginbutton.php' => 1, | |
'proxy-manager.svg' => 1, | |
'proxy-manager.png' => 1, | |
'stability' => 1, | |
'finalizer' => 1, | |
'oisfunctions.php' => 1, | |
'translator_config.yml' => 1, | |
'translator_config.diff.yml' => 1, | |
'spyc-0.5.zip' => 1, | |
'cache.appcache' => 1, | |
'october' => 1, | |
'oxikoneapibundle.php' => 1, | |
'cookbook.jpg' => 1, | |
'solrconfig.xml' => 1, | |
'solrconfig-5.xml' => 1, | |
'schema-5.xml' => 1, | |
'logging.properties' => 1, | |
'core.properties' => 1, | |
'synonyms' => 1, | |
'stopwords' => 1, | |
'opcvm360wrapperbundle.php' => 1, | |
'oktolabmediaevent.php' => 1, | |
'oktolabmediabundle.php' => 1, | |
'october.yaml' => 1, | |
'qqwry.dat' => 1, | |
'socialbundle.php' => 1, | |
'et_ee.csv' => 1, | |
'run-cept' => 1, | |
'sprite' => 1, | |
'make-junctions' => 1, | |
'sitcom.yml' => 1, | |
'sitcom' => 1, | |
'sigurd' => 1, | |
'signals-pre-false-filter.yml' => 1, | |
'signals-post-false-filter.yml' => 1, | |
'signals' => 1, | |
'make-links' => 1, | |
'composer-1426786617.json.bak' => 1, | |
'maquinette' => 1, | |
'run-cepts' => 1, | |
'make-messages' => 1, | |
'staple' => 1, | |
'make-cept' => 1, | |
'hedron' => 1, | |
'.hedron.example.yml' => 1, | |
'travis-ocular.sh' => 1, | |
'i18n-extractor' => 1, | |
'twitterextension.php' => 1, | |
'authenticationexception.php' => 1, | |
'distancematrix.php' => 1, | |
'bytesdocraptorbundle.php' => 1, | |
'itunes-m3u' => 1, | |
'rce.sublime-workspace' => 1, | |
'rce.sublime-project' => 1, | |
'sprite.yml' => 1, | |
'whitelist.yml' => 1, | |
'marijnkoesencodegeneratorbundle.php' => 1, | |
'breadcrumbsutility.php' => 1, | |
'.gitingore' => 1, | |
'herokuwebapiserviceprovider.php' => 1, | |
'herokuwebapi.php' => 1, | |
'rapidauthorization.php' => 1, | |
'clientpreferences.php' => 1, | |
'availablepreferences.php' => 1, | |
'tumblroauth.php' => 1, | |
'abstractoauthclient.php' => 1, | |
'linkedinoauth.php' => 1, | |
'instagramoauth.php' => 1, | |
'ccouchconnect.php' => 1, | |
'matthimatikeropcachebundle.php' => 1, | |
'annotationparserinterface.php' => 1, | |
'.zamm-example.yml' => 1, | |
'annotationparameter.php' => 1, | |
'annotationobject.php' => 1, | |
'annotationmethod.php' => 1, | |
'annotationfunctiontrait.php' => 1, | |
'annotationfunction.php' => 1, | |
'annotationclass.php' => 1, | |
'techpafannotationfirewallbundle.php' => 1, | |
'mattdunbarusermicroservicebundle.php' => 1, | |
'matthecathtmlcompressorbundle.php' => 1, | |
'fort' => 1, | |
'htmlpurifier.standalone.php' => 1, | |
'autouploader.php' => 1, | |
'zamm' => 1, | |
'config.local.php-dist' => 1, | |
'mbrightrepresentbundle.php' => 1, | |
'bambooapibundle.php' => 1, | |
'phparray.class.php' => 1, | |
'sfs-mass-ip-checker.php' => 1, | |
'phpmussel.php' => 1, | |
'people' => 1, | |
'changelog-v1' => 1, | |
'baseassets.php' => 1, | |
'ajaxinputwidget.php' => 1, | |
'ajaxinputasset.php' => 1, | |
'routefinder.php' => 1, | |
'accessobject.php' => 1, | |
'eventloginterface.php' => 1, | |
'eventlogindb.php' => 1, | |
'phparray.test.php' => 1, | |
'magweldispatcherbundle.php' => 1, | |
'majescmsbundle.php' => 1, | |
'zh_cn.csv' => 1, | |
'uk_ua.csv' => 1, | |
'tr_tr.csv' => 1, | |
'sk_sk.csv' => 1, | |
'pt_pt.csv' => 1, | |
'pt_br.csv' => 1, | |
'nl_nl.csv' => 1, | |
'lv_lv.csv' => 1, | |
'it_it.csv' => 1, | |
'hu_hu.csv' => 1, | |
'hr_hr.csv' => 1, | |
'he_il.csv' => 1, | |
'fi_fi.csv' => 1, | |
'majesblogbundle.php' => 1, | |
'majescorebundle.php' => 1, | |
'v2.0.zip' => 1, | |
'logs-schema-mysql.sql' => 1, | |
'v1.1.zip' => 1, | |
'v1-0.zip' => 1, | |
'kanda.php' => 1, | |
'kbase.php' => 1, | |
'exception_handler' => 1, | |
'likebroapirequest.php' => 1, | |
'mannewhipchatbundle.php' => 1, | |
'mango.php' => 1, | |
'mmmediabundle.php' => 1, | |
'mmcmfroutingbundle.php' => 1, | |
'mmcmfnodebundle.php' => 1, | |
'mmcmfmenubundle.php' => 1, | |
'zendeskbundle.php' => 1, | |
'majesmediabundle.php' => 1, | |
'malwarebytestestbundle.php' => 1, | |
'malwarebytesformmetadatabundle.php' => 1, | |
'malwarebytesaltamirabundle.php' => 1, | |
'chartfactory.php' => 1, | |
'altamira-config.ini' => 1, | |
'asbowhoswhoevents.php' => 1, | |
'asbowhoswhobundle.php' => 1, | |
'alfrescodocument.php' => 1, | |
'alfrescodoc-joomla.xml' => 1, | |
'alfrescodoc-joomla.php' => 1, | |
'alfresco_cmis_api.php' => 1, | |
'majessocialbundle.php' => 1, | |
'majessearchbundle.php' => 1, | |
'mediamonksrestapibundle.php' => 1, | |
'daemonbundle.php' => 1, | |
'vssresourcesfirewallbundle.php' => 1, | |
'morphodoindexerbundle.php' => 1, | |
'mrgreenstuffaclsonataadminextensionbundle.php' => 1, | |
'url_shortener.sqlite' => 1, | |
'php.travis.ini' => 1, | |
'foundation' => 1, | |
'myext.php' => 1, | |
'steppaginationfactory.php' => 1, | |
'paginationiteratorinterface.php' => 1, | |
'paginationiterator.php' => 1, | |
'paginationfactoryinterface.php' => 1, | |
'neighbourpaginationfactory.php' => 1, | |
'logpaginationfactory.php' => 1, | |
'fullpaginationfactory.php' => 1, | |
'morphodocrawlerbundle.php' => 1, | |
'mrmentityvalidationbundle.php' => 1, | |
'platform.ini' => 1, | |
'php.5.5' => 1, | |
'repositories.json' => 1, | |
'morkethmvcbundle.php' => 1, | |
'morannonbundle.php' => 1, | |
'moovlyrecurlybundle.php' => 1, | |
'robots.prod' => 1, | |
'robots.dev' => 1, | |
'channel.html' => 1, | |
'getval' => 1, | |
'envfile.php' => 1, | |
'thbaseservicetest.php' => 1, | |
'thbaseservice.thrift' => 1, | |
'dbg.php' => 1, | |
'mrmisotestbundle.php' => 1, | |
'hbase.thrift' => 1, | |
'mykeestagbundle.php' => 1, | |
'vssoauthextensionbundle.php' => 1, | |
'phpoole.php' => 1, | |
'napasformextrabundle.php' => 1, | |
'user_guide_magento2.pdf' => 1, | |
'guide_utilisation_magento2.pdf' => 1, | |
'modify.php' => 1, | |
'add.php' => 1, | |
'nfcuploadbundle.php' => 1, | |
'pubstack' => 1, | |
'nzourlencryptorbundle.php' => 1, | |
'nzograbberbundle.php' => 1, | |
'nzofiledownloaderbundle.php' => 1, | |
'mykeesmediabundle.php' => 1, | |
'.travis.yml~' => 1, | |
'mykeescommentbundle.php' => 1, | |
'mvcblogbundle.php' => 1, | |
'restedservice.php' => 1, | |
'restedbundle.php' => 1, | |
'abstractresource.php' => 1, | |
'mykrzysiusmsapibundle.php' => 1, | |
'tour.php' => 1, | |
'bootstraptourpluginasset.php' => 1, | |
'mustached_test.sql' => 1, | |
'myextensionslist.json' => 1, | |
'config.cson' => 1, | |
'bagel.cmd.html' => 1, | |
'.tgitconfig' => 1, | |
'hbasetest.php' => 1, | |
'mollom.class.inc' => 1, | |
'jiraapibundle.php' => 1, | |
'adminltebootstrap.php' => 1, | |
'build-repo.php' => 1, | |
'wunderdatamailchimpbundle.php' => 1, | |
'filter' => 1, | |
'zsh_completion' => 1, | |
'moosh.php' => 1, | |
'framelayout.php' => 1, | |
'moderatorpanel.php' => 1, | |
'linkwidget.php' => 1, | |
'framewidget.php' => 1, | |
'imageuploadwidget.php' => 1, | |
'fileuploadwidget.php' => 1, | |
'brainthemebootstrap.php' => 1, | |
'blogbootstrap.php' => 1, | |
'bar.navigation.panel.latte' => 1, | |
'migrate.sh' => 1, | |
'makedb.sh' => 1, | |
'getconfig' => 1, | |
'appinit.bat' => 1, | |
'appinit' => 1, | |
'commentatorasset.php' => 1, | |
'fontcolorbyimage.class.php' => 1, | |
'mewesktwigexcelbundle.php' => 1, | |
'cjuidatetimepicker.php' => 1, | |
'dash.html' => 1, | |
'yii2_start_slider.sql' => 1, | |
'widgetapn.php' => 1, | |
'stashapibundle.php' => 1, | |
'navigationpanel.php' => 1, | |
'couchbaseconnection.php' => 1, | |
'xxxreadme' => 1, | |
'mmdhelperbundle.php' => 1, | |
'uploadreadme' => 1, | |
'viewcount.php' => 1, | |
'sendslackbestarticles.php' => 1, | |
'readerserviceprovider.php' => 1, | |
'ireader.php' => 1, | |
'crawlfeed.php' => 1, | |
'blogcontroller.php' => 1, | |
'articlecontroller.php' => 1, | |
'cashive.php' => 1, | |
'mmdsourceboxbundle.php' => 1, | |
'mmdmcmonitorbundle.php' => 1, | |
'mmdimprovbundle.php' => 1, | |
'mmdgooglewebfontscachebundle.php' => 1, | |
'quaver.sql' => 1, | |
'mmdgithubapicachebundle.php' => 1, | |
'mmdcassandrabundle.php' => 1, | |
'mmdcaptchabundle.php' => 1, | |
'mmdapebundle.php' => 1, | |
'igniterelasticachebundle.php' => 1, | |
'validate.json' => 1, | |
'.validate.json' => 1, | |
'misatobootstrapduallistboxbundle.php' => 1, | |
'minify_html.php' => 1, | |
'minishlinkwebpushbundle.php' => 1, | |
'minecraftjp.php' => 1, | |
'testbootstrap.php' => 1, | |
'codeigniterinstructions' => 1, | |
'barcode-test.php' => 1, | |
'yiiquagga.php' => 1, | |
'epilgrimmodifyrequestheadersbundle.php' => 1, | |
'easyajax.php' => 1, | |
'urltoquery.php' => 1, | |
'reject-and-notify.php' => 1, | |
'raph.php' => 1, | |
'pentothal.php' => 1, | |
'occipital-in-theme-guide' => 1, | |
'occipital.php' => 1, | |
'screenshot-03.png' => 1, | |
'screenshot-02.png' => 1, | |
'screenshot-01.png' => 1, | |
'fcpch-helpers.php' => 1, | |
'fcpch-admin.php' => 1, | |
'fc-post-content-handler.php' => 1, | |
'cleverrules.php' => 1, | |
'url_to_query.php' => 1, | |
'ajax-template-part.php' => 1, | |
'checklist' => 1, | |
'jstorage.min.js' => 1, | |
'jstorage.js' => 1, | |
'jquery.md5.min.js' => 1, | |
'jquery.md5.js' => 1, | |
'gizlabtranslationbundle.php' => 1, | |
'single_post_layout.html' => 1, | |
'single_post_header.html' => 1, | |
'header.html' => 1, | |
'head.html' => 1, | |
'base.html' => 1, | |
'urltoqueryitem.php' => 1, | |
'gliferycrudabstractdatabundle.php' => 1, | |
'archive.plugin.php' => 1, | |
'providerservice.php' => 1, | |
'grcsinternalmessagesbundle.php' => 1, | |
'gouttewordpressbundle.php' => 1, | |
'gouttetreebundle.php' => 1, | |
'blackboard' => 1, | |
'wp-goracash.php' => 1, | |
'app.yaml.dist' => 1, | |
'gollumsflibsassbundle.php' => 1, | |
'bugsnagplugin.php' => 1, | |
'gterrortracker.php' => 1, | |
'goldenlineimgixbundle.php' => 1, | |
'goldenlinealgoliabundle.php' => 1, | |
'publisherservice.php' => 1, | |
'gointegrohateoasbundle.php' => 1, | |
'gliferyentityhiddentypebundle.php' => 1, | |
'mailchimpbundle.php' => 1, | |
'acltreebundle.php' => 1, | |
'dastatbundle.php' => 1, | |
'dapaginatorbundle.php' => 1, | |
'daoauthserverbundle.php' => 1, | |
'daoauthclientbundle.php' => 1, | |
'daauthcommonbundle.php' => 1, | |
'daapiserverbundle.php' => 1, | |
'daapiclientbundle.php' => 1, | |
'dalessbundle.php' => 1, | |
'dadibundle.php' => 1, | |
'gttcryptbundle.php' => 1, | |
'cryptorregistry.php' => 1, | |
'rss.plugin.php' => 1, | |
'archive.html' => 1, | |
'threads.php' => 1, | |
'haloapi.class.php' => 1, | |
'gcobngtablebundle.php' => 1, | |
'class-gamajo-template-loader.php' => 1, | |
'phpunit.record.xml' => 1, | |
'phpunit.live.xml' => 1, | |
'garethpsainsburryscraperbundle.php' => 1, | |
'garethpphotosbundle.php' => 1, | |
'garethpitsalwaysfivebundle.php' => 1, | |
'translatorbundle.php' => 1, | |
'gabe96multi5bundle.php' => 1, | |
'gayaphpsandboxbundle.php' => 1, | |
'ioformbundle.php' => 1, | |
'gtheronrestbundle.php' => 1, | |
'ggteambreadcrumbbundle.php' => 1, | |
'bugs.php' => 1, | |
'formdatepickerfield.php' => 1, | |
'datepickerfield.php' => 1, | |
'formaddresspickerfield.php' => 1, | |
'addresspickerfield.php' => 1, | |
'please' => 1, | |
'lensesframework.pdf' => 1, | |
'funstaffredirectevents.php' => 1, | |
'funstaffredirectbundle.php' => 1, | |
'fwslayoutbundle.php' => 1, | |
'frydrynotificationbundle.php' => 1, | |
'mqtranslate_xhaleera_addons.php' => 1, | |
'mqtranslate_wphacks.php' => 1, | |
'mqtranslate_widget_qtranslate-slug.php' => 1, | |
'externaltrackingbundle.php' => 1, | |
'demotext.php' => 1, | |
'write.html' => 1, | |
'widgettwigextension.php' => 1, | |
'posts.html' => 1, | |
'edit.html' => 1, | |
'admin_header.html' => 1, | |
'admin_head.html' => 1, | |
'admin_base.html' => 1, | |
'admin.plugin.php' => 1, | |
'admin.html' => 1, | |
'stream-laravel.sublime-project' => 1, | |
'gitignore' => 1, | |
'sfvoterbundle.php' => 1, | |
'mastersliderasset.php' => 1, | |
'masterslider.php' => 1, | |
'widgetregistryinterface.php' => 1, | |
'flatplane.inc.php' => 1, | |
'widgetregistry.php' => 1, | |
'ws_logo.jpeg' => 1, | |
'goswebsocketbundle.php' => 1, | |
'gospubsubrouterbundle.php' => 1, | |
'gosmailerbundle.php' => 1, | |
'gosformbundle.php' => 1, | |
'gosfixturebundle.php' => 1, | |
'fixture.php' => 1, | |
'querybuildableinterface.php' => 1, | |
'gosentityrepository.php' => 1, | |
'settings_sample.ini' => 1, | |
'genedyscsrfroutebundle.php' => 1, | |
'gendoriaparamconverterbundle.php' => 1, | |
'grcstorbundle.php' => 1, | |
'binstring.example1.php' => 1, | |
'mqtranslate_widget.inc.php' => 1, | |
'abstractcacheadapter.php' => 1, | |
'abstractentitybodydecorator.php' => 1, | |
'toarrayinterface.php' => 1, | |
'hasdispatcherinterface.php' => 1, | |
'fromconfiginterface.php' => 1, | |
'abstracthasdispatcher.php' => 1, | |
'zf2cacheadapter.php' => 1, | |
'zf1cacheadapter.php' => 1, | |
'nullcacheadapter.php' => 1, | |
'doctrinecacheadapter.php' => 1, | |
'closurecacheadapter.php' => 1, | |
'cacheadapterinterface.php' => 1, | |
'cacheadapterfactory.php' => 1, | |
'notifyingbatch.php' => 1, | |
'entitybody.php' => 1, | |
'historybatch.php' => 1, | |
'flushingbatch.php' => 1, | |
'exceptionbufferingbatch.php' => 1, | |
'batchtransferinterface.php' => 1, | |
'batchsizedivisor.php' => 1, | |
'batchrequesttransfer.php' => 1, | |
'batchinterface.php' => 1, | |
'batchdivisorinterface.php' => 1, | |
'batchcommandtransfer.php' => 1, | |
'batchclosuretransfer.php' => 1, | |
'batchclosuredivisor.php' => 1, | |
'batchbuilder.php' => 1, | |
'cachingentitybody.php' => 1, | |
'entitybodyinterface.php' => 1, | |
'dson.php' => 1, | |
'messageformatter.php' => 1, | |
'callbackbackoffstrategy.php' => 1, | |
'backoffstrategyinterface.php' => 1, | |
'backoffplugin.php' => 1, | |
'backofflogger.php' => 1, | |
'abstracterrorcodebackoffstrategy.php' => 1, | |
'abstractbackoffstrategy.php' => 1, | |
'asyncplugin.php' => 1, | |
'parserregistry.php' => 1, | |
'zf2logadapter.php' => 1, | |
'zf1logadapter.php' => 1, | |
'psrlogadapter.php' => 1, | |
'monologlogadapter.php' => 1, | |
'logadapterinterface.php' => 1, | |
'ioemittingentitybody.php' => 1, | |
'closurelogadapter.php' => 1, | |
'arraylogadapter.php' => 1, | |
'abstractlogadapter.php' => 1, | |
'methodproxyiterator.php' => 1, | |
'filteriterator.php' => 1, | |
'chunkediterator.php' => 1, | |
'appenditerator.php' => 1, | |
'precomputedinflector.php' => 1, | |
'memoizinginflector.php' => 1, | |
'inflectorinterface.php' => 1, | |
'staticclient.php' => 1, | |
'redirectplugin.php' => 1, | |
'readlimitentitybody.php' => 1, | |
'abstractbatchdecorator.php' => 1, | |
'guilroprotectionproxybundle.php' => 1, | |
'binstring.example2.php' => 1, | |
'emptytimespan.php' => 1, | |
'grossumcontactbundle.php' => 1, | |
'basejob.php' => 1, | |
'facebookserviceprovider.php' => 1, | |
'dgjiraauthbundle.php' => 1, | |
'grifisdoctrinetableprefixbundle.php' => 1, | |
'greibitpaneladminbundle.php' => 1, | |
'phpserial.php' => 1, | |
'tex2pnghandler.php' => 1, | |
'gregwartex2pngbundle.php' => 1, | |
'slidey.php' => 1, | |
'timespan.php' => 1, | |
'planning.php' => 1, | |
'phpnet.php' => 1, | |
'grossumcustomentitymanagerbundle.php' => 1, | |
'license.htm' => 1, | |
'gnuplot.php' => 1, | |
'gregwarcaptchabundle.php' => 1, | |
'csvfile.php' => 1, | |
'tasks.properties' => 1, | |
'joomla' => 1, | |
'icontaineraware.php' => 1, | |
'composer-screenshot.png' => 1, | |
'documentation.css' => 1, | |
'relativepath.example1.php' => 1, | |
'opencmd.bat' => 1, | |
'binstringstatic.php' => 1, | |
'binstring.php' => 1, | |
'grossumcorebundle.php' => 1, | |
'grossumextendedformtypebundle.php' => 1, | |
'phpcbf.phar' => 1, | |
'blockrepository.php' => 1, | |
'generator.js' => 1, | |
'gthmrdfbundle.php' => 1, | |
'_inuit.scss' => 1, | |
'_defaults.scss' => 1, | |
'gtacoolinuitcssbundle.php' => 1, | |
'gtacoolhtml5inuitcssboilerplatebundle.php' => 1, | |
'version.sh' => 1, | |
'userrepository.php' => 1, | |
'repositoryexception.php' => 1, | |
'optionrepository.php' => 1, | |
'langrepository.php' => 1, | |
'contentrepository.php' => 1, | |
'routetranslation.php' => 1, | |
'grossumfeedbackbundle.php' => 1, | |
'optioncategory.php' => 1, | |
'contenttranslation.php' => 1, | |
'blocktype.php' => 1, | |
'blocktranslation.php' => 1, | |
'basetree.php' => 1, | |
'laravel_helpers.php' => 1, | |
'optionsservice.php' => 1, | |
'cmsseeder.php' => 1, | |
'blockhandler.php' => 1, | |
'blockfinder.php' => 1, | |
'abstractserviceprovider.php' => 1, | |
'baseuservalidator.php' => 1, | |
'grossumnewsbundle.php' => 1, | |
'mqtranslate_widget.php' => 1, | |
'mqtranslate_utils.php' => 1, | |
'curlbackoffstrategy.php' => 1, | |
'inline_entity.module' => 1, | |
'levels.php' => 1, | |
'infos.php' => 1, | |
'block_xp.php' => 1, | |
'csv2md' => 1, | |
'loguser.php' => 1, | |
'grafizzi.dox' => 1, | |
'web_install.sh' => 1, | |
'code-mockup-dataprovider.php' => 1, | |
'build-release.ps1' => 1, | |
'fact-finder-php-library.sublime-project' => 1, | |
'eyjarestdemobundle.php' => 1, | |
'eyjarestbundle.php' => 1, | |
'inline_entity.info.yml' => 1, | |
'archinspec.yml.dist' => 1, | |
'wsdl_generator.info.yml' => 1, | |
'sql_users.php' => 1, | |
'secure.php' => 1, | |
'php-components.php' => 1, | |
'rfc-version-2-0' => 1, | |
'exeumiscbundle.php' => 1, | |
'exeuapaiiobundle.php' => 1, | |
'exeuamazonecsbundle.php' => 1, | |
'savewithaudittrailbehavior.php' => 1, | |
'searchresult.php' => 1, | |
'quickaddress.php' => 1, | |
'qaqueryheader.php' => 1, | |
'visuals.php' => 1, | |
'.editorconf' => 1, | |
'qaauthentication.php' => 1, | |
'lcnimageuploaderbundle.php' => 1, | |
'fastspring.php' => 1, | |
'some-file' => 1, | |
'fastfeedbundle.php' => 1, | |
'key.pem' => 1, | |
'sparkleshare' => 1, | |
'objectevent.php' => 1, | |
'injectdispatcher.php' => 1, | |
'.sparkleshare' => 1, | |
'.scrutnizer.yml' => 1, | |
'apache_license' => 1, | |
'lcnweatherforecastbundle.php' => 1, | |
'lcntemplateblockbundle.php' => 1, | |
'submitresponse.php' => 1, | |
'laskgen' => 1, | |
'matchresponse.php' => 1, | |
'matchquery.php' => 1, | |
'flagresponse.php' => 1, | |
'factualsubmittor.php' => 1, | |
'factualrectangle.php' => 1, | |
'factualpost.php' => 1, | |
'factualpoint.php' => 1, | |
'factualflagger.php' => 1, | |
'factualclearor.php' => 1, | |
'factualboost.php' => 1, | |
'diffsresponse.php' => 1, | |
'diffsquery.php' => 1, | |
'bareresponse.php' => 1, | |
'qagetdata.php' => 1, | |
'promptset.php' => 1, | |
'filedb.inc' => 1, | |
'eriktrapmanreleasecommandbundle.php' => 1, | |
'userguide' => 1, | |
'exception' => 1, | |
'gliald' => 1, | |
'complex' => 1, | |
'003-glial.conf' => 1, | |
'sf_logo.png' => 1, | |
'uitinytblwidget.php' => 1, | |
'jfixedheadertablewidget.php' => 1, | |
'tray-php.sublime-project' => 1, | |
'escape' => 1, | |
'ldap_auth.php' => 1, | |
'eriktrapmanwebcommandbundle.php' => 1, | |
'cycleargamebundle.php' => 1, | |
'bootstrapper.example.php' => 1, | |
'eriktrapmancqrankingparserbundle.php' => 1, | |
'ttl.php' => 1, | |
'rename.php' => 1, | |
'module_testcase.php' => 1, | |
'helpermodule.php' => 1, | |
'model.yml' => 1, | |
'license.skeleton' => 1, | |
'get_version.php' => 1, | |
'get_filetags.php' => 1, | |
'get_composer.php' => 1, | |
'dependency.php' => 1, | |
'precommit.php' => 1, | |
'createsymlinks.php' => 1, | |
'assegai' => 1, | |
'conf.example.php' => 1, | |
'picklist.php' => 1, | |
'evercodetwigextensionsbundle.php' => 1, | |
'formattedaddress.php' => 1, | |
'bulksearchresult.php' => 1, | |
'bulksearchitem.php' => 1, | |
'exercisehtmlpurifierbundle.php' => 1, | |
'exsterminalbundle.php' => 1, | |
'exserrorbundle.php' => 1, | |
'ex3vformerrorsbundle.php' => 1, | |
'diagnostics' => 1, | |
'slickasset.php' => 1, | |
'emsettingsbundle.php' => 1, | |
'emoauthbundle.php' => 1, | |
'evercodefaqbundle.php' => 1, | |
'evercodepagebundle.php' => 1, | |
'objectomatic.php' => 1, | |
'evercodehipchatmonologbundle.php' => 1, | |
'evercodeblogbundle.php' => 1, | |
'evercodebannerbundle.php' => 1, | |
'ekironmqbundle.php' => 1, | |
'classcountcollector.php' => 1, | |
'uml-generator-php.yml.dist' => 1, | |
'.uml-generator-php.yml' => 1, | |
'upgrade_auto.sh' => 1, | |
'php_upgrade_to_5.5.sh' => 1, | |
'create_certificat_nginx.sh' => 1, | |
'base.sh' => 1, | |
'evelabsphealngbundle.php' => 1, | |
'edblogbundle.php' => 1, | |
'filedb' => 1, | |
'faultmem.php' => 1, | |
'mqtranslate_services.php' => 1, | |
'hgtanhellodoctrinemongodbbundle.php' => 1, | |
'.blackfire.travis.ini.enc' => 1, | |
'benchmark.sh' => 1, | |
'cookbook-fixers' => 1, | |
'hgtanhellosalesforcebundle.php' => 1, | |
'hgtanhellorabbitmqbundle.php' => 1, | |
'hgtanhellojirarestapibundle.php' => 1, | |
'hgtanhellograylogbundle.php' => 1, | |
'fobhellouserbundle.php' => 1, | |
'fobhellorestbundle.php' => 1, | |
'fobhellooauthserverbundle.php' => 1, | |
'fobhellocommentbundle.php' => 1, | |
'fobhelloelasticabundle.php' => 1, | |
'foacronbundle.php' => 1, | |
'fosadvancedencoderbundle.php' => 1, | |
'acf-sync.php' => 1, | |
'scmsasset.php' => 1, | |
'sblogasset.php' => 1, | |
'categoriesasset.php' => 1, | |
'commonasset.php' => 1, | |
'oistwebauthbundle.php' => 1, | |
'fortibbcodebundle.php' => 1, | |
'square.php' => 1, | |
'formalibreworkspacesubscriptionbundle.php' => 1, | |
'formalibresupportbundle.php' => 1, | |
'formalibrereservationbundle.php' => 1, | |
'formalibrereadspeakerbundle.php' => 1, | |
'formalibrepresencebundle.php' => 1, | |
'sismo' => 1, | |
'foshttpcachebundle.php' => 1, | |
'formalibrepiabundle.php' => 1, | |
'dynamicloaderbar.php' => 1, | |
'mqtranslate_javascript.php' => 1, | |
'mqtranslate_hooks.php' => 1, | |
'mqtranslate_core.php' => 1, | |
'mqtranslate_configuration.php' => 1, | |
'mqtranslate.php' => 1, | |
'class-gf-bitrix24.php' => 1, | |
'bitrix24.php' => 1, | |
'validfluent.php' => 1, | |
'frojd-segments.php' => 1, | |
'frojd-image-menu.php' => 1, | |
'loader.latte' => 1, | |
'dynamicloaderexception.php' => 1, | |
'messengerplatform.php' => 1, | |
'locallang_csh_ttaddress.xml' => 1, | |
'victoirewidgetsocialpagebundle.php' => 1, | |
'victoirewidgetsearchbundle.php' => 1, | |
'victoirewidgetprogressbundle.php' => 1, | |
'victoirewidgetmailchimpnewsletterbundle.php' => 1, | |
'victoirewidgetloginbundle.php' => 1, | |
'victoirewidgetlocaleswitcherbundle.php' => 1, | |
'victoirewidgetdatebundle.php' => 1, | |
'victoirewidgetcookielawbundle.php' => 1, | |
'victoirewidgetconnectbundle.php' => 1, | |
'victoirewidgetcardbundle.php' => 1, | |
'victoirewidgetaggregateratingbundle.php' => 1, | |
'victoirewidgetpicturecomparatorbundle.php' => 1, | |
'locallang_tca.xml' => 1, | |
'formalibreplatformadministrationbundle.php' => 1, | |
'formalibreofficeconnectbundle.php' => 1, | |
'faultmemasync.php' => 1, | |
'mpjaxblock.php' => 1, | |
'radiusstrategy.php' => 1, | |
'radiusclient.php' => 1, | |
'ldapstrategy.php' => 1, | |
'flagship-library.php' => 1, | |
'flagbitmetricsbundle.php' => 1, | |
'flagbitcurrencybundle.php' => 1, | |
'creating_commands' => 1, | |
'runnercomponent.php' => 1, | |
'inlinerunner.php' => 1, | |
'baserunner.php' => 1, | |
'readmoreasset.php' => 1, | |
'readmore.php' => 1, | |
'footableasset.php' => 1, | |
'newplugin.php' => 1, | |
'flagsasset.php' => 1, | |
'calendarasset.php' => 1, | |
'devbridge-autocomplete.jquery.json' => 1, | |
'fz_log.php' => 1, | |
'fz_limonade.php' => 1, | |
'fz_helper_view.php' => 1, | |
'fz_config.php' => 1, | |
'multilanguage.php' => 1, | |
'fievelajaxtablebundle.php' => 1, | |
'zabbixcomponent.php' => 1, | |
'providers.json' => 1, | |
'feftaddressbundle.php' => 1, | |
'featurebrowser.yml.dist' => 1, | |
'flexmodelbundle.php' => 1, | |
'broken-links.php' => 1, | |
'formalibrejobbundle.php' => 1, | |
'product.tpl' => 1, | |
'formalibrebulletinbundle.php' => 1, | |
'forcec' => 1, | |
'plugin_packages' => 1, | |
'hooks_events_results' => 1, | |
'wordpresscomposertoolsplugin.php' => 1, | |
'flyingstructbundle.php' => 1, | |
'bujsonresponsebundle.php' => 1, | |
'buextraparamconverterbundle.php' => 1, | |
'vacancy.tpl' => 1, | |
'text.tpl' => 1, | |
'slider.tpl' => 1, | |
'project.tpl' => 1, | |
'person.tpl' => 1, | |
'plugin-cms.php' => 1, | |
'person-tiles.tpl' => 1, | |
'news.tpl' => 1, | |
'menu.tpl' => 1, | |
'featured_list.tpl' => 1, | |
'breadcrumbs.tpl' => 1, | |
'banner.tpl' => 1, | |
'fieldentityinterface.php' => 1, | |
'.styleci.yaml' => 1, | |
'.codeclimat.yaml' => 1, | |
'flubbigbangbundle.php' => 1, | |
'fsbproxybundle.php' => 1, | |
'requirementchecker.php' => 1, | |
'popular-posts.php' => 1, | |
'constantbackoffstrategy.php' => 1, | |
'exponentialbackoffstrategy.php' => 1, | |
'barcodefactory.php' => 1, | |
'imaticimportbundle.php' => 1, | |
'mysql-transfer.sh' => 1, | |
'mysql-restore.sh' => 1, | |
'mysql-remote-restore.sh' => 1, | |
'mysql-remote-backup.sh' => 1, | |
'mysql-csv-to-sql.php' => 1, | |
'mysql-backup.sh' => 1, | |
'api_calls.php' => 1, | |
'api_callback.php' => 1, | |
'testpdf.pdf' => 1, | |
'travis.config.ini' => 1, | |
'passport.php' => 1, | |
'importoption.php' => 1, | |
'anchovycurlbundle.php' => 1, | |
'icms_version.php' => 1, | |
'fr_fr.theme.frontend_magento_luma.csv' => 1, | |
'fr_fr.theme.frontend_magento_blank.csv' => 1, | |
'fr_fr.module.magento_wishlist.csv' => 1, | |
'fr_fr.module.magento_widget.csv' => 1, | |
'fr_fr.module.magento_weee.csv' => 1, | |
'fr_fr.module.magento_webapisecurity.csv' => 1, | |
'fr_fr.module.magento_webapi.csv' => 1, | |
'fr_fr.module.magento_variable.csv' => 1, | |
'fr_fr.module.magento_usps.csv' => 1, | |
'fr_fr.module.magento_user.csv' => 1, | |
'fr_fr.module.magento_urlrewrite.csv' => 1, | |
'fr_fr.module.magento_ups.csv' => 1, | |
'mysql-tunnel.sh' => 1, | |
'module.css' => 1, | |
'fr_fr.module.magento_translation.csv' => 1, | |
'ircategorybundle.php' => 1, | |
'irzonebundle.php' => 1, | |
'irproductevents.php' => 1, | |
'irproductbundle.php' => 1, | |
'irorderevents.php' => 1, | |
'irorderbundle.php' => 1, | |
'irnewsevents.php' => 1, | |
'irnewsbundle.php' => 1, | |
'ircustomerevents.php' => 1, | |
'ircustomerbundle.php' => 1, | |
'ircontactevents.php' => 1, | |
'ircontactbundle.php' => 1, | |
'ircategoryevents.php' => 1, | |
'ircartevents.php' => 1, | |
'module_rtl.css' => 1, | |
'ircartbundle.php' => 1, | |
'iraddressbundle.php' => 1, | |
'infinitedevelopersweatherwidgetbundle.php' => 1, | |
'infinitedevelopersbase64bundle.php' => 1, | |
'infernosquadcalculationbundle.php' => 1, | |
'migrationawaremodule.php' => 1, | |
'migrationawareinterface.php' => 1, | |
'bakery' => 1, | |
'gopher' => 1, | |
'logsafecheddargetterbundle.php' => 1, | |
'incenteevtranslationcheckerbundle.php' => 1, | |
'inpostvalidationbundle.php' => 1, | |
'dashboard.png' => 1, | |
'fr_fr.module.magento_ui.csv' => 1, | |
'fr_fr.module.magento_theme.csv' => 1, | |
'ingewikkeldwrapperbundle.php' => 1, | |
'fr_fr.module.magento_downloadable.csv' => 1, | |
'fr_fr.module.magento_indexer.csv' => 1, | |
'fr_fr.module.magento_importexport.csv' => 1, | |
'fr_fr.module.magento_groupedproduct.csv' => 1, | |
'fr_fr.module.magento_googleoptimizer.csv' => 1, | |
'fr_fr.module.magento_googleanalytics.csv' => 1, | |
'fr_fr.module.magento_googleadwords.csv' => 1, | |
'fr_fr.module.magento_giftmessage.csv' => 1, | |
'fr_fr.module.magento_fedex.csv' => 1, | |
'fr_fr.module.magento_encryptionkey.csv' => 1, | |
'fr_fr.module.magento_email.csv' => 1, | |
'fr_fr.module.magento_eav.csv' => 1, | |
'fr_fr.module.magento_downloadableimportexport.csv' => 1, | |
'fr_fr.module.magento_directory.csv' => 1, | |
'fr_fr.module.magento_layerednavigation.csv' => 1, | |
'fr_fr.module.magento_dhl.csv' => 1, | |
'fr_fr.module.magento_developer.csv' => 1, | |
'fr_fr.module.magento_deploy.csv' => 1, | |
'fr_fr.module.magento_customerimportexport.csv' => 1, | |
'fr_fr.module.magento_customer.csv' => 1, | |
'fr_fr.module.magento_currencysymbol.csv' => 1, | |
'fr_fr.module.magento_cron.csv' => 1, | |
'fr_fr.module.magento_cookie.csv' => 1, | |
'fr_fr.module.magento_contact.csv' => 1, | |
'fr_fr.module.magento_configurableproduct.csv' => 1, | |
'fr_fr.module.magento_config.csv' => 1, | |
'fr_fr.module.magento_cms.csv' => 1, | |
'fr_fr.module.magento_checkoutagreements.csv' => 1, | |
'fr_fr.module.magento_integration.csv' => 1, | |
'fr_fr.module.magento_marketplace.csv' => 1, | |
'fr_fr.module.magento_taximportexport.csv' => 1, | |
'fr_fr.module.magento_review.csv' => 1, | |
'fr_fr.module.magento_tax.csv' => 1, | |
'fr_fr.module.magento_swatches.csv' => 1, | |
'fr_fr.module.magento_store.csv' => 1, | |
'fr_fr.module.magento_sitemap.csv' => 1, | |
'fr_fr.module.magento_shipping.csv' => 1, | |
'fr_fr.module.magento_sendfriend.csv' => 1, | |
'fr_fr.module.magento_search.csv' => 1, | |
'fr_fr.module.magento_salessequence.csv' => 1, | |
'fr_fr.module.magento_salesrule.csv' => 1, | |
'fr_fr.module.magento_sales.csv' => 1, | |
'fr_fr.module.magento_rule.csv' => 1, | |
'fr_fr.module.magento_rss.csv' => 1, | |
'fr_fr.module.magento_reports.csv' => 1, | |
'fr_fr.module.magento_mediastorage.csv' => 1, | |
'fr_fr.module.magento_quote.csv' => 1, | |
'fr_fr.module.magento_productvideo.csv' => 1, | |
'fr_fr.module.magento_productalert.csv' => 1, | |
'fr_fr.module.magento_persistent.csv' => 1, | |
'fr_fr.module.magento_paypal.csv' => 1, | |
'fr_fr.module.magento_payment.csv' => 1, | |
'fr_fr.module.magento_pagecache.csv' => 1, | |
'fr_fr.module.magento_offlineshipping.csv' => 1, | |
'fr_fr.module.magento_offlinepayments.csv' => 1, | |
'fr_fr.module.magento_newsletter.csv' => 1, | |
'fr_fr.module.magento_newrelicreporting.csv' => 1, | |
'fr_fr.module.magento_multishipping.csv' => 1, | |
'fr_fr.module.magento_msrp.csv' => 1, | |
'irzoneevents.php' => 1, | |
'build.clip.php' => 1, | |
'fr_fr.module.magento_catalogwidget.csv' => 1, | |
'jcookieasset.php' => 1, | |
'ibtablemanagerbundle.php' => 1, | |
'rbacmodule.php' => 1, | |
'redisman.php' => 1, | |
'messages_conf_redisman' => 1, | |
'messages_conf_app' => 1, | |
'jgallerywidget.php' => 1, | |
'jgalleryasset.php' => 1, | |
'iconpicker.php' => 1, | |
'timelineitem.php' => 1, | |
'timeline' => 1, | |
'tile.php' => 1, | |
'smallbox.php' => 1, | |
'flashalerts.php' => 1, | |
'socialstatsbundle.php' => 1, | |
'extadminlteasset.php' => 1, | |
'exampletimelineitem.php' => 1, | |
'insightly.php' => 1, | |
'inoritwitterappbundle.php' => 1, | |
'innovataxonomybundle.php' => 1, | |
'innovasupportbundle.php' => 1, | |
'innovapathbundle.php' => 1, | |
'innovanondigitalresourcebundle.php' => 1, | |
'innovametronomebundle.php' => 1, | |
'innovamediaresourcebundle.php' => 1, | |
'innovalearningpathbundle.php' => 1, | |
'innovagitterbundle.php' => 1, | |
'innovaforummultimodalbundle.php' => 1, | |
'smartcodebundle.php' => 1, | |
'itcollectorbundle.php' => 1, | |
'innovafakerbundle.php' => 1, | |
'phpunit-wordpress-browser.xml.dist' => 1, | |
'docodile' => 1, | |
'arc2jsonldconverter.php' => 1, | |
'redistarget.php' => 1, | |
'tvmazeincludes.php' => 1, | |
'fatcowiconsbundle.php' => 1, | |
'testastring.php' => 1, | |
'jorgehernanodmrelationshipviewbundle.php' => 1, | |
'wp-l10n-validator.php' => 1, | |
'ignores-cache-generator.php' => 1, | |
'wp-http-testcase.php' => 1, | |
'pimple.json' => 1, | |
'phpunit-wordpress.xml.dist' => 1, | |
'phpunit-joomla.xml.dist' => 1, | |
'involvaitadminltebundle.php' => 1, | |
'phpunit-joomla-browser.xml.dist' => 1, | |
'jaiuserbundle.php' => 1, | |
'jaicontactbundle.php' => 1, | |
'configstore.php' => 1, | |
'easylang.php' => 1, | |
'jmosecommandschedulerbundle.php' => 1, | |
'parsleybundle.php' => 1, | |
'work' => 1, | |
'iteoformfilterbundle.php' => 1, | |
'irvyneembedlybundle.php' => 1, | |
'involvaitjqueryuibundle.php' => 1, | |
'involvaitfoundationbundle.php' => 1, | |
'involvaitfontawesomebundle.php' => 1, | |
'innovafavoritebundle.php' => 1, | |
'description-pak' => 1, | |
'crawlerinterface.php' => 1, | |
'innmindneo4jbundle.php' => 1, | |
'nullquery.php' => 1, | |
'nullpath.php' => 1, | |
'nullfragment.php' => 1, | |
'fragmentinterface.php' => 1, | |
'authorityinterface.php' => 1, | |
'authority.php' => 1, | |
'notinterface.php' => 1, | |
'compositeinterface.php' => 1, | |
'routeloader.php' => 1, | |
'innmindrestbundle.php' => 1, | |
'reflectionobject.php' => 1, | |
'instanciatorinterface.php' => 1, | |
'typedcollectioninterface.php' => 1, | |
'pathinterface.php' => 1, | |
'typedcollection.php' => 1, | |
'symbol.php' => 1, | |
'stringableinterface.php' => 1, | |
'stringprimitive.php' => 1, | |
'sizeableinterface.php' => 1, | |
'setinterface.php' => 1, | |
'sequenceinterface.php' => 1, | |
'primitiveinterface.php' => 1, | |
'pair.php' => 1, | |
'nameinterface.php' => 1, | |
'mediatypeinterface.php' => 1, | |
'lazyadapterinterface.php' => 1, | |
'domcrawlerfactory.php' => 1, | |
'nullscheme.php' => 1, | |
'clauseinterface.php' => 1, | |
'innovacollecticielbundle.php' => 1, | |
'formats.php' => 1, | |
'innovaaudiorecorderbundle.php' => 1, | |
'innovaangularuitreebundle.php' => 1, | |
'innovaangularuitranslationbundle.php' => 1, | |
'innovaangularuitinymcebundle.php' => 1, | |
'innovaangularuisortablebundle.php' => 1, | |
'innovaangularuiresourcepickerbundle.php' => 1, | |
'innovaangularuipageslidebundle.php' => 1, | |
'innovaangularjsbundle.php' => 1, | |
'innovaactivitybundle.php' => 1, | |
'urlresolver.php' => 1, | |
'storages.php' => 1, | |
'resourcebuilder.php' => 1, | |
'entitybuilder.php' => 1, | |
'cypher.php' => 1, | |
'definitioncompiler.php' => 1, | |
'compilerpassinterface.php' => 1, | |
'repositoryfactory.php' => 1, | |
'persisterinterface.php' => 1, | |
'metadatas.php' => 1, | |
'metadatafactoryinterface.php' => 1, | |
'metadatabuilder.php' => 1, | |
'managerfactory.php' => 1, | |
'identitymatch.php' => 1, | |
'identityinterface.php' => 1, | |
'entityfactoryinterface.php' => 1, | |
'transactions.php' => 1, | |
'resultinterface.php' => 1, | |
'fr_fr.module.magento_checkout.csv' => 1, | |
'fr_fr.module.magento_catalogurlrewrite.csv' => 1, | |
'httpbackoffstrategy.php' => 1, | |
'happyrnormaldistributionbundle.php' => 1, | |
'ajaxcreatetable.php' => 1, | |
'template.html.twig' => 1, | |
'listitems.js' => 1, | |
'headoomediasocialapibundle.php' => 1, | |
'headoomailjetbundle.php' => 1, | |
'headooecommercebundle.php' => 1, | |
'haverkamp87userbundle.php' => 1, | |
'haverkamp87corebundle.php' => 1, | |
'authentication_2016-04-19.sql' => 1, | |
'happyruserprojectbundle.php' => 1, | |
'happyrstompbundle.php' => 1, | |
'happyrslugifybundle.php' => 1, | |
'happyrmq2phpbundle.php' => 1, | |
'ajaximportfile.php' => 1, | |
'happyrlocationbundle.php' => 1, | |
'happyrlinkedinbundle.php' => 1, | |
'identifierinterface.php' => 1, | |
'happyrmailerbundle.php' => 1, | |
'happyrgooglesiteauthenticatorbundle.php' => 1, | |
'happyrgooglegeocoderbundle.php' => 1, | |
'happyrgoogleapibundle.php' => 1, | |
'happyrgoogleanalyticsbundle.php' => 1, | |
'happyrexcerptbundle.php' => 1, | |
'happyreventtrackerbundle.php' => 1, | |
'happyrcloudflarebundle.php' => 1, | |
'happyrbirthdaybundle.php' => 1, | |
'ajaxfulltext.php' => 1, | |
'ajaxquery.php' => 1, | |
'travisconfigs.tar.enc' => 1, | |
'fakeprocessbuilder.php' => 1, | |
'prepper-stop.sh' => 1, | |
'prepper-stop.php' => 1, | |
'prepper-stop.bat' => 1, | |
'prepper-start.sh' => 1, | |
'prepper-start.php' => 1, | |
'prepper-start.bat' => 1, | |
'testresult' => 1, | |
'.gitignor' => 1, | |
'tokenize' => 1, | |
'hipi18nroutingbundle.php' => 1, | |
'htcnowtaxibundle.php' => 1, | |
'.twgit' => 1, | |
'fakeprocess.php' => 1, | |
'ajaxsavecolumnedit.php' => 1, | |
'hexmediauserbundle.php' => 1, | |
'hexmediatimeformatterbundle.php' => 1, | |
'hexmediaknockoutbundle.php' => 1, | |
'hexmediaknockoutbootstrapbundle.php' => 1, | |
'hexmediacontentbundle.php' => 1, | |
'hexmediaasseticbundle.php' => 1, | |
'hexmediaadministratorbundle.php' => 1, | |
'arduinoclient.php' => 1, | |
'echofor.php' => 1, | |
'editcolumn.php' => 1, | |
'dboverview.php' => 1, | |
'ajaxsaveuseredit.php' => 1, | |
'ajaxsaveedit.php' => 1, | |
'hanfreysparkpostbundle.php' => 1, | |
'hdconfig.php' => 1, | |
'admin_index.php' => 1, | |
'cookieplugin.php' => 1, | |
'phpstreamrequestfactory.php' => 1, | |
'configloaderinterface.php' => 1, | |
'cachingconfigloader.php' => 1, | |
'abstractconfigloader.php' => 1, | |
'oauthplugin.php' => 1, | |
'md5validatorplugin.php' => 1, | |
'commandcontentmd5plugin.php' => 1, | |
'logplugin.php' => 1, | |
'historyplugin.php' => 1, | |
'errorresponseplugin.php' => 1, | |
'errorresponseexceptioninterface.php' => 1, | |
'curlauthplugin.php' => 1, | |
'skiprevalidation.php' => 1, | |
'multisite' => 1, | |
'revalidationinterface.php' => 1, | |
'denyrevalidation.php' => 1, | |
'defaultrevalidation.php' => 1, | |
'defaultcancachestrategy.php' => 1, | |
'defaultcachestorage.php' => 1, | |
'defaultcachekeyprovider.php' => 1, | |
'cancachestrategyinterface.php' => 1, | |
'callbackcancachestrategy.php' => 1, | |
'cachestorageinterface.php' => 1, | |
'cachekeyproviderinterface.php' => 1, | |
'truncatedbackoffstrategy.php' => 1, | |
'reasonphrasebackoffstrategy.php' => 1, | |
'linearbackoffstrategy.php' => 1, | |
'streamrequestfactoryinterface.php' => 1, | |
'class-h1-auto-image-download-admin.php' => 1, | |
'hd4helper.js' => 1, | |
'aplikasidakwah.sql' => 1, | |
'hdstore.php' => 1, | |
'hdextra.php' => 1, | |
'hddevice.php' => 1, | |
'hdcache.php' => 1, | |
'hdbase.php' => 1, | |
'hd4.php' => 1, | |
'halbehatwizardbundle.php' => 1, | |
'halbehattoolsbundle.php' => 1, | |
'hobtokenbundle.php' => 1, | |
'commonbundle.php' => 1, | |
'hobapibundle.php' => 1, | |
'run.py' => 1, | |
'espendzenddbbundle.php' => 1, | |
'class-h1-auto-image-download.php' => 1, | |
'hadesarchitectnotificationbundle.php' => 1, | |
'jsonschemabundle.php' => 1, | |
'ssql.php' => 1, | |
'basiq.php' => 1, | |
'infogen.php' => 1, | |
'app.css' => 1, | |
'listtable.twig' => 1, | |
'dbtools.php' => 1, | |
'dockerfile.phpspec' => 1, | |
'dockerfile.composer' => 1, | |
'supervisorasset.php' => 1, | |
'h1-auto-image-download.php' => 1, | |
'h1-auto-image-download.js' => 1, | |
'hotaru.php' => 1, | |
'htaccess_default' => 1, | |
'fr_fr.module.magento_catalogsearch.csv' => 1, | |
'phantom.js' => 1, | |
'cartpositionbehaviour.php' => 1, | |
'cartposition.php' => 1, | |
'sharebar.php' => 1, | |
'ipinfodb.php' => 1, | |
'currencyconverterinterface.php' => 1, | |
'currencyconverter.php' => 1, | |
'countrytocurrency.php' => 1, | |
'jabberjaxlbundle.php' => 1, | |
'ikimeapagebundle.php' => 1, | |
'ikimeackeditorbundle.php' => 1, | |
'imtdatagridbundle.php' => 1, | |
'planet' => 1, | |
'ifgmaclinterfacebundle.php' => 1, | |
'fr_fr.component.magento2_base.csv' => 1, | |
'id4vmenubundle.php' => 1, | |
'stikairinitbundle.php' => 1, | |
'icode4foodjqueryuibundle.php' => 1, | |
'packagemanager.png' => 1, | |
'itlizedzurbfoundationbundle.php' => 1, | |
'itlizedsocialbundle.php' => 1, | |
'pagerduty.php' => 1, | |
'requestreader.php' => 1, | |
'rsmartload.php' => 1, | |
'rsmartloadhelper.php' => 1, | |
'rsmartloadclientscript.php' => 1, | |
'seleniumtestcasedoc.php' => 1, | |
'iq2iprestashopwebservicebundle.php' => 1, | |
'sharebutton.php' => 1, | |
'fr_fr.custom.imaginaerum.csv' => 1, | |
'extdirectaction.php' => 1, | |
'fr_fr.module.magento_adminnotification.csv' => 1, | |
'fr_fr.module.magento_catalogrule.csv' => 1, | |
'fr_fr.module.magento_cataloginventory.csv' => 1, | |
'fr_fr.module.magento_catalogimportexport.csv' => 1, | |
'fr_fr.module.magento_catalog.csv' => 1, | |
'fr_fr.module.magento_captcha.csv' => 1, | |
'fr_fr.module.magento_bundle.csv' => 1, | |
'fr_fr.module.magento_braintree.csv' => 1, | |
'fr_fr.module.magento_backup.csv' => 1, | |
'fr_fr.module.magento_backend.csv' => 1, | |
'fr_fr.module.magento_authorizenet.csv' => 1, | |
'fr_fr.module.magento_authorization.csv' => 1, | |
'fr_fr.module.magento_advancedpricingimportexport.csv' => 1, | |
'fr_fr.lib.lib_web_mage_validation_validation_js.csv' => 1, | |
'fr_fr.deprecated.imaginaerum.after.2.0.0.csv' => 1, | |
'fr_fr.lib.lib_web_mage_validation_js.csv' => 1, | |
'fr_fr.lib.lib_web_mage_translate_inline_vde_js.csv' => 1, | |
'fr_fr.lib.lib_web_mage_translate_inline_js.csv' => 1, | |
'fr_fr.lib.lib_web_mage_menu_js.csv' => 1, | |
'fr_fr.lib.lib_web_mage_loader_old_js.csv' => 1, | |
'fr_fr.lib.lib_web_mage_loader_js.csv' => 1, | |
'fr_fr.lib.lib_web_mage_dropdown_js.csv' => 1, | |
'fr_fr.lib.lib_web_mage_decorate_js.csv' => 1, | |
'fr_fr.lib.lib_web_mage_backend_suggest_js.csv' => 1, | |
'fr_fr.lib.lib_web_mage_adminhtml_wysiwyg_widget_js.csv' => 1, | |
'fr_fr.lib.lib_web_mage_adminhtml_backup_js.csv' => 1, | |
'fr_fr.deprecated.imaginaerum.after.2.0.3.csv' => 1, | |
'fr_fr.deprecated.imaginaerum.after.2.0.2.csv' => 1, | |
'extdirectmanager.php' => 1, | |
'process_settings.php' => 1, | |
'hotflofeaturetogglebundle.php' => 1, | |
'usecase' => 1, | |
'idcicontactformbundle.php' => 1, | |
'idcicolorschemebundle.php' => 1, | |
'idcicodegeneratorbundle.php' => 1, | |
'codegeneratormanager.php' => 1, | |
'awssesbundle.php' => 1, | |
'idciadmingeneratorbundle.php' => 1, | |
'patches.php' => 1, | |
'logging.services.yml' => 1, | |
'logging.module' => 1, | |
'logging.info' => 1, | |
'icansloggingbundle.php' => 1, | |
'hypolayoutbundle.php' => 1, | |
'frameworks' => 1, | |
'idciextraformbundle.php' => 1, | |
'debugging' => 1, | |
'mwbsexporterbundle.php' => 1, | |
'lazyguy' => 1, | |
'fuzzypeanut.php' => 1, | |
'ip2location.class.php' => 1, | |
'ip2location_products_catalog.pdf' => 1, | |
'htimelightcmsbundle.php' => 1, | |
'hsererouter.php' => 1, | |
'hoanotificationevents.php' => 1, | |
'hoanotificationbundle.php' => 1, | |
'dacorpextraevents.php' => 1, | |
'dacorpextrabundle.php' => 1, | |
'hotflosupervisorbundle.php' => 1, | |
'idciexporterbundle.php' => 1, | |
'idcifilterformbundle.php' => 1, | |
'logconfig.xml' => 1, | |
'fullcalendar.css' => 1, | |
'default.settings.php' => 1, | |
'tableexport.js' => 1, | |
'tableexport.jquery.json' => 1, | |
'jquery.base64.js' => 1, | |
'html2canvas.js' => 1, | |
'project-assembly.xml' => 1, | |
'lang-all.js' => 1, | |
'gcal.js' => 1, | |
'fullcalendar.print.css' => 1, | |
'fullcalendar.min.js' => 1, | |
'fullcalendar.min.css' => 1, | |
'fullcalendar.js' => 1, | |
'mailchimp-tools.php' => 1, | |
'idcigenealogybundle.php' => 1, | |
'mailchimp-functions.php' => 1, | |
'illdatacitedoibundle.php' => 1, | |
'qqq.t' => 1, | |
'.sams' => 1, | |
'idciwebpagescreenshotbundle.php' => 1, | |
'idcistepbundle.php' => 1, | |
'idcisimpleschedulebundle.php' => 1, | |
'idcisimplemetadatabundle.php' => 1, | |
'idcisimplemediabundle.php' => 1, | |
'idcipartnerbundle.php' => 1, | |
'idcinotificationbundle.php' => 1, | |
'idcinotificationapiclientbundle.php' => 1, | |
'idcinavbarbundle.php' => 1, | |
'gitlabmodel.php' => 1, | |
'modulebootstrap.php' => 1, | |
'baffordbowerbundle.php' => 1, | |
'examples_database.sql' => 1, | |
'intellijsetup' => 1, | |
'affirm.json' => 1, | |
'groovey.jpg' => 1, | |
'modulequery.php' => 1, | |
'moduleeventsinterface.php' => 1, | |
'objectmodelinterface.php' => 1, | |
'objectmodel.php' => 1, | |
'modelformasset.php' => 1, | |
'invokeevent.php' => 1, | |
'formnameevent.php' => 1, | |
'arraymodel.php' => 1, | |
'license-image-crud' => 1, | |
'grizzlylabuibundle.php' => 1, | |
'slack.hooks.php' => 1, | |
'grizzlylabmailerbundle.php' => 1, | |
'grinfeld_phpjsonable.phar' => 1, | |
'timingfield.scss' => 1, | |
'timingfield.min.js' => 1, | |
'timingfield.js' => 1, | |
'timingfield.css' => 1, | |
'grimmlinkalipaybundle.php' => 1, | |
'ymcomponent.php' => 1, | |
'awscomponent.php' => 1, | |
'gaspfile' => 1, | |
'gremosubscriptionbundle.php' => 1, | |
'gremopjaxbundle.php' => 1, | |
'grunchmercadopagobundle.php' => 1, | |
'prestashop' => 1, | |
'gremohighchartsbundle.php' => 1, | |
'.travis.phpunit.xml.dist' => 1, | |
'web-test.php' => 1, | |
'commanderbundle.php' => 1, | |
'ispconfig-cli.phar' => 1, | |
'ispconfig-cli.dist.yml' => 1, | |
'environment.example.ini' => 1, | |
'validaterule.php' => 1, | |
'dataspringdemobundle.php' => 1, | |
'guiyomhgoogleauthenticatorbundle.php' => 1, | |
'clips' => 1, | |
'.env-sample.php' => 1, | |
'udfangularjsbundle.php' => 1, | |
'undfangulartransbundle.php' => 1, | |
'kebhubapi.php' => 1, | |
'gtriasaddorselectbundle.php' => 1, | |
'donatopathwellbundle.php' => 1, | |
'ninjamutexbundle.php' => 1, | |
'donatogenerichwioauthproxybundle.php' => 1, | |
'donatohttpservicebundle.php' => 1, | |
'yamlconfig.php' => 1, | |
'arrayconfig.php' => 1, | |
'donatohttpproxiedbuzzbundle.php' => 1, | |
'plan_test.php' => 1, | |
'plan.php' => 1, | |
'sweethome' => 1, | |
'task.xml' => 1, | |
'hint.jpg' => 1, | |
'gtriastimepickerbundle.php' => 1, | |
'gremohmacauthenticationbundle.php' => 1, | |
'gremocaptchaformbundle.php' => 1, | |
'wellknowntext.php' => 1, | |
'cachetoolbundle.php' => 1, | |
'gpatonparsebundle.php' => 1, | |
'gpatonlabelconverterbundle.php' => 1, | |
'gotakkviewmodelbundle.php' => 1, | |
'doc.ini' => 1, | |
'wsdl.xml' => 1, | |
'contactemail.ss' => 1, | |
'extensions.yml' => 1, | |
'gordalinamangopaybundle.php' => 1, | |
'ifmbevents.php' => 1, | |
'gordalinaifmbbundle.php' => 1, | |
'gordalinamixpanelbundle.php' => 1, | |
'gordalinaeasypaybundle.php' => 1, | |
'phpunit.full.xml' => 1, | |
'demoportalbundle.php' => 1, | |
'youtubereporting.php' => 1, | |
'youtubeanalytics.php' => 1, | |
'webmasters.php' => 1, | |
'webfonts.php' => 1, | |
'vision.php' => 1, | |
'urlshortener.php' => 1, | |
'toolresults.php' => 1, | |
'taskqueue.php' => 1, | |
'tagmanager.php' => 1, | |
'storagetransfer.php' => 1, | |
'spectrum.php' => 1, | |
'siteverification.php' => 1, | |
'shoppingcontent.php' => 1, | |
'helloworld.hello.xml' => 1, | |
'vagrant-up' => 1, | |
'gremobuzzbundle.php' => 1, | |
'pkg_sales.xml' => 1, | |
'yiimandrill.php' => 1, | |
'scriptcore.php' => 1, | |
'design.jpg' => 1, | |
'install_demo.sh' => 1, | |
'install_demo.bat' => 1, | |
'.coverage.yml' => 1, | |
'.drush-lock-update' => 1, | |
'.eclipse-php-formatter.xml' => 1, | |
'phpari.php' => 1, | |
'phpari.ini' => 1, | |
'ixr_xmlrpc.php' => 1, | |
'pkg_translations.xml' => 1, | |
'pkg_articles.xml' => 1, | |
'markethubbundle.php' => 1, | |
'arrayvalidator.php' => 1, | |
'queries' => 1, | |
'polylang-slug.php' => 1, | |
'config.yml.default' => 1, | |
'ofreader' => 1, | |
'grachevenumbundle.php' => 1, | |
'grachevcronbundle.php' => 1, | |
'deploy.default.properties' => 1, | |
'inputreader.php' => 1, | |
'githelper.php' => 1, | |
'gitdeploy.php' => 1, | |
'ftphelper.php' => 1, | |
'sevendigitalbundle.php' => 1, | |
'effect.php' => 1, | |
'flush_privileges.php' => 1, | |
'resourceviews.php' => 1, | |
'imagemanagerexception.php' => 1, | |
'hackzillabarcodebundle.php' => 1, | |
'procergslogincidadaobadgesbundle.php' => 1, | |
'hacfirequestdumperbundle.php' => 1, | |
'phpfa' => 1, | |
'hacfiobjectbridgebundle.php' => 1, | |
'haberbergerredisstoragebundle.php' => 1, | |
'romenumber.php' => 1, | |
'nonobject.php' => 1, | |
'filetools.php' => 1, | |
'feast.php' => 1, | |
'arraystatic.php' => 1, | |
'pathnizer.php' => 1, | |
'period.php' => 1, | |
'hackzillaticketbundle.php' => 1, | |
'silpionloggerextrabundle.php' => 1, | |
'h4ccalicefixturesbundle.php' => 1, | |
'hnmessageformatbundle.php' => 1, | |
'widgets.html' => 1, | |
'typo.html' => 1, | |
'two-sidebars.html' => 1, | |
'tables.html' => 1, | |
'support.html' => 1, | |
'structure.html' => 1, | |
'simplechartsloadedviajson.zip' => 1, | |
'simplechart.zip' => 1, | |
'right-sidebar.html' => 1, | |
'hackzillafosuserbridgebundle.php' => 1, | |
'ticketevents.php' => 1, | |
'offline.html' => 1, | |
'phockito_globals.php' => 1, | |
'wikimate.php' => 1, | |
'pheditor.php' => 1, | |
'faraso.class.php' => 1, | |
'hamepub' => 1, | |
'roles.png' => 1, | |
'resources.png' => 1, | |
'permissions.png' => 1, | |
'hamaryuginhmeekrodbbundle.php' => 1, | |
'hamaryuginhgoogleanalyticsbundle.php' => 1, | |
'littlesnapper.php' => 1, | |
'__bootstrap.php' => 1, | |
'awscloudsearchbundle.php' => 1, | |
'phockitosilverstripe.php' => 1, | |
'ticketrole.php' => 1, | |
'phockito.php' => 1, | |
'hamcresttypebridge_globals.php' => 1, | |
'hamcresttypebridge.php' => 1, | |
'hadonraaddressbundle.php' => 1, | |
'metamaterial.php' => 1, | |
'mm_user.php' => 1, | |
'mm_taxonomy.php' => 1, | |
'mm_metabox.php' => 1, | |
'mm_mediaaccess.php' => 1, | |
'mm_loop.php' => 1, | |
'mm_dashboard.php' => 1, | |
'hackzillapasswordgeneratorbundle.php' => 1, | |
'hackzillabootstrapbundle.php' => 1, | |
'profile.html' => 1, | |
'no-sidebar.html' => 1, | |
'recover_password.php' => 1, | |
'wee.php' => 1, | |
'pointcutinjector.php' => 1, | |
'pointcut.php' => 1, | |
'patternvalueset.php' => 1, | |
'patternnamespace.php' => 1, | |
'patternfunction.php' => 1, | |
'patternfilename.php' => 1, | |
'patternclass.php' => 1, | |
'pattern.php' => 1, | |
'aoptests.php' => 1, | |
'aop.php' => 1, | |
'weeplugininterface.php' => 1, | |
'weepluginabstract.php' => 1, | |
'gwkmailjetbundle.php' => 1, | |
'file_put_contents_backup.php' => 1, | |
'gwkdynamosessionbundle.php' => 1, | |
'gwinntinymcefastloadbundle.php' => 1, | |
'gw-config.php.dist' => 1, | |
'cakeblog.sql' => 1, | |
'mohostrategy.php' => 1, | |
'zero-header.jpg' => 1, | |
'.scruitinzr.yml' => 1, | |
'nicescrollasset.php' => 1, | |
'nicescroll.php' => 1, | |
'jquerycustomcontentscrollerasset.php' => 1, | |
'jquerycustomcontentscroller.php' => 1, | |
'create_translations.sh' => 1, | |
'switch_project.php' => 1, | |
'fakepath.php' => 1, | |
'rcopy.php' => 1, | |
'icons.html' => 1, | |
'503.html' => 1, | |
'grid.html' => 1, | |
'forms.html' => 1, | |
'forms-validation.html' => 1, | |
'fixed-topbar.html' => 1, | |
'file.html' => 1, | |
'faq.html' => 1, | |
'email.html' => 1, | |
'drag.html' => 1, | |
'data-table.html' => 1, | |
'charts.html' => 1, | |
'calendar.html' => 1, | |
'buttons.html' => 1, | |
'405.html' => 1, | |
'jquery.easing.1.3.js' => 1, | |
'xparserexception.php' => 1, | |
'xnodelist.php' => 1, | |
'xnode.php' => 1, | |
'stricttrait.php' => 1, | |
'strict.php' => 1, | |
'multitonfactory.php' => 1, | |
'associativetrait.php' => 1, | |
'associativestrict.php' => 1, | |
'associative.php' => 1, | |
'minitestinterface.php' => 1, | |
'minitestabstract.php' => 1, | |
'jquery.easing.js' => 1, | |
'jquery.easing.compatibility.js' => 1, | |
'sqladmin.php' => 1, | |
'reseller.php' => 1, | |
'ups.rate.class.php' => 1, | |
'jquerynicescrollasset.php' => 1, | |
'oauth_testserver.php' => 1, | |
'oauthtests.xml' => 1, | |
'glavwebuserbundle.php' => 1, | |
'glavwebuploaderbundle.php' => 1, | |
'glavwebsubscriptionbundle.php' => 1, | |
'glavwebsimpletablebundle.php' => 1, | |
'glavwebrestbundle.php' => 1, | |
'glavwebcorebundle.php' => 1, | |
'glavwebcontentblockbundle.php' => 1, | |
'glavwebadminbundle.php' => 1, | |
'woklfsrbundle.php' => 1, | |
'keymasterjsasset.php' => 1, | |
'gaugejsasset.php' => 1, | |
'glitresquebundle.php' => 1, | |
'test-bootstrap.php' => 1, | |
'gl3nserializationgroupbundle.php' => 1, | |
'gl3nhttpquerystringfilterbundle.php' => 1, | |
'caster.php' => 1, | |
'license.javascriptpacker' => 1, | |
'gkocakayaparsesdkbundle.php' => 1, | |
'.gitignore.json' => 1, | |
'generatedocs' => 1, | |
'bootstrap.core.php' => 1, | |
'autoload.core.php' => 1, | |
'make-million.php' => 1, | |
'mysqlconnector.php' => 1, | |
'test-client.php' => 1, | |
'gliverich' => 1, | |
'wabbr.php' => 1, | |
'license_symfony' => 1, | |
'svggraphcoords.php' => 1, | |
'flood.php' => 1, | |
'edgeevent.php' => 1, | |
'edge.php' => 1, | |
'jwtmiddleware.php' => 1, | |
'gnugatsearchenginebundle.php' => 1, | |
'gnugatredaktilobundle.php' => 1, | |
'gnugatquerybusbundle.php' => 1, | |
'gnugatpommfoundationbundle.php' => 1, | |
'gnugatmicroframeworkbundle.php' => 1, | |
'gnugatmarshallerbundle.php' => 1, | |
'license-gnkwldf' => 1, | |
'flycatcher_medoo.php' => 1, | |
'mistranscriptions' => 1, | |
'syncer.php' => 1, | |
'functions_post_oo.php' => 1, | |
'gmorelstateworkflowbundle.php' => 1, | |
'testhook.php' => 1, | |
'neptune' => 1, | |
'ztecsecurityactivedirectorybundle.php' => 1, | |
'phpmetrics.yml' => 1, | |
'kalendarasset.php' => 1, | |
'kalendar.php' => 1, | |
'php-iso7064.php' => 1, | |
'registry' => 1, | |
'php-iban.php' => 1, | |
'oophp-iban.php' => 1, | |
'zlider.php' => 1, | |
'cuztom.php' => 1, | |
'svggraphshape.php' => 1, | |
'slice.php' => 1, | |
'devtimerafflerbundle.php' => 1, | |
'devtimebackbonebundle.php' => 1, | |
'libphonenumber-for-php.spec' => 1, | |
'metadata-version' => 1, | |
'gbpersonaproviderbundle.php' => 1, | |
'giftcardspackagistbundle.php' => 1, | |
'rewriterbuilder.php' => 1, | |
'rewriter.php' => 1, | |
'matchstate.php' => 1, | |
'giftcardsmodrewritebundle.php' => 1, | |
'giftcardsfixedwidthbundle.php' => 1, | |
'giftcardsencryptionbundle.php' => 1, | |
'linetoreaderiterator.php' => 1, | |
'gikoimagebundle.php' => 1, | |
'linereader.php' => 1, | |
'lineinterface.php' => 1, | |
'inmemoryfile.php' => 1, | |
'filesystemline.php' => 1, | |
'filesystemfile.php' => 1, | |
'fileiterator.php' => 1, | |
'filefactory.php' => 1, | |
'filebuilder.php' => 1, | |
'fieldrequiredexception.php' => 1, | |
'fieldnotfoundexception.php' => 1, | |
'abstractline.php' => 1, | |
'abstractfile.php' => 1, | |
'encryptorbuilder.php' => 1, | |
'gikoaliyunossbundle.php' => 1, | |
'gikopinyinbundle.php' => 1, | |
'asq.php' => 1, | |
'deployii' => 1, | |
'pokus.php' => 1, | |
'test-git-versions.sh' => 1, | |
'gitonomygitbundle.php' => 1, | |
'reftest.php' => 1, | |
'readtest.php' => 1, | |
'cleartrustbundle.php' => 1, | |
'php-to-7-aid.phar' => 1, | |
'php-to-7-aid' => 1, | |
'updatelayerextent.php' => 1, | |
'syntaxhighlighterasset.php' => 1, | |
'yiiangularjshelper.php' => 1, | |
'deployii.bat' => 1, | |
'readme-pt' => 1, | |
'gikosinaweibobundle.php' => 1, | |
'giosh94mhzsimplepreauthenticatorbundle.php' => 1, | |
'phpunit-selenium-bootstrap.php' => 1, | |
'readthedocs.yml' => 1, | |
'readthedocs.requirements' => 1, | |
'photosort' => 1, | |
'services.json.dist' => 1, | |
'pazure.phar' => 1, | |
'pazure' => 1, | |
'mysqlnduhtool.phar' => 1, | |
'index.php.dist' => 1, | |
'sclr.php' => 1, | |
'gikocorpbundle.php' => 1, | |
'gikotaobaobundle.php' => 1, | |
'svggraphhistogram.php' => 1, | |
'svggraphstackedgroupedbar3dgraph.php' => 1, | |
'reports.php' => 1, | |
'cloudmonitoring.php' => 1, | |
'dataproc.php' => 1, | |
'customsearch.php' => 1, | |
'coordinate.php' => 1, | |
'consumersurveys.php' => 1, | |
'compute.php' => 1, | |
'cloudtrace.php' => 1, | |
'cloudresourcemanager.php' => 1, | |
'cloudlatencytest.php' => 1, | |
'clouderrorreporting.php' => 1, | |
'clouddebugger.php' => 1, | |
'cloudbilling.php' => 1, | |
'clouduseraccounts.php' => 1, | |
'cloudbuild.php' => 1, | |
'dfareporting.php' => 1, | |
'classroom.php' => 1, | |
'civicinfo.php' => 1, | |
'books.php' => 1, | |
'blogger.php' => 1, | |
'bigquery.php' => 1, | |
'autoscaler.php' => 1, | |
'appsactivity.php' => 1, | |
'appengine.php' => 1, | |
'appstate.php' => 1, | |
'androidpublisher.php' => 1, | |
'androidenterprise.php' => 1, | |
'analyticsreporting.php' => 1, | |
'adsensehost.php' => 1, | |
'deploymentmanager.php' => 1, | |
'doubleclickbidmanager.php' => 1, | |
'adexchangeseller.php' => 1, | |
'mirror.php' => 1, | |
'replicapoolupdater.php' => 1, | |
'replicapool.php' => 1, | |
'qpxexpress.php' => 1, | |
'pubsub.php' => 1, | |
'proximitybeacon.php' => 1, | |
'prediction.php' => 1, | |
'plusdomains.php' => 1, | |
'plus.php' => 1, | |
'playmoviespartner.php' => 1, | |
'people.php' => 1, | |
'partners.php' => 1, | |
'pagespeedonline.php' => 1, | |
'licensing.php' => 1, | |
'doubleclicksearch.php' => 1, | |
'kgsearch.php' => 1, | |
'identitytoolkit.php' => 1, | |
'iam.php' => 1, | |
'groupssettings.php' => 1, | |
'groupsmigration.php' => 1, | |
'gmail.php' => 1, | |
'genomics.php' => 1, | |
'gamesmanagement.php' => 1, | |
'gamesconfiguration.php' => 1, | |
'fusiontables.php' => 1, | |
'freebase.php' => 1, | |
'fitness.php' => 1, | |
'drive.php' => 1, | |
'adsense.php' => 1, | |
'adexchangebuyerii.php' => 1, | |
'svggraphstackedgroupedcylindergraph.php' => 1, | |
'rah_bitly_localhost.php' => 1, | |
'rah_repeat.php' => 1, | |
'rah_minify.php' => 1, | |
'rah_knots.php' => 1, | |
'rah_function.php' => 1, | |
'rah_external_output.php' => 1, | |
'rah_expanding.php' => 1, | |
'rah_dupliquer.php' => 1, | |
'rah_debug.php' => 1, | |
'rah_cache_minify.php' => 1, | |
'rah_cache.php' => 1, | |
'rah_blobin.php' => 1, | |
'rah_bitly_prevent.php' => 1, | |
'rah_bitly.php' => 1, | |
'rah_runtime.php' => 1, | |
'rah_backup_dropbox.php' => 1, | |
'rah_autoload.php' => 1, | |
'abc_theme.php' => 1, | |
'abc_plugin.php' => 1, | |
'wp-markdown.php' => 1, | |
'style.less' => 1, | |
'post-form.php' => 1, | |
'page-resetpass.php' => 1, | |
'page-register.php' => 1, | |
'page-lostpassword.php' => 1, | |
'page-login.php' => 1, | |
'gh-minify.php' => 1, | |
'gh-cache.php' => 1, | |
'rah_replace.php' => 1, | |
'rah_sitemap_links.php' => 1, | |
'adexchangebuyer.php' => 1, | |
'iframeautoheight.php' => 1, | |
'biicode.conf' => 1, | |
'apixmlresponseprovider.php' => 1, | |
'apitestcase.php' => 1, | |
'apiresponseprovider.php' => 1, | |
'apirelationprovider.php' => 1, | |
'apijsonresponseprovider.php' => 1, | |
'apibasecontroller.php' => 1, | |
'dbsync.php' => 1, | |
'tecsprocomunbundle.php' => 1, | |
'tecsproapipostbundle.php' => 1, | |
'parsetorg12.php' => 1, | |
'completed' => 1, | |
'response3fm.php' => 1, | |
'rah_swap.php' => 1, | |
'helper3fm.php' => 1, | |
'getargs2.php' => 1, | |
'file2' => 1, | |
'file1' => 1, | |
'github-btn.html' => 1, | |
'ggmtoolsbundle.php' => 1, | |
'gitpush.sh' => 1, | |
'zem_nth.php' => 1, | |
'rah_updater.php' => 1, | |
'rah_terminal_txpmarkup.php' => 1, | |
'rah_terminal_textile.php' => 1, | |
'rah_terminal_markdown.php' => 1, | |
'rah_terminal.php' => 1, | |
'license.modernizr-server' => 1, | |
'frnkcronexpressionparserbundle.php' => 1, | |
'redgemservicesiobundle.php' => 1, | |
'multilevelhorizontalmenu.php' => 1, | |
'live-reload-kid.js' => 1, | |
'readme.highcharts' => 1, | |
'houssradmangopaybundle.php' => 1, | |
'houndedfpdfbundle.php' => 1, | |
'gridlbundle.php' => 1, | |
'iugu.php' => 1, | |
'markdownassets.php' => 1, | |
'fakeloaderasset.php' => 1, | |
'artdialogasset.php' => 1, | |
'readme.auth' => 1, | |
'readme.advancedsecurity' => 1, | |
'multilevelverticalmenu.php' => 1, | |
'yboardsettingsasset.php' => 1, | |
'hpatoiobitlybundle.php' => 1, | |
'yboardasset.php' => 1, | |
'yboard.php' => 1, | |
'profilemodule.php' => 1, | |
'profileasset.php' => 1, | |
'audiojsasset.php' => 1, | |
'audiojs.php' => 1, | |
'horriblesolutionsflaggerizerbundle.php' => 1, | |
'jdf.php' => 1, | |
'.environaut.cache' => 1, | |
'hospectphptojsbundle.php' => 1, | |
'art.png' => 1, | |
'hwbasicsbundle.php' => 1, | |
'hoyesimagemanagerbundle.php' => 1, | |
'hpatoiocommonbackendbundle.php' => 1, | |
'tigert.class.php' => 1, | |
'hslavichoneloginsamlbundle.php' => 1, | |
'arraycounter.php' => 1, | |
'config.sql' => 1, | |
'dbconfig.php' => 1, | |
'hashcache.php' => 1, | |
'instantiatetrait.php' => 1, | |
'buildkeytrait.php' => 1, | |
'applicationtrait.php' => 1, | |
'ampsubrequestextrabundle.php' => 1, | |
'bak.json' => 1, | |
'carbon-fields.php' => 1, | |
'carbon-fields-plugin.php' => 1, | |
'hslavichsimplesamlphpbundle.php' => 1, | |
'hshnclassmatcherbundle.php' => 1, | |
'.rsync_exclude.txt.dist' => 1, | |
'classmatcherbuilder.php' => 1, | |
'classmatcher.php' => 1, | |
'screenshoot.png' => 1, | |
'opentbs.php' => 1, | |
'nada.php' => 1, | |
'ipbase.php' => 1, | |
'wp-helpers.php' => 1, | |
'wp-bridges.php' => 1, | |
'hproseworkermanservice.php' => 1, | |
'localemanager.php' => 1, | |
'i18nserviceprovider.php' => 1, | |
'hpdevjquerybundle.php' => 1, | |
'deploybundle.php' => 1, | |
'codeigniter-2.2.6' => 1, | |
'cleverreach-extension.php' => 1, | |
'rediscounter.php' => 1, | |
'boundfloat.php' => 1, | |
'realdom.php' => 1, | |
'odd.php' => 1, | |
'natural.php' => 1, | |
'integer.php' => 1, | |
'even.php' => 1, | |
'disjunction.php' => 1, | |
'conststring.php' => 1, | |
'constnull.php' => 1, | |
'constinteger.php' => 1, | |
'constfloat.php' => 1, | |
'constboolean.php' => 1, | |
'constarray.php' => 1, | |
'boolean.php' => 1, | |
'realdomclass.php' => 1, | |
'praspel.php' => 1, | |
'arithmetic.pp' => 1, | |
'seekable.php' => 1, | |
'repeater.php' => 1, | |
'regularexpression.php' => 1, | |
'outer.php' => 1, | |
'norewind.php' => 1, | |
'multiple.php' => 1, | |
'lookbehind.php' => 1, | |
'lookahead.php' => 1, | |
'iteratoriterator.php' => 1, | |
'infinite.php' => 1, | |
'demultiplexer.php' => 1, | |
'realdomarray.php' => 1, | |
'realdomempty.php' => 1, | |
'screenshot-frontend.jpg' => 1, | |
'csstoxpath.php' => 1, | |
'screenshot-backend.jpg' => 1, | |
'screenshot_subscribe-extended-fe.png' => 1, | |
'screenshot_subscribe-extended-be.png' => 1, | |
'hochstrasserwirecardbundle.php' => 1, | |
'sg_dev.php' => 1, | |
'sg.php' => 1, | |
'phpunit.phar.xml' => 1, | |
'autoloader-phar.php' => 1, | |
'hobnobamaziumbundle.php' => 1, | |
'zombie.php' => 1, | |
'parameterizable.php' => 1, | |
'xyl.php' => 1, | |
'visit.php' => 1, | |
'realdomfloat.php' => 1, | |
'viewable.php' => 1, | |
'ustring.php' => 1, | |
'.autoload.atoum.php' => 1, | |
'stringbuffer.php' => 1, | |
'serializable.php' => 1, | |
'cryonicable.php' => 1, | |
'ruler.php' => 1, | |
'dynamiccallable.php' => 1, | |
'timestamp.php' => 1, | |
'smallinteger.php' => 1, | |
'smallfloat.php' => 1, | |
'realdomstring.php' => 1, | |
'realdomobject.php' => 1, | |
'dbcounter.php' => 1, | |
'chinesechar.php' => 1, | |
'callbackfilter.php' => 1, | |
'wanaworkjmspaypalrestbundle.php' => 1, | |
'icapwebsitebundle.php' => 1, | |
'icapsocialmediabundle.php' => 1, | |
'icaplyon1simpletagbundle.php' => 1, | |
'icapreferencebundle.php' => 1, | |
'icapportfoliobundle.php' => 1, | |
'icapoauthbundle.p |
View raw
(Sorry about that, but we can’t show files that are this big right now.)
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment