Skip to content

Instantly share code, notes, and snippets.

💭
I'm sorry to inform you that Adam passed away 7/11/2018. Signed Adam's Dad.

Adam Voss adamvoss

💭
I'm sorry to inform you that Adam passed away 7/11/2018. Signed Adam's Dad.
Block or report user

Report or block adamvoss

Hide content and notifications from this user.

Learn more about blocking users

Contact Support about this user’s behavior.

Learn more about reporting abuse

Report abuse
View GitHub Profile
@adamvoss
adamvoss / Fitting-Alignment-Problem-Datasets-And-Output.md
Last active Feb 12, 2017
Sample Data and Extra Dataset solutions for exercise "1.3 The Changing Faces of Sequence Alignment" for Stepik Course "How Do We Compare Biological Sequences?" Week 2 (https://stepik.org/lesson/The-Changing-Faces-of-Sequence-Alignment-248/step/5?course=Stepic-Interactive-Text-for-Week-2&unit=8279)
View Fitting-Alignment-Problem-Datasets-And-Output.md

Sample Data

Sample Input:

GTAGGCTTAAGGTTA
TAGATA

Sample Output with Prescedence: [↘, →, ↓] or [↘, ↓, →]

2
TAGGCTTA
TAGA-T-A

@adamvoss
adamvoss / Local-Alignment-Problem-Extra-Dataset.md
Last active Feb 11, 2017
Extra Dataset solutions for exercise "1.2 From Global to Local Alignment" for Stepik Course "How Do We Compare Biological Sequences?" Week 2 (https://stepik.org/lesson/From-Global-to-Local-Alignment-247/step/10?course=Stepic-Interactive-Text-for-Week-2&unit=8278)
View Local-Alignment-Problem-Extra-Dataset.md

Input:

AMTAFRYRQGNPRYVKHFAYEIRLSHIWLLTQMPWEFVMGIKMPEDVFQHWRVYSVCTAEPMRSDETYEQKPKPMAKWSGMTIMYQAGIIRQPPRGDRGVSDRNYSQCGKQNQAQLDNNPTWTKYEIEWRVQILPPGAGVFEGDNGQNQCLCPNWAWEQPCQWGALHSNEQYPNRIHLWAPMSKLHIKIEKSSYNRNAQFPNRCMYECEFPSYREQVDSCHYENVQIAFTIFSGAEQKRKFCSCHFWSNFIDQAVFSTGLIPWCYRRDDHSAFFMPNWNKQYKHPQLQFRVAGEGTQCRPFYTREMFTKVSAWRIAGRFAGPYERHHDAHLELWYQHHKVRTGQQLGIIWNNRDKTRNPCPFSAYYNKLPWWKINQNAFYNCLQNIAHSTHDETHEFNPVKCIDWLQGTMVPTECKKGFVHEKCECYRNPGPPLHDMYHQMEDIFGVRFDCLTGWKHLSDYNPCQERRNINDFYIFAYEIAPAVKNLVLSPQPLADATKKCAFNYTPLDQSPVVIACKWYIHQPICMLLIVLICAMDKYNAHMIVIRTTEGQQPMHACRMTEGPGMCMKEPLVTFTLPAQWQWPNHEFKYVYMYVLNYHLSQYTYTDEGHAGGQHYSFNVAVDVGMAWGHNRCYCQPACYSQQETQTRTIDYEKWQYMKHQAFKWGLWFCEQERHAWFKGQNRCEMFTAKMTRMGADSNLDQYKLMLAQNYEEQWEQPIMECGMSEIIEIDPPYRSELIFTFWPFCTYSPWQNLIKCRCNNVIEEMDQCVPLTFIGFGVKQAGGIQAWAFYKEEWTSTYYLMCQCMKSDKAQYPYEIILFWMQPMDTGEQEPPQQNMWIFLPHSWFFDWCCNAPWSEICSSRHDHGQCQDAFYPCELFTVFDDIFTAEPVVCSCFYDDPM

WQEKAVDGTVPSRHQYREKEDRQGNEIGKEFRRGPQVCEYSCNSHSCGWMPIFCIVCMSYVAFYCGLEYPMSRKTAKSQFIEWCDWFCFNHWTNWAPLSIVRTSVAFAVWGHC

@adamvoss
adamvoss / si-jira-github-user-mapping.csv
Last active Dec 7, 2016
GitHub accounts for Scala Assignees in JIRA
View si-jira-github-user-mapping.csv
Eugene Burmako xeno-by
Adriaan Moors adriaanm
Martin Odersky retronym
Lukas Rytz Ichoran
Martin Odersky odersky
Lukas Rytz lrytz
Denys Shabalin densh
Vlad Ureche VladUreche
A. P. Marki som-snytt
Hubert Plociniczak hubertp
@adamvoss
adamvoss / sstable.py
Created Mar 4, 2014
SSTable (MoinMoin Parser)
View sstable.py
"""
MoinMoin - sstable a Processor for spread sheet calculations using only Python.
@license: GNU GPL, see COPYING for details.
PURPOSE:
This processor is used to do some spread sheet calculation in a regular wiki
table using only Python. The first column/first line coordinate is A0.
You can’t perform that action at this time.