Skip to content

Instantly share code, notes, and snippets.

Avatar
💭
I'm sorry to inform you that Adam passed away 7/11/2018. Signed Adam's Dad.

Adam Voss adamvoss

💭
I'm sorry to inform you that Adam passed away 7/11/2018. Signed Adam's Dad.
View GitHub Profile
@adamvoss
adamvoss / Fitting-Alignment-Problem-Datasets-And-Output.md
Last active Feb 12, 2017
Sample Data and Extra Dataset solutions for exercise "1.3 The Changing Faces of Sequence Alignment" for Stepik Course "How Do We Compare Biological Sequences?" Week 2 (https://stepik.org/lesson/The-Changing-Faces-of-Sequence-Alignment-248/step/5?course=Stepic-Interactive-Text-for-Week-2&unit=8279)
View Fitting-Alignment-Problem-Datasets-And-Output.md

Sample Data

Sample Input:

GTAGGCTTAAGGTTA
TAGATA

Sample Output with Prescedence: [, →, ↓] or [, ↓, →]

2
TAGGCTTA
TAGA-T-A

@adamvoss
adamvoss / Local-Alignment-Problem-Extra-Dataset.md
Last active Feb 11, 2017
Extra Dataset solutions for exercise "1.2 From Global to Local Alignment" for Stepik Course "How Do We Compare Biological Sequences?" Week 2 (https://stepik.org/lesson/From-Global-to-Local-Alignment-247/step/10?course=Stepic-Interactive-Text-for-Week-2&unit=8278)
View Local-Alignment-Problem-Extra-Dataset.md

Input:

AMTAFRYRQGNPRYVKHFAYEIRLSHIWLLTQMPWEFVMGIKMPEDVFQHWRVYSVCTAEPMRSDETYEQKPKPMAKWSGMTIMYQAGIIRQPPRGDRGVSDRNYSQCGKQNQAQLDNNPTWTKYEIEWRVQILPPGAGVFEGDNGQNQCLCPNWAWEQPCQWGALHSNEQYPNRIHLWAPMSKLHIKIEKSSYNRNAQFPNRCMYECEFPSYREQVDSCHYENVQIAFTIFSGAEQKRKFCSCHFWSNFIDQAVFSTGLIPWCYRRDDHSAFFMPNWNKQYKHPQLQFRVAGEGTQCRPFYTREMFTKVSAWRIAGRFAGPYERHHDAHLELWYQHHKVRTGQQLGIIWNNRDKTRNPCPFSAYYNKLPWWKINQNAFYNCLQNIAHSTHDETHEFNPVKCIDWLQGTMVPTECKKGFVHEKCECYRNPGPPLHDMYHQMEDIFGVRFDCLTGWKHLSDYNPCQERRNINDFYIFAYEIAPAVKNLVLSPQPLADATKKCAFNYTPLDQSPVVIACKWYIHQPICMLLIVLICAMDKYNAHMIVIRTTEGQQPMHACRMTEGPGMCMKEPLVTFTLPAQWQWPNHEFKYVYMYVLNYHLSQYTYTDEGHAGGQHYSFNVAVDVGMAWGHNRCYCQPACYSQQETQTRTIDYEKWQYMKHQAFKWGLWFCEQERHAWFKGQNRCEMFTAKMTRMGADSNLDQYKLMLAQNYEEQWEQPIMECGMSEIIEIDPPYRSELIFTFWPFCTYSPWQNLIKCRCNNVIEEMDQCVPLTFIGFGVKQAGGIQAWAFYKEEWTSTYYLMCQCMKSDKAQYPYEIILFWMQPMDTGEQEPPQQNMWIFLPHSWFFDWCCNAPWSEICSSRHDHGQCQDAFYPCELFTVFDDIFTAEPVVCSCFYDDPM

WQEKAVDGTVPSRHQYREKEDRQGNEIGKEFRRGPQVCEYSCNSHSCGWMPIFCIVCMSYVAFYCGLEYPMSRKTAKSQFIEWCDWFCFNHWTNWAPLSIVRTSVAFAVWGHC

@adamvoss
adamvoss / si-jira-github-user-mapping.csv
Last active Dec 7, 2016
GitHub accounts for Scala Assignees in JIRA
View si-jira-github-user-mapping.csv
Eugene Burmako xeno-by
Adriaan Moors adriaanm
Martin Odersky retronym
Lukas Rytz Ichoran
Martin Odersky odersky
Lukas Rytz lrytz
Denys Shabalin densh
Vlad Ureche VladUreche
A. P. Marki som-snytt
Hubert Plociniczak hubertp
@adamvoss
adamvoss / sstable.py
Created Mar 4, 2014
SSTable (MoinMoin Parser)
View sstable.py
"""
MoinMoin - sstable a Processor for spread sheet calculations using only Python.
@license: GNU GPL, see COPYING for details.
PURPOSE:
This processor is used to do some spread sheet calculation in a regular wiki
table using only Python. The first column/first line coordinate is A0.