Skip to content

Instantly share code, notes, and snippets.

@ahmetb ahmetb/_README.md
Created May 27, 2018

Embed
What would you like to do?
BSD grep segmentation fault

I'm getting garbage characters on my screen and eventually segmentation fault from BSD grep "2.5.1-FreeBSD".

Repro

Download attached files and run:

/usr/bin/grep -E --color -f dirs_pattern.txt rp_dirs_used_in_deps.txt
vendor/cloud.google.com(/.*)?$
vendor/cloud.google.com/go(/.*)?$
vendor/cloud.google.com/go/bigquery(/.*)?$
vendor/cloud.google.com/go/bigtable(/.*)?$
vendor/cloud.google.com/go/bigtable/bttest(/.*)?$
vendor/cloud.google.com/go/bigtable/cmd(/.*)?$
vendor/cloud.google.com/go/bigtable/cmd/cbt(/.*)?$
vendor/cloud.google.com/go/bigtable/cmd/emulator(/.*)?$
vendor/cloud.google.com/go/bigtable/cmd/loadtest(/.*)?$
vendor/cloud.google.com/go/bigtable/cmd/scantest(/.*)?$
vendor/cloud.google.com/go/bigtable/internal(/.*)?$
vendor/cloud.google.com/go/bigtable/internal/cbtconfig(/.*)?$
vendor/cloud.google.com/go/bigtable/internal/gax(/.*)?$
vendor/cloud.google.com/go/bigtable/internal/option(/.*)?$
vendor/cloud.google.com/go/bigtable/internal/stat(/.*)?$
vendor/cloud.google.com/go/bigtable/testdata(/.*)?$
vendor/cloud.google.com/go/civil(/.*)?$
vendor/cloud.google.com/go/cmd(/.*)?$
vendor/cloud.google.com/go/cmd/go-cloud-debug-agent(/.*)?$
vendor/cloud.google.com/go/cmd/go-cloud-debug-agent/internal(/.*)?$
vendor/cloud.google.com/go/cmd/go-cloud-debug-agent/internal/breakpoints(/.*)?$
vendor/cloud.google.com/go/cmd/go-cloud-debug-agent/internal/controller(/.*)?$
vendor/cloud.google.com/go/cmd/go-cloud-debug-agent/internal/valuecollector(/.*)?$
vendor/cloud.google.com/go/compute(/.*)?$
vendor/cloud.google.com/go/compute/metadata(/.*)?$
vendor/cloud.google.com/go/container(/.*)?$
vendor/cloud.google.com/go/datastore(/.*)?$
vendor/cloud.google.com/go/datastore/testdata(/.*)?$
vendor/cloud.google.com/go/debugger(/.*)?$
vendor/cloud.google.com/go/debugger/apiv2(/.*)?$
vendor/cloud.google.com/go/errorreporting(/.*)?$
vendor/cloud.google.com/go/errorreporting/apiv1beta1(/.*)?$
vendor/cloud.google.com/go/errors(/.*)?$
vendor/cloud.google.com/go/iam(/.*)?$
vendor/cloud.google.com/go/iam/admin(/.*)?$
vendor/cloud.google.com/go/iam/admin/apiv1(/.*)?$
vendor/cloud.google.com/go/internal(/.*)?$
vendor/cloud.google.com/go/internal/atomiccache(/.*)?$
vendor/cloud.google.com/go/internal/fields(/.*)?$
vendor/cloud.google.com/go/internal/kokoro(/.*)?$
vendor/cloud.google.com/go/internal/optional(/.*)?$
vendor/cloud.google.com/go/internal/pretty(/.*)?$
vendor/cloud.google.com/go/internal/readme(/.*)?$
vendor/cloud.google.com/go/internal/readme/testdata(/.*)?$
vendor/cloud.google.com/go/internal/rpcreplay(/.*)?$
vendor/cloud.google.com/go/internal/rpcreplay/proto(/.*)?$
vendor/cloud.google.com/go/internal/rpcreplay/proto/intstore(/.*)?$
vendor/cloud.google.com/go/internal/rpcreplay/proto/rpcreplay(/.*)?$
vendor/cloud.google.com/go/internal/testutil(/.*)?$
vendor/cloud.google.com/go/internal/tracecontext(/.*)?$
vendor/cloud.google.com/go/internal/version(/.*)?$
vendor/cloud.google.com/go/language(/.*)?$
vendor/cloud.google.com/go/language/apiv1(/.*)?$
vendor/cloud.google.com/go/language/apiv1beta2(/.*)?$
vendor/cloud.google.com/go/logging(/.*)?$
vendor/cloud.google.com/go/logging/apiv2(/.*)?$
vendor/cloud.google.com/go/logging/internal(/.*)?$
vendor/cloud.google.com/go/logging/internal/testing(/.*)?$
vendor/cloud.google.com/go/logging/logadmin(/.*)?$
vendor/cloud.google.com/go/longrunning(/.*)?$
vendor/cloud.google.com/go/longrunning/autogen(/.*)?$
vendor/cloud.google.com/go/monitoring(/.*)?$
vendor/cloud.google.com/go/monitoring/apiv3(/.*)?$
vendor/cloud.google.com/go/profiler(/.*)?$
vendor/cloud.google.com/go/profiler/mocks(/.*)?$
vendor/cloud.google.com/go/pubsub(/.*)?$
vendor/cloud.google.com/go/pubsub/apiv1(/.*)?$
vendor/cloud.google.com/go/pubsub/loadtest(/.*)?$
vendor/cloud.google.com/go/pubsub/loadtest/cmd(/.*)?$
vendor/cloud.google.com/go/pubsub/loadtest/pb(/.*)?$
vendor/cloud.google.com/go/spanner(/.*)?$
vendor/cloud.google.com/go/spanner/admin(/.*)?$
vendor/cloud.google.com/go/spanner/admin/database(/.*)?$
vendor/cloud.google.com/go/spanner/admin/database/apiv1(/.*)?$
vendor/cloud.google.com/go/spanner/admin/instance(/.*)?$
vendor/cloud.google.com/go/spanner/admin/instance/apiv1(/.*)?$
vendor/cloud.google.com/go/spanner/internal(/.*)?$
vendor/cloud.google.com/go/spanner/internal/testutil(/.*)?$
vendor/cloud.google.com/go/speech(/.*)?$
vendor/cloud.google.com/go/speech/apiv1(/.*)?$
vendor/cloud.google.com/go/speech/apiv1beta1(/.*)?$
vendor/cloud.google.com/go/storage(/.*)?$
vendor/cloud.google.com/go/storage/testdata(/.*)?$
vendor/cloud.google.com/go/trace(/.*)?$
vendor/cloud.google.com/go/trace/apiv1(/.*)?$
vendor/cloud.google.com/go/trace/testdata(/.*)?$
vendor/cloud.google.com/go/trace/testdata/helloworld(/.*)?$
vendor/cloud.google.com/go/translate(/.*)?$
vendor/cloud.google.com/go/translate/internal(/.*)?$
vendor/cloud.google.com/go/translate/internal/translate(/.*)?$
vendor/cloud.google.com/go/translate/internal/translate/v2(/.*)?$
vendor/cloud.google.com/go/videointelligence(/.*)?$
vendor/cloud.google.com/go/videointelligence/apiv1beta1(/.*)?$
vendor/cloud.google.com/go/vision(/.*)?$
vendor/cloud.google.com/go/vision/apiv1(/.*)?$
vendor/cloud.google.com/go/vision/testdata(/.*)?$
vendor/github.com(/.*)?$
vendor/github.com/Azure(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/.github(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/advisor(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/analysisservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/apimanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/apimdeployment(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/appinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/authorization(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/automation(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/billing(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/cdn(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/cognitiveservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/commerce(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/consumption(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/containerinstance(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/containerregistry(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/cosmos-db(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/customer-insights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/datalake-analytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/datalake-analytics/account(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/datalake-store(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/datalake-store/account(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/deployment(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/devtestlabs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/disk(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/dns(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/documentdb(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/eventgrid(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/eventhub(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/examples(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/examples/check(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/examples/create(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/examples/dns(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/examples/dns/paging(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/examples/helpers(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/graphrbac(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/hdinsight(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/insights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/intune(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/iothub(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/logic(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/machinelearning(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/machinelearning/commitmentplans(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/machinelearning/webservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/marketplaceordering(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/mediaservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/mobileengagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/monitor(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/mysql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/networkwatcher(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/notificationhubs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/operationalinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/operationsmanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/postgresql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/powerbiembedded(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/recoveryservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/recoveryservicesbackup(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/recoveryservicessiterecovery(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/redis(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/relay(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/resourcehealth(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/resources/features(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/resources/links(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/resources/locks(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/resources/managedapplications(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/resources/policy(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/resources/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/resources/subscriptions(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/scheduler(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/search(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/servermanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/service-map(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/servicebus(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/sql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/storageimportexport(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/storsimple8000series(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/streamanalytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/trafficmanager(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/visualstudio(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/arm/web(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/datalake-store(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/datalake-store/filesystem(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/dataplane(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/dataplane/cognitiveservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/dataplane/cognitiveservices/face(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/dataplane/cognitiveservices/textanalytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/dataplane/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/documentation(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/affinitygroup(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/hostedservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/location(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/networksecuritygroup(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/osimage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/sql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/storageservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/testutils(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/virtualmachine(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/virtualmachinedisk(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/virtualmachineimage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/virtualnetwork(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/management/vmutils(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/compute/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/compute/mgmt/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/network/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/network/mgmt/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt/features(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt/links(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt/locks(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt/policy(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/resources/mgmt/subscriptions(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/storage/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/2017-03-09/storage/mgmt/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/advisor(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/advisor/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/advisor/mgmt/advisor(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/analysisservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/analysisservices/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/analysisservices/mgmt/analysisservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/appinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/appinsights/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/appinsights/mgmt/insights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/authorization(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/authorization/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/authorization/mgmt/authorization(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/automation(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/automation/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/automation/mgmt/automation(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/batch/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/batch/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/batch/mgmt/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cdn(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cdn/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cdn/mgmt/cdn(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/customsearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/entitysearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/face(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/imagesearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/mgmt/cognitiveservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/newssearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/spellcheck(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/textanalytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/videosearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cognitiveservices/websearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/compute/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/compute/mgmt/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/containerregistry(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/containerregistry/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/containerregistry/mgmt/containerregistry(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/containerservice/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/containerservice/mgmt/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cosmos-db(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cosmos-db/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/cosmos-db/mgmt/documentdb(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/customerinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/customerinsights/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/customerinsights/mgmt/customerinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/datalake(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/datalake/analytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/datalake/analytics/job(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/datalake/analytics/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/datalake/analytics/mgmt/account(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/datalake/store(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/datalake/store/filesystem(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/datalake/store/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/datalake/store/mgmt/account(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/devtestlabs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/devtestlabs/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/devtestlabs/mgmt/dtl(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/dns(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/dns/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/dns/mgmt/dns(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/domainservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/domainservices/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/domainservices/mgmt/aad(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/eventgrid(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/eventgrid/eventgrid(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/eventhub(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/eventhub/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/eventhub/mgmt/eventhub(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/graphrbac(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/graphrbac/graphrbac(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/iothub(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/iothub/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/iothub/mgmt/devices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/keyvault/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/keyvault/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/keyvault/mgmt/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/logic(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/logic/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/logic/mgmt/logic(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/machinelearning(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/machinelearning/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/machinelearning/mgmt/webservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/marketplaceordering(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/marketplaceordering/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/marketplaceordering/mgmt/marketplaceordering(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/mediaservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/mediaservices/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/mediaservices/mgmt/media(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/mobileengagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/mobileengagement/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/mobileengagement/mgmt/mobileengagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/network/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/network/mgmt/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/notificationhubs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/notificationhubs/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/notificationhubs/mgmt/notificationhubs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/operationalinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/operationalinsights/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/operationalinsights/mgmt/operationalinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/powerbiembedded(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/powerbiembedded/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/powerbiembedded/mgmt/powerbiembedded(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/redis(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/redis/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/redis/mgmt/cache(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/redis/mgmt/redis(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/relay(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/relay/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/relay/mgmt/relay(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/resourcehealth(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/resourcehealth/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/resourcehealth/mgmt/resourcehealth(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt/features(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt/links(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt/locks(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt/policy(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/resources/mgmt/subscriptions(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/scheduler(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/scheduler/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/scheduler/mgmt/scheduler(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/search(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/search/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/search/mgmt/search(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/search/search(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/servicebus(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/servicebus/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/servicebus/mgmt/servicebus(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/servicefabric/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/servicefabric/mgmt/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/servicefabric/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/sql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/sql/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/sql/mgmt/sql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/storage/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/storage/mgmt/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/storageimportexport(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/storageimportexport/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/storageimportexport/mgmt/storageimportexport(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/storsimple8000series(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/storsimple8000series/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/storsimple8000series/mgmt/storsimple(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/streamanalytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/streamanalytics/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/streamanalytics/mgmt/streamanalytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/trafficmanager(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/trafficmanager/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/trafficmanager/mgmt/trafficmanager(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/web(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/web/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/latest/web/mgmt/web(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/advisor(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/advisor/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/advisor/mgmt/advisor(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/analysisservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/analysisservices/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/analysisservices/mgmt/analysisservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/appinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/appinsights/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/appinsights/mgmt/insights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/authorization(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/authorization/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/authorization/mgmt/authorization(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/automation(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/automation/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/automation/mgmt/automation(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/batch/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/batch/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/batch/mgmt/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/billing(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/billing/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/billing/mgmt/billing(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cdn(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cdn/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cdn/mgmt/cdn(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/customsearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/entitysearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/face(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/imagesearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/mgmt/cognitiveservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/newssearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/spellcheck(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/textanalytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/videosearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cognitiveservices/websearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/commerce(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/commerce/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/commerce/mgmt/commerce(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/compute/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/compute/mgmt/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/containerinstance(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/containerinstance/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/containerinstance/mgmt/containerinstance(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/containerregistry(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/containerregistry/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/containerregistry/mgmt/containerregistry(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/containerservice/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/containerservice/mgmt/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cosmos-db(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cosmos-db/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/cosmos-db/mgmt/documentdb(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/customerinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/customerinsights/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/customerinsights/mgmt/customerinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datafactory(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datafactory/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datafactory/mgmt/datafactory(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datalake(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/analytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/analytics/catalog(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/analytics/job(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/analytics/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/analytics/mgmt/account(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/store(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/store/filesystem(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/store/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/datalake/store/mgmt/account(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/devtestlabs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/devtestlabs/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/devtestlabs/mgmt/dtl(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/dns(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/dns/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/dns/mgmt/dns(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/domainservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/domainservices/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/domainservices/mgmt/aad(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/eventgrid(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/eventgrid/eventgrid(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/eventgrid/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/eventgrid/mgmt/eventgrid(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/eventhub(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/eventhub/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/eventhub/mgmt/eventhub(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/graphrbac(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/graphrbac/graphrbac(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/hdinsight(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/hdinsight/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/hdinsight/mgmt/hdinsight(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/iothub(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/iothub/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/iothub/mgmt/devices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/keyvault/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/keyvault/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/keyvault/mgmt/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/logic(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/logic/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/logic/mgmt/logic(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/machinelearning(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/machinelearning/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/machinelearning/mgmt/commitmentplans(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/machinelearning/mgmt/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/machinelearning/mgmt/experimentation(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/machinelearning/mgmt/webservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/marketplaceordering(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/marketplaceordering/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/marketplaceordering/mgmt/marketplaceordering(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/mediaservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/mediaservices/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/mediaservices/mgmt/media(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/mobileengagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/mobileengagement/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/mobileengagement/mgmt/mobileengagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/monitor(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/monitor/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/monitor/mgmt/insights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/msi(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/msi/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/msi/mgmt/msi(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/mysql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/mysql/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/mysql/mgmt/mysql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/network/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/network/mgmt/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/notificationhubs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/notificationhubs/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/notificationhubs/mgmt/notificationhubs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/operationalinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/operationalinsights/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/operationalinsights/mgmt/operationalinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/operationalinsights/mgmt/servicemap(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/operationsmanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/operationsmanagement/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/operationsmanagement/mgmt/operationsmanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/postgresql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/postgresql/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/postgresql/mgmt/postgresql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/powerbiembedded(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/powerbiembedded/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/powerbiembedded/mgmt/powerbiembedded(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/redis(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/redis/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/redis/mgmt/cache(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/redis/mgmt/redis(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/relay(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/relay/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/relay/mgmt/relay(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resourcehealth(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resourcehealth/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resourcehealth/mgmt/resourcehealth(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/features(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/links(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/locks(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/managedapplications(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/management(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/policy(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/resources/mgmt/subscriptions(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/scheduler(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/scheduler/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/scheduler/mgmt/scheduler(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/search(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/search/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/search/mgmt/search(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/search/search(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/servermanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/servermanagement/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/servermanagement/mgmt/servermanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/servicebus(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/servicebus/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/servicebus/mgmt/servicebus(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/servicefabric/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/servicefabric/mgmt/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/servicefabric/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/sql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/sql/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/sql/mgmt/sql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/storage/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/storage/mgmt/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/storageimportexport(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/storageimportexport/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/storageimportexport/mgmt/storageimportexport(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/storsimple8000series(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/storsimple8000series/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/storsimple8000series/mgmt/storsimple(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/streamanalytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/streamanalytics/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/streamanalytics/mgmt/streamanalytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/trafficmanager(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/trafficmanager/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/trafficmanager/mgmt/trafficmanager(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/visualstudio(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/visualstudio/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/visualstudio/mgmt/visualstudio(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/web(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/web/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/profiles/preview/web/mgmt/web(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/advisor(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/advisor/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/advisor/mgmt/2016-07-12-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/advisor/mgmt/2016-07-12-preview/advisor(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/advisor/mgmt/2017-03-31(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/advisor/mgmt/2017-03-31/advisor(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/advisor/mgmt/2017-04-19(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/advisor/mgmt/2017-04-19/advisor(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/analysisservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/analysisservices/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/analysisservices/mgmt/2016-05-16(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/analysisservices/mgmt/2016-05-16/analysisservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/analysisservices/mgmt/2017-07-14(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/analysisservices/mgmt/2017-07-14/analysisservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/analysisservices/mgmt/2017-08-01-beta(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/analysisservices/mgmt/2017-08-01-beta/analysisservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/apimanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/apimanagement/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/apimanagement/mgmt/2016-10-10(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/apimanagement/mgmt/2016-10-10/apimanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/appinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/appinsights/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/appinsights/mgmt/2015-05-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/appinsights/mgmt/2015-05-01/insights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/authorization(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/authorization/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/authorization/mgmt/2015-07-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/authorization/mgmt/2015-07-01/authorization(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/authorization/mgmt/2017-10-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/authorization/mgmt/2017-10-01-preview/authorization(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/automation(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/automation/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/automation/mgmt/2015-10-31(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/automation/mgmt/2015-10-31/automation(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/batch/2017-05-01.5.0(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/batch/2017-05-01.5.0/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/batch/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/batch/mgmt/2015-12-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/batch/mgmt/2015-12-01/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/batch/mgmt/2017-01-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/batch/mgmt/2017-01-01/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/batch/mgmt/2017-05-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/batch/mgmt/2017-05-01/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/batch/mgmt/2017-09-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/batch/mgmt/2017-09-01/batch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/billing(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/billing/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/billing/mgmt/2017-02-27-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/billing/mgmt/2017-02-27-preview/billing(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/billing/mgmt/2017-04-24-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/billing/mgmt/2017-04-24-preview/billing(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cdn(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cdn/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cdn/mgmt/2015-06-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cdn/mgmt/2015-06-01/cdn(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cdn/mgmt/2016-04-02(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cdn/mgmt/2016-04-02/cdn(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cdn/mgmt/2016-10-02(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cdn/mgmt/2016-10-02/cdn(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cdn/mgmt/2017-04-02(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cdn/mgmt/2017-04-02/cdn(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/mgmt/2016-02-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/mgmt/2016-02-01-preview/cognitiveservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/mgmt/2017-04-18(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/mgmt/2017-04-18/cognitiveservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/customsearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/entitysearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/face(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/imagesearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/newssearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/spellcheck(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/videosearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v1.0/websearch(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v2.0(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cognitiveservices/v2.0/textanalytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/commerce(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/commerce/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/commerce/mgmt/2015-06-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/commerce/mgmt/2015-06-01-preview/commerce(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/compute/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/compute/mgmt/2015-06-15(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/compute/mgmt/2015-06-15/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/compute/mgmt/2016-03-30(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/compute/mgmt/2016-03-30/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/compute/mgmt/2016-04-30-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/compute/mgmt/2016-04-30-preview/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/compute/mgmt/2017-03-30(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/compute/mgmt/2017-03-30/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/consumption(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/consumption/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/consumption/mgmt/2017-04-24-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/consumption/mgmt/2017-04-24-preview/consumption(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerinstance(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerinstance/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerinstance/mgmt/2017-08-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerinstance/mgmt/2017-08-01-preview/containerinstance(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerregistry(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerregistry/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerregistry/mgmt/2017-03-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerregistry/mgmt/2017-03-01/containerregistry(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerregistry/mgmt/2017-06-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerregistry/mgmt/2017-06-01-preview/containerregistry(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerregistry/mgmt/2017-10-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerregistry/mgmt/2017-10-01/containerregistry(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2015-11-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2015-11-01-preview/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2016-03-30(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2016-03-30/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2016-09-30(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2016-09-30/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2017-01-31(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2017-01-31/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2017-07-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2017-07-01/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2017-08-31(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2017-08-31/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2017-09-30(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/containerservice/mgmt/2017-09-30/containerservice(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cosmos-db(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cosmos-db/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cosmos-db/mgmt/2015-04-08(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cosmos-db/mgmt/2015-04-08/documentdb(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/cosmos-db/mongodb(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/customerinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/customerinsights/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/customerinsights/mgmt/2017-01-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/customerinsights/mgmt/2017-01-01/customerinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/customerinsights/mgmt/2017-04-26(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/customerinsights/mgmt/2017-04-26/customerinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datafactory(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datafactory/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datafactory/mgmt/2017-09-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datafactory/mgmt/2017-09-01-preview/datafactory(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2015-10-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2015-10-01-preview/catalog(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2015-11-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2015-11-01-preview/job(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2016-03-20-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2016-03-20-preview/job(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2016-11-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2016-11-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2016-11-01-preview/catalog(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2016-11-01/job(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2017-09-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/2017-09-01-preview/job(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/mgmt/2015-10-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/mgmt/2015-10-01-preview/account(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/mgmt/2016-11-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/analytics/mgmt/2016-11-01/account(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/store(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/store/2015-10-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/store/2015-10-01-preview/filesystem(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/store/2016-11-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/store/2016-11-01/filesystem(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/store/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/store/mgmt/2015-10-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/store/mgmt/2015-10-01-preview/account(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/store/mgmt/2016-11-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/datalake/store/mgmt/2016-11-01/account(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/devtestlabs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/devtestlabs/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/devtestlabs/mgmt/2015-05-21-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/devtestlabs/mgmt/2015-05-21-preview/dtl(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/devtestlabs/mgmt/2016-05-15(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/devtestlabs/mgmt/2016-05-15/dtl(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/dns(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/dns/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/dns/mgmt/2015-05-04-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/dns/mgmt/2015-05-04-preview/dns(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/dns/mgmt/2016-04-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/dns/mgmt/2016-04-01/dns(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/domainservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/domainservices/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/domainservices/mgmt/2017-01-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/domainservices/mgmt/2017-01-01/aad(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventgrid(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventgrid/2018-01-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventgrid/2018-01-01/eventgrid(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventgrid/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventgrid/mgmt/2017-06-15-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventgrid/mgmt/2017-06-15-preview/eventgrid(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventgrid/mgmt/2017-09-15-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventgrid/mgmt/2017-09-15-preview/eventgrid(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventhub(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventhub/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventhub/mgmt/2015-08-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventhub/mgmt/2015-08-01/eventhub(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventhub/mgmt/2017-04-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/eventhub/mgmt/2017-04-01/eventhub(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/graphrbac(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/graphrbac/1.6(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/graphrbac/1.6/graphrbac(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/hdinsight(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/hdinsight/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/hdinsight/mgmt/2015-03-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/hdinsight/mgmt/2015-03-01-preview/hdinsight(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/iothub(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/iothub/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/iothub/mgmt/2016-02-03(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/iothub/mgmt/2016-02-03/devices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/iothub/mgmt/2017-01-19(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/iothub/mgmt/2017-01-19/devices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/iothub/mgmt/2017-07-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/iothub/mgmt/2017-07-01/devices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/keyvault/2015-06-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/keyvault/2015-06-01/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/keyvault/2016-10-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/keyvault/2016-10-01/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/keyvault/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/keyvault/mgmt/2015-06-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/keyvault/mgmt/2015-06-01/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/keyvault/mgmt/2016-10-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/keyvault/mgmt/2016-10-01/keyvault(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/logic(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/logic/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/logic/mgmt/2015-02-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/logic/mgmt/2015-02-01-preview/logic(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/logic/mgmt/2015-08-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/logic/mgmt/2015-08-01-preview/logic(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/logic/mgmt/2016-06-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/logic/mgmt/2016-06-01/logic(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/machinelearning(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2016-05-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2016-05-01-preview/commitmentplans(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2016-05-01-preview/webservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2017-01-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2017-01-01/webservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2017-05-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2017-05-01-preview/experimentation(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2017-08-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/machinelearning/mgmt/2017-08-01-preview/compute(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/marketplaceordering(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/marketplaceordering/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/marketplaceordering/mgmt/2015-06-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/marketplaceordering/mgmt/2015-06-01/marketplaceordering(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/mediaservices(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/mediaservices/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/mediaservices/mgmt/2015-10-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/mediaservices/mgmt/2015-10-01/media(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/mobileengagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/mobileengagement/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/mobileengagement/mgmt/2014-12-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/mobileengagement/mgmt/2014-12-01/mobileengagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/monitor(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/monitor/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/monitor/mgmt/2017-05-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/monitor/mgmt/2017-05-01-preview/insights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/msi(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/msi/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/msi/mgmt/2015-08-31-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/msi/mgmt/2015-08-31-preview/msi(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/mysql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/mysql/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/mysql/mgmt/2017-04-30-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/mysql/mgmt/2017-04-30-preview/mysql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2015-05-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2015-05-01-preview/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2015-06-15(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2015-06-15/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2016-03-30(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2016-03-30/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2016-06-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2016-06-01/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2016-09-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2016-09-01/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2016-12-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2016-12-01/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2017-03-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2017-03-01/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2017-06-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2017-06-01/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2017-08-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2017-08-01/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2017-09-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/network/mgmt/2017-09-01/network(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/notificationhubs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/notificationhubs/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/notificationhubs/mgmt/2014-09-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/notificationhubs/mgmt/2014-09-01/notificationhubs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/notificationhubs/mgmt/2016-03-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/notificationhubs/mgmt/2016-03-01/notificationhubs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/notificationhubs/mgmt/2017-04-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/notificationhubs/mgmt/2017-04-01/notificationhubs(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationalinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationalinsights/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationalinsights/mgmt/2015-03-20(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationalinsights/mgmt/2015-03-20/operationalinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationalinsights/mgmt/2015-11-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationalinsights/mgmt/2015-11-01-preview/operationalinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationalinsights/mgmt/2015-11-01-preview/servicemap(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationalinsights/v1(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationalinsights/v1/operationalinsights(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationsmanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationsmanagement/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationsmanagement/mgmt/2015-11-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/operationsmanagement/mgmt/2015-11-01-preview/operationsmanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/postgresql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/postgresql/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/postgresql/mgmt/2017-04-30-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/postgresql/mgmt/2017-04-30-preview/postgresql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/powerbiembedded(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/powerbiembedded/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/powerbiembedded/mgmt/2016-01-29(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/powerbiembedded/mgmt/2016-01-29/powerbiembedded(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/redis(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/redis/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/redis/mgmt/2015-08-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/redis/mgmt/2015-08-01/redis(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/redis/mgmt/2016-04-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/redis/mgmt/2016-04-01/redis(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/redis/mgmt/2017-02-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/redis/mgmt/2017-02-01/redis(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/redis/mgmt/2017-10-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/redis/mgmt/2017-10-01/cache(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/relay(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/relay/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/relay/mgmt/2016-07-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/relay/mgmt/2016-07-01/relay(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/relay/mgmt/2017-04-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/relay/mgmt/2017-04-01/relay(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resourcehealth(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resourcehealth/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resourcehealth/mgmt/2015-01-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resourcehealth/mgmt/2015-01-01/resourcehealth(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resourcehealth/mgmt/2017-07-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resourcehealth/mgmt/2017-07-01/resourcehealth(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-01-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-01-01/locks(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-10-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-10-01-preview/policy(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-11-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-11-01/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-11-01/subscriptions(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-12-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2015-12-01/features(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-02-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-02-01/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-04-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-04-01/policy(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-06-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-06-01/subscriptions(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-07-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-07-01/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-09-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-09-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-09-01-preview/managedapplications(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-09-01/links(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-09-01/locks(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-09-01/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-12-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2016-12-01/policy(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2017-05-10(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2017-05-10/resources(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2017-06-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2017-06-01-preview/policy(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2017-08-31-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/resources/mgmt/2017-08-31-preview/management(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/scheduler(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/scheduler/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/scheduler/mgmt/2014-08-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/scheduler/mgmt/2014-08-01-preview/scheduler(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/scheduler/mgmt/2016-01-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/scheduler/mgmt/2016-01-01/scheduler(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/scheduler/mgmt/2016-03-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/scheduler/mgmt/2016-03-01/scheduler(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/search(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/search/2016-09-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/search/2016-09-01/search(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/search/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/search/mgmt/2015-02-28(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/search/mgmt/2015-02-28/search(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/search/mgmt/2015-08-19(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/search/mgmt/2015-08-19/search(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servermanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servermanagement/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servermanagement/mgmt/2015-07-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servermanagement/mgmt/2015-07-01-preview/servermanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servermanagement/mgmt/2016-07-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servermanagement/mgmt/2016-07-01-preview/servermanagement(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicebus(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicebus/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicebus/mgmt/2015-08-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicebus/mgmt/2015-08-01/servicebus(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicebus/mgmt/2017-04-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicebus/mgmt/2017-04-01/servicebus(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicefabric/1.0.0(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicefabric/1.0.0/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicefabric/5.6(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicefabric/5.6/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicefabric/6.0(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicefabric/6.0/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicefabric/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicefabric/mgmt/2016-09-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicefabric/mgmt/2016-09-01/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicefabric/mgmt/2017-07-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/servicefabric/mgmt/2017-07-01-preview/servicefabric(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/sql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/sql/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/sql/mgmt/2014-04-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/sql/mgmt/2014-04-01/sql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/sql/mgmt/2015-05-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/sql/mgmt/2015-05-01-preview/sql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/sql/mgmt/2017-03-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/sql/mgmt/2017-03-01-preview/sql(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2015-05-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2015-05-01-preview/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2015-06-15(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2015-06-15/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2016-01-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2016-01-01/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2016-05-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2016-05-01/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2016-12-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2016-12-01/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2017-06-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2017-06-01/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2017-10-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storage/mgmt/2017-10-01/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storageimportexport(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storageimportexport/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storageimportexport/mgmt/2016-11-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storageimportexport/mgmt/2016-11-01/storageimportexport(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storsimple8000series(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storsimple8000series/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storsimple8000series/mgmt/2017-06-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/storsimple8000series/mgmt/2017-06-01/storsimple(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/streamanalytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/streamanalytics/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/streamanalytics/mgmt/2016-03-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/streamanalytics/mgmt/2016-03-01/streamanalytics(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/trafficmanager(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt/2015-11-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt/2015-11-01/trafficmanager(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt/2017-03-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt/2017-03-01/trafficmanager(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt/2017-05-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt/2017-05-01/trafficmanager(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt/2017-09-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/trafficmanager/mgmt/2017-09-01-preview/trafficmanager(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/visualstudio(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/visualstudio/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/visualstudio/mgmt/2014-04-01-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/visualstudio/mgmt/2014-04-01-preview/visualstudio(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/web(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/web/mgmt(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/web/mgmt/2015-08-preview(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/web/mgmt/2015-08-preview/web(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/web/mgmt/2016-09-01(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/services/web/mgmt/2016-09-01/web(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/AppendBlobSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/AuthorizationSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/BlobSASURISuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/BlockBlobSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/ContainerSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/CopyBlobSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/LeaseBlobSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/PageBlobSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/StorageBlobSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/StorageClientSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/StorageDirSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/StorageEntitySuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/StorageFileSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/StorageMessageSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/StorageQueueSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/StorageShareSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/StorageSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/StorageTableSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/storage/recordings/TableBatchSuite(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/tools(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/tools/generator(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/tools/profileBuilder(/.*)?$
vendor/github.com/Azure/azure-sdk-for-go/tools/profileBuilder/testdata(/.*)?$
vendor/github.com/Azure/go-autorest(/.*)?$
vendor/github.com/Azure/go-autorest/.github(/.*)?$
vendor/github.com/Azure/go-autorest/autorest(/.*)?$
vendor/github.com/Azure/go-autorest/autorest/adal(/.*)?$
vendor/github.com/Azure/go-autorest/autorest/adal/cmd(/.*)?$
vendor/github.com/Azure/go-autorest/autorest/azure(/.*)?$
vendor/github.com/Azure/go-autorest/autorest/azure/auth(/.*)?$
vendor/github.com/Azure/go-autorest/autorest/azure/cli(/.*)?$
vendor/github.com/Azure/go-autorest/autorest/azure/example(/.*)?$
vendor/github.com/Azure/go-autorest/autorest/azure/testdata(/.*)?$
vendor/github.com/Azure/go-autorest/autorest/date(/.*)?$
vendor/github.com/Azure/go-autorest/autorest/mocks(/.*)?$
vendor/github.com/Azure/go-autorest/autorest/to(/.*)?$
vendor/github.com/Azure/go-autorest/autorest/utils(/.*)?$
vendor/github.com/Azure/go-autorest/autorest/validation(/.*)?$
vendor/github.com/Azure/go-autorest/testdata(/.*)?$
vendor/github.com/aws(/.*)?$
vendor/github.com/aws/aws-sdk-go(/.*)?$
vendor/github.com/aws/aws-sdk-go/.github(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/awserr(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/awsutil(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/client(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/client/metadata(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/corehandlers(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/credentials(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/credentials/ec2rolecreds(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/credentials/endpointcreds(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/credentials/plugincreds(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/credentials/stscreds(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/defaults(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/ec2metadata(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/endpoints(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/request(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/session(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/session/testdata(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/signer(/.*)?$
vendor/github.com/aws/aws-sdk-go/aws/signer/v4(/.*)?$
vendor/github.com/aws/aws-sdk-go/awsmigrate(/.*)?$
vendor/github.com/aws/aws-sdk-go/awsmigrate/awsmigrate-renamer(/.*)?$
vendor/github.com/aws/aws-sdk-go/awsmigrate/awsmigrate-renamer/Godeps(/.*)?$
vendor/github.com/aws/aws-sdk-go/awsmigrate/awsmigrate-renamer/gen(/.*)?$
vendor/github.com/aws/aws-sdk-go/awsmigrate/awsmigrate-renamer/rename(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/cmd(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/cmd/bucket_cleanup(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/customizations(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/customizations/s3(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/customizations/s3/s3crypto(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/customizations/s3/s3manager(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/acm(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/apigateway(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/applicationdiscoveryservice(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/autoscaling(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/cloudformation(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/cloudfront(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/cloudhsm(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/cloudsearch(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/cloudtrail(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/cloudwatch(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/cloudwatchlogs(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/codecommit(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/codedeploy(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/codepipeline(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/cognitoidentity(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/cognitosync(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/configservice(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/datapipeline(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/devicefarm(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/directconnect(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/directoryservice(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/dynamodb(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/dynamodbstreams(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/ec2(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/ecs(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/efs(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/elasticache(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/elasticbeanstalk(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/elasticloadbalancing(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/elastictranscoder(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/emr(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/es(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/glacier(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/iam(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/iotdataplane(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/kinesis(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/kms(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/lambda(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/machinelearning(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/opsworks(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/rds(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/redshift(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/route53(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/route53domains(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/ses(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/simpledb(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/sns(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/sqs(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/ssm(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/storagegateway(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/sts(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/support(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/swf(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/waf(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/integration/smoke/workspaces(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/mock(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/performance(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/sandbox(/.*)?$
vendor/github.com/aws/aws-sdk-go/awstesting/unit(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/aws-godoc(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/aws-godoc/templates(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/plugin(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/plugin/templates(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/plugin/templates/default(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/plugin/templates/default/layout(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/plugin/templates/default/layout/html(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/plugin/templates/default/module(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/plugin/templates/default/module/html(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/plugin/templates/default/package(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/plugin/templates/default/package/html(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/plugin/templates/default/struct(/.*)?$
vendor/github.com/aws/aws-sdk-go/doc-src/plugin/templates/default/struct/html(/.*)?$
vendor/github.com/aws/aws-sdk-go/example(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/aws(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/aws/credentials(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/aws/credentials/plugincreds(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/aws/credentials/plugincreds/plugin(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/aws/endpoints(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/aws/endpoints/customEndpoint(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/aws/endpoints/enumEndpoints(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/aws/request(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/aws/request/handleServiceErrorCodes(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/aws/request/withContext(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/cloudfront(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/cloudfront/signCookies(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/dynamodb(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/dynamodb/scanItems(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/dynamodb/unitTest(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/ec2(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/ec2/filterInstances(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/rds(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/rds/rdsutils(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/rds/rdsutils/authentication(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/s3(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/s3/concatObjects(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/s3/listObjects(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/s3/listObjectsConcurrently(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/s3/presignURL(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/s3/presignURL/client(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/s3/presignURL/server(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/s3/putObjectAcl(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/sqs(/.*)?$
vendor/github.com/aws/aws-sdk-go/example/service/sqs/mockingClientsForTests(/.*)?$
vendor/github.com/aws/aws-sdk-go/internal(/.*)?$
vendor/github.com/aws/aws-sdk-go/internal/shareddefaults(/.*)?$
vendor/github.com/aws/aws-sdk-go/models(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/acm(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/acm/2015-12-08(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/apigateway(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/apigateway/2015-07-09(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/application-autoscaling(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/application-autoscaling/2016-02-06(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/appstream(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/appstream/2016-12-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/athena(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/athena/2017-05-18(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/autoscaling(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/autoscaling/2011-01-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/batch(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/batch/2016-08-10(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/budgets(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/budgets/2016-10-20(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/clouddirectory(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/clouddirectory/2016-05-10(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudformation(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudformation/2010-05-15(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudfront(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudfront/2015-04-17(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudfront/2015-07-27(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudfront/2015-09-17(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudfront/2016-01-13(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudfront/2016-01-28(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudfront/2016-08-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudfront/2016-08-20(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudfront/2016-09-07(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudfront/2016-09-29(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudfront/2016-11-25(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudfront/2017-03-25(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudhsm(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudhsm/2014-05-30(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudsearch(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudsearch/2013-01-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudsearchdomain(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudsearchdomain/2013-01-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudtrail(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cloudtrail/2013-11-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/codebuild(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/codebuild/2016-10-06(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/codecommit(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/codecommit/2015-04-13(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/codedeploy(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/codedeploy/2014-10-06(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/codepipeline(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/codepipeline/2015-07-09(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/codestar(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/codestar/2017-04-19(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cognito-identity(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cognito-identity/2014-06-30(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cognito-idp(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cognito-idp/2016-04-18(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cognito-sync(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cognito-sync/2014-06-30(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/config(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/config/2014-11-12(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cur(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/cur/2017-01-06(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/datapipeline(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/datapipeline/2012-10-29(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/dax(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/dax/2017-04-19(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/devicefarm(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/devicefarm/2015-06-23(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/directconnect(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/directconnect/2012-10-25(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/discovery(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/discovery/2015-11-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/dms(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/dms/2016-01-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ds(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ds/2015-04-16(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/dynamodb(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/dynamodb/2011-12-05(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/dynamodb/2012-08-10(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ec2(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ec2/2015-04-15(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ec2/2015-10-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ec2/2016-04-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ec2/2016-09-15(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ec2/2016-11-15(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ecr(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ecr/2015-09-21(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ecs(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ecs/2014-11-13(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elasticache(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elasticache/2015-02-02(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elasticbeanstalk(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elasticbeanstalk/2010-12-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elasticfilesystem(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elasticfilesystem/2015-02-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elasticloadbalancing(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elasticloadbalancing/2012-06-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elasticloadbalancingv2(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elasticloadbalancingv2/2015-12-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elasticmapreduce(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elasticmapreduce/2009-03-31(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elastictranscoder(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/elastictranscoder/2012-09-25(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/email(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/email/2010-12-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/entitlement.marketplace(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/entitlement.marketplace/2017-01-11(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/es(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/es/2015-01-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/events(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/events/2014-02-03(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/events/2015-10-07(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/firehose(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/firehose/2015-08-04(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/gamelift(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/gamelift/2015-10-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/glacier(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/glacier/2012-06-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/greengrass(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/greengrass/2017-06-07(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/health(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/health/2016-08-04(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/iam(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/iam/2010-05-08(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/importexport(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/importexport/2010-06-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/inspector(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/inspector/2015-08-18(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/inspector/2016-02-16(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/iot(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/iot-data(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/iot-data/2015-05-28(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/iot/2015-05-28(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/kinesis(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/kinesis/2013-12-02(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/kinesisanalytics(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/kinesisanalytics/2015-08-14(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/kms(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/kms/2014-11-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/lambda(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/lambda/2014-11-11(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/lambda/2015-03-31(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/lex-models(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/lex-models/2017-04-19(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/lightsail(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/lightsail/2016-11-28(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/logs(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/logs/2014-03-28(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/machinelearning(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/machinelearning/2014-12-12(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/marketplacecommerceanalytics(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/marketplacecommerceanalytics/2015-07-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/meteringmarketplace(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/meteringmarketplace/2016-01-14(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/mobileanalytics(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/mobileanalytics/2014-06-05(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/monitoring(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/monitoring/2010-08-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/mturk-requester(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/mturk-requester/2017-01-17(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/opsworks(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/opsworks/2013-02-18(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/opsworkscm(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/opsworkscm/2016-11-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/organizations(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/organizations/2016-11-28(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/pinpoint(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/pinpoint/2016-12-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/polly(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/polly/2016-06-10(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/rds(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/rds/2013-01-10(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/rds/2013-02-12(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/rds/2013-09-09(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/rds/2014-09-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/rds/2014-10-31(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/redshift(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/redshift/2012-12-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/rekognition(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/rekognition/2016-06-27(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/resourcegroupstaggingapi(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/resourcegroupstaggingapi/2017-01-26(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/route53(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/route53/2013-04-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/route53domains(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/route53domains/2014-05-15(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/runtime.lex(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/runtime.lex/2016-11-28(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/s3(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/s3/2006-03-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/sdb(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/sdb/2009-04-15(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/servicecatalog(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/servicecatalog/2015-12-10(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/shield(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/shield/2016-06-02(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/sms(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/sms/2016-10-24(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/snowball(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/snowball/2016-06-30(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/sns(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/sns/2010-03-31(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/sqs(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/sqs/2012-11-05(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ssm(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/ssm/2014-11-06(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/states(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/states/2016-11-23(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/storagegateway(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/storagegateway/2013-06-30(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/streams.dynamodb(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/streams.dynamodb/2012-08-10(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/sts(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/sts/2011-06-15(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/support(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/support/2013-04-15(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/swf(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/swf/2012-01-25(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/waf(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/waf-regional(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/waf-regional/2016-11-28(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/waf/2015-08-24(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/workdocs(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/workdocs/2016-05-01(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/workspaces(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/workspaces/2015-04-08(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/xray(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/apis/xray/2016-04-12(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/customizations(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/endpoints(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/protocol_tests(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/protocol_tests/input(/.*)?$
vendor/github.com/aws/aws-sdk-go/models/protocol_tests/output(/.*)?$
vendor/github.com/aws/aws-sdk-go/private(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/model(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/model/api(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/model/cli(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/model/cli/api-info(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/model/cli/gen-api(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/model/cli/gen-endpoints(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/protocol(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/protocol/ec2query(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/protocol/json(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/protocol/json/jsonutil(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/protocol/jsonrpc(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/protocol/query(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/protocol/query/queryutil(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/protocol/rest(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/protocol/restjson(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/protocol/restxml(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/protocol/xml(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/protocol/xml/xmlutil(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/signer(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/signer/v2(/.*)?$
vendor/github.com/aws/aws-sdk-go/private/util(/.*)?$
vendor/github.com/aws/aws-sdk-go/service(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/acm(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/acm/acmiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/apigateway(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/apigateway/apigatewayiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/applicationautoscaling(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/applicationautoscaling/applicationautoscalingiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/applicationdiscoveryservice(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/applicationdiscoveryservice/applicationdiscoveryserviceiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/appstream(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/appstream/appstreamiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/athena(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/athena/athenaiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/autoscaling(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/autoscaling/autoscalingiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/batch(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/batch/batchiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/budgets(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/budgets/budgetsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/clouddirectory(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/clouddirectory/clouddirectoryiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudformation(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudformation/cloudformationiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudfront(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudfront/cloudfrontiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudfront/sign(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudhsm(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudhsm/cloudhsmiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudsearch(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudsearch/cloudsearchiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudsearchdomain(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudsearchdomain/cloudsearchdomainiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudtrail(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudtrail/cloudtrailiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudwatch(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudwatch/cloudwatchiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudwatchevents(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudwatchevents/cloudwatcheventsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudwatchlogs(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cloudwatchlogs/cloudwatchlogsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/codebuild(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/codebuild/codebuildiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/codecommit(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/codecommit/codecommitiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/codedeploy(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/codedeploy/codedeployiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/codepipeline(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/codepipeline/codepipelineiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/codestar(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/codestar/codestariface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cognitoidentity(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cognitoidentity/cognitoidentityiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cognitoidentityprovider(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cognitoidentityprovider/cognitoidentityprovideriface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cognitosync(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/cognitosync/cognitosynciface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/configservice(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/configservice/configserviceiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/costandusagereportservice(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/costandusagereportservice/costandusagereportserviceiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/databasemigrationservice(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/databasemigrationservice/databasemigrationserviceiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/datapipeline(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/datapipeline/datapipelineiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/dax(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/dax/daxiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/devicefarm(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/devicefarm/devicefarmiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/directconnect(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/directconnect/directconnectiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/directoryservice(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/directoryservice/directoryserviceiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/dynamodb(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/dynamodb/dynamodbattribute(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/dynamodb/dynamodbiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/dynamodbstreams(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/dynamodbstreams/dynamodbstreamsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/ec2(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/ec2/ec2iface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/ecr(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/ecr/ecriface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/ecs(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/ecs/ecsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/efs(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/efs/efsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/elasticache(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/elasticache/elasticacheiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/elasticbeanstalk(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/elasticbeanstalk/elasticbeanstalkiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/elasticsearchservice(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/elasticsearchservice/elasticsearchserviceiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/elastictranscoder(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/elastictranscoder/elastictranscoderiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/elb(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/elb/elbiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/elbv2(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/elbv2/elbv2iface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/emr(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/emr/emriface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/firehose(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/firehose/firehoseiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/gamelift(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/gamelift/gameliftiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/glacier(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/glacier/glacieriface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/greengrass(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/greengrass/greengrassiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/health(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/health/healthiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/iam(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/iam/iamiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/inspector(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/inspector/inspectoriface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/iot(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/iot/iotiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/iotdataplane(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/iotdataplane/iotdataplaneiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/kinesis(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/kinesis/kinesisiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/kinesisanalytics(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/kinesisanalytics/kinesisanalyticsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/kms(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/kms/kmsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/lambda(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/lambda/lambdaiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/lexmodelbuildingservice(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/lexmodelbuildingservice/lexmodelbuildingserviceiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/lexruntimeservice(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/lexruntimeservice/lexruntimeserviceiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/lightsail(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/lightsail/lightsailiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/machinelearning(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/machinelearning/machinelearningiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/marketplacecommerceanalytics(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/marketplacecommerceanalytics/marketplacecommerceanalyticsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/marketplaceentitlementservice(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/marketplaceentitlementservice/marketplaceentitlementserviceiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/marketplacemetering(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/marketplacemetering/marketplacemeteringiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/mobileanalytics(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/mobileanalytics/mobileanalyticsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/mturk(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/mturk/mturkiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/opsworks(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/opsworks/opsworksiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/opsworkscm(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/opsworkscm/opsworkscmiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/organizations(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/organizations/organizationsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/pinpoint(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/pinpoint/pinpointiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/polly(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/polly/pollyiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/rds(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/rds/rdsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/rds/rdsutils(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/redshift(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/redshift/redshiftiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/rekognition(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/rekognition/rekognitioniface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/resourcegroupstaggingapi(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/resourcegroupstaggingapi/resourcegroupstaggingapiiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/route53(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/route53/route53iface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/route53domains(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/route53domains/route53domainsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/s3(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/s3/s3crypto(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/s3/s3iface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/s3/s3manager(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/s3/s3manager/s3manageriface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/servicecatalog(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/servicecatalog/servicecatalogiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/ses(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/ses/sesiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/sfn(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/sfn/sfniface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/shield(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/shield/shieldiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/simpledb(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/simpledb/simpledbiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/sms(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/sms/smsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/snowball(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/snowball/snowballiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/sns(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/sns/snsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/sqs(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/sqs/sqsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/ssm(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/ssm/ssmiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/storagegateway(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/storagegateway/storagegatewayiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/sts(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/sts/stsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/support(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/support/supportiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/swf(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/swf/swfiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/waf(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/waf/wafiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/wafregional(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/wafregional/wafregionaliface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/workdocs(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/workdocs/workdocsiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/workspaces(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/workspaces/workspacesiface(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/xray(/.*)?$
vendor/github.com/aws/aws-sdk-go/service/xray/xrayiface(/.*)?$
vendor/github.com/beorn7(/.*)?$
vendor/github.com/beorn7/perks(/.*)?$
vendor/github.com/beorn7/perks/histogram(/.*)?$
vendor/github.com/beorn7/perks/quantile(/.*)?$
vendor/github.com/beorn7/perks/topk(/.*)?$
vendor/github.com/davecgh(/.*)?$
vendor/github.com/davecgh/go-spew(/.*)?$
vendor/github.com/davecgh/go-spew/spew(/.*)?$
vendor/github.com/davecgh/go-spew/spew/testdata(/.*)?$
vendor/github.com/dgrijalva(/.*)?$
vendor/github.com/dgrijalva/jwt-go(/.*)?$
vendor/github.com/dgrijalva/jwt-go/cmd(/.*)?$
vendor/github.com/dgrijalva/jwt-go/cmd/jwt(/.*)?$
vendor/github.com/dgrijalva/jwt-go/request(/.*)?$
vendor/github.com/dgrijalva/jwt-go/test(/.*)?$
vendor/github.com/fatih(/.*)?$
vendor/github.com/fatih/structs(/.*)?$
vendor/github.com/ghodss(/.*)?$
vendor/github.com/ghodss/yaml(/.*)?$
vendor/github.com/go-ini(/.*)?$
vendor/github.com/go-ini/ini(/.*)?$
vendor/github.com/go-ini/ini/testdata(/.*)?$
vendor/github.com/gogo(/.*)?$
vendor/github.com/gogo/protobuf(/.*)?$
vendor/github.com/gogo/protobuf/_conformance(/.*)?$
vendor/github.com/gogo/protobuf/_conformance/conformance_proto(/.*)?$
vendor/github.com/gogo/protobuf/codec(/.*)?$
vendor/github.com/gogo/protobuf/gogoproto(/.*)?$
vendor/github.com/gogo/protobuf/gogoreplace(/.*)?$
vendor/github.com/gogo/protobuf/io(/.*)?$
vendor/github.com/gogo/protobuf/jsonpb(/.*)?$
vendor/github.com/gogo/protobuf/jsonpb/jsonpb_test_proto(/.*)?$
vendor/github.com/gogo/protobuf/plugin(/.*)?$
vendor/github.com/gogo/protobuf/plugin/compare(/.*)?$
vendor/github.com/gogo/protobuf/plugin/defaultcheck(/.*)?$
vendor/github.com/gogo/protobuf/plugin/description(/.*)?$
vendor/github.com/gogo/protobuf/plugin/embedcheck(/.*)?$
vendor/github.com/gogo/protobuf/plugin/enumstringer(/.*)?$
vendor/github.com/gogo/protobuf/plugin/equal(/.*)?$
vendor/github.com/gogo/protobuf/plugin/face(/.*)?$
vendor/github.com/gogo/protobuf/plugin/gostring(/.*)?$
vendor/github.com/gogo/protobuf/plugin/marshalto(/.*)?$
vendor/github.com/gogo/protobuf/plugin/oneofcheck(/.*)?$
vendor/github.com/gogo/protobuf/plugin/populate(/.*)?$
vendor/github.com/gogo/protobuf/plugin/size(/.*)?$
vendor/github.com/gogo/protobuf/plugin/stringer(/.*)?$
vendor/github.com/gogo/protobuf/plugin/testgen(/.*)?$
vendor/github.com/gogo/protobuf/plugin/union(/.*)?$
vendor/github.com/gogo/protobuf/plugin/unmarshal(/.*)?$
vendor/github.com/gogo/protobuf/proto(/.*)?$
vendor/github.com/gogo/protobuf/proto/proto3_proto(/.*)?$
vendor/github.com/gogo/protobuf/proto/testdata(/.*)?$
vendor/github.com/gogo/protobuf/protobuf(/.*)?$
vendor/github.com/gogo/protobuf/protobuf/google(/.*)?$
vendor/github.com/gogo/protobuf/protobuf/google/protobuf(/.*)?$
vendor/github.com/gogo/protobuf/protobuf/google/protobuf/compiler(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-combo(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gofast(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gogo(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gogo/descriptor(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gogo/generator(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gogo/grpc(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gogo/plugin(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gogo/testdata(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gogo/testdata/multi(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gogo/testdata/my_test(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gogofast(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gogofaster(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gogoslick(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gogotypes(/.*)?$
vendor/github.com/gogo/protobuf/protoc-gen-gostring(/.*)?$
vendor/github.com/gogo/protobuf/protoc-min-version(/.*)?$
vendor/github.com/gogo/protobuf/sortkeys(/.*)?$
vendor/github.com/gogo/protobuf/test(/.*)?$
vendor/github.com/gogo/protobuf/test/asymetric-issue125(/.*)?$
vendor/github.com/gogo/protobuf/test/casttype(/.*)?$
vendor/github.com/gogo/protobuf/test/casttype/combos(/.*)?$
vendor/github.com/gogo/protobuf/test/casttype/combos/both(/.*)?$
vendor/github.com/gogo/protobuf/test/casttype/combos/marshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/casttype/combos/neither(/.*)?$
vendor/github.com/gogo/protobuf/test/casttype/combos/unmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/casttype/combos/unsafeboth(/.*)?$
vendor/github.com/gogo/protobuf/test/casttype/combos/unsafemarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/casttype/combos/unsafeunmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/castvalue(/.*)?$
vendor/github.com/gogo/protobuf/test/castvalue/combos(/.*)?$
vendor/github.com/gogo/protobuf/test/castvalue/combos/both(/.*)?$
vendor/github.com/gogo/protobuf/test/castvalue/combos/marshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/castvalue/combos/unmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/castvalue/combos/unsafeboth(/.*)?$
vendor/github.com/gogo/protobuf/test/castvalue/combos/unsafemarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/castvalue/combos/unsafeunmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/combos(/.*)?$
vendor/github.com/gogo/protobuf/test/combos/both(/.*)?$
vendor/github.com/gogo/protobuf/test/combos/marshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/combos/unmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/combos/unsafeboth(/.*)?$
vendor/github.com/gogo/protobuf/test/combos/unsafemarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/combos/unsafeunmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/custom(/.*)?$
vendor/github.com/gogo/protobuf/test/custom-dash-type(/.*)?$
vendor/github.com/gogo/protobuf/test/custombytesnonstruct(/.*)?$
vendor/github.com/gogo/protobuf/test/dashfilename(/.*)?$
vendor/github.com/gogo/protobuf/test/data(/.*)?$
vendor/github.com/gogo/protobuf/test/defaultconflict(/.*)?$
vendor/github.com/gogo/protobuf/test/embedconflict(/.*)?$
vendor/github.com/gogo/protobuf/test/empty-issue70(/.*)?$
vendor/github.com/gogo/protobuf/test/enumcustomname(/.*)?$
vendor/github.com/gogo/protobuf/test/enumdecl(/.*)?$
vendor/github.com/gogo/protobuf/test/enumdecl_all(/.*)?$
vendor/github.com/gogo/protobuf/test/enumprefix(/.*)?$
vendor/github.com/gogo/protobuf/test/enumstringer(/.*)?$
vendor/github.com/gogo/protobuf/test/example(/.*)?$
vendor/github.com/gogo/protobuf/test/filedotname(/.*)?$
vendor/github.com/gogo/protobuf/test/fuzztests(/.*)?$
vendor/github.com/gogo/protobuf/test/group(/.*)?$
vendor/github.com/gogo/protobuf/test/importdedup(/.*)?$
vendor/github.com/gogo/protobuf/test/importdedup/subpkg(/.*)?$
vendor/github.com/gogo/protobuf/test/indeximport-issue72(/.*)?$
vendor/github.com/gogo/protobuf/test/indeximport-issue72/index(/.*)?$
vendor/github.com/gogo/protobuf/test/issue260(/.*)?$
vendor/github.com/gogo/protobuf/test/issue261(/.*)?$
vendor/github.com/gogo/protobuf/test/issue262(/.*)?$
vendor/github.com/gogo/protobuf/test/issue34(/.*)?$
vendor/github.com/gogo/protobuf/test/issue42order(/.*)?$
vendor/github.com/gogo/protobuf/test/issue8(/.*)?$
vendor/github.com/gogo/protobuf/test/mapsproto2(/.*)?$
vendor/github.com/gogo/protobuf/test/mapsproto2/combos(/.*)?$
vendor/github.com/gogo/protobuf/test/mapsproto2/combos/both(/.*)?$
vendor/github.com/gogo/protobuf/test/mapsproto2/combos/marshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/mapsproto2/combos/neither(/.*)?$
vendor/github.com/gogo/protobuf/test/mapsproto2/combos/unmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/mapsproto2/combos/unsafeboth(/.*)?$
vendor/github.com/gogo/protobuf/test/mapsproto2/combos/unsafemarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/mapsproto2/combos/unsafeunmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/mixbench(/.*)?$
vendor/github.com/gogo/protobuf/test/moredefaults(/.*)?$
vendor/github.com/gogo/protobuf/test/nopackage(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof/combos(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof/combos/both(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof/combos/marshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof/combos/neither(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof/combos/unmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof/combos/unsafeboth(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof/combos/unsafemarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof/combos/unsafeunmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof3(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof3/combos(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof3/combos/both(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof3/combos/marshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof3/combos/neither(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof3/combos/unmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof3/combos/unsafeboth(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof3/combos/unsafemarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/oneof3/combos/unsafeunmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/oneofembed(/.*)?$
vendor/github.com/gogo/protobuf/test/packed(/.*)?$
vendor/github.com/gogo/protobuf/test/proto3extension(/.*)?$
vendor/github.com/gogo/protobuf/test/protosize(/.*)?$
vendor/github.com/gogo/protobuf/test/registration(/.*)?$
vendor/github.com/gogo/protobuf/test/required(/.*)?$
vendor/github.com/gogo/protobuf/test/sizerconflict(/.*)?$
vendor/github.com/gogo/protobuf/test/sizeunderscore(/.*)?$
vendor/github.com/gogo/protobuf/test/stdtypes(/.*)?$
vendor/github.com/gogo/protobuf/test/tags(/.*)?$
vendor/github.com/gogo/protobuf/test/theproto3(/.*)?$
vendor/github.com/gogo/protobuf/test/theproto3/combos(/.*)?$
vendor/github.com/gogo/protobuf/test/theproto3/combos/both(/.*)?$
vendor/github.com/gogo/protobuf/test/theproto3/combos/marshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/theproto3/combos/neither(/.*)?$
vendor/github.com/gogo/protobuf/test/theproto3/combos/unmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/theproto3/combos/unsafeboth(/.*)?$
vendor/github.com/gogo/protobuf/test/theproto3/combos/unsafemarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/theproto3/combos/unsafeunmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/typedecl(/.*)?$
vendor/github.com/gogo/protobuf/test/typedecl_all(/.*)?$
vendor/github.com/gogo/protobuf/test/types(/.*)?$
vendor/github.com/gogo/protobuf/test/types/combos(/.*)?$
vendor/github.com/gogo/protobuf/test/types/combos/both(/.*)?$
vendor/github.com/gogo/protobuf/test/types/combos/marshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/types/combos/neither(/.*)?$
vendor/github.com/gogo/protobuf/test/types/combos/unmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/types/combos/unsafeboth(/.*)?$
vendor/github.com/gogo/protobuf/test/types/combos/unsafemarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/types/combos/unsafeunmarshaler(/.*)?$
vendor/github.com/gogo/protobuf/test/unmarshalmerge(/.*)?$
vendor/github.com/gogo/protobuf/test/unrecognized(/.*)?$
vendor/github.com/gogo/protobuf/test/unrecognizedgroup(/.*)?$
vendor/github.com/gogo/protobuf/types(/.*)?$
vendor/github.com/gogo/protobuf/vanity(/.*)?$
vendor/github.com/gogo/protobuf/vanity/command(/.*)?$
vendor/github.com/gogo/protobuf/vanity/test(/.*)?$
vendor/github.com/gogo/protobuf/vanity/test/fast(/.*)?$
vendor/github.com/gogo/protobuf/vanity/test/faster(/.*)?$
vendor/github.com/gogo/protobuf/vanity/test/gofast(/.*)?$
vendor/github.com/gogo/protobuf/vanity/test/slick(/.*)?$
vendor/github.com/gogo/protobuf/version(/.*)?$
vendor/github.com/golang(/.*)?$
vendor/github.com/golang/glog(/.*)?$
vendor/github.com/golang/groupcache(/.*)?$
vendor/github.com/golang/groupcache/consistenthash(/.*)?$
vendor/github.com/golang/groupcache/groupcachepb(/.*)?$
vendor/github.com/golang/groupcache/lru(/.*)?$
vendor/github.com/golang/groupcache/singleflight(/.*)?$
vendor/github.com/golang/groupcache/testpb(/.*)?$
vendor/github.com/golang/protobuf(/.*)?$
vendor/github.com/golang/protobuf/_conformance(/.*)?$
vendor/github.com/golang/protobuf/_conformance/conformance_proto(/.*)?$
vendor/github.com/golang/protobuf/descriptor(/.*)?$
vendor/github.com/golang/protobuf/jsonpb(/.*)?$
vendor/github.com/golang/protobuf/jsonpb/jsonpb_test_proto(/.*)?$
vendor/github.com/golang/protobuf/proto(/.*)?$
vendor/github.com/golang/protobuf/proto/proto3_proto(/.*)?$
vendor/github.com/golang/protobuf/proto/testdata(/.*)?$
vendor/github.com/golang/protobuf/protoc-gen-go(/.*)?$
vendor/github.com/golang/protobuf/protoc-gen-go/descriptor(/.*)?$
vendor/github.com/golang/protobuf/protoc-gen-go/generator(/.*)?$
vendor/github.com/golang/protobuf/protoc-gen-go/grpc(/.*)?$
vendor/github.com/golang/protobuf/protoc-gen-go/plugin(/.*)?$
vendor/github.com/golang/protobuf/protoc-gen-go/testdata(/.*)?$
vendor/github.com/golang/protobuf/protoc-gen-go/testdata/multi(/.*)?$
vendor/github.com/golang/protobuf/protoc-gen-go/testdata/my_test(/.*)?$
vendor/github.com/golang/protobuf/ptypes(/.*)?$
vendor/github.com/golang/protobuf/ptypes/any(/.*)?$
vendor/github.com/golang/protobuf/ptypes/duration(/.*)?$
vendor/github.com/golang/protobuf/ptypes/empty(/.*)?$
vendor/github.com/golang/protobuf/ptypes/struct(/.*)?$
vendor/github.com/golang/protobuf/ptypes/timestamp(/.*)?$
vendor/github.com/golang/protobuf/ptypes/wrappers(/.*)?$
vendor/github.com/golang/snappy(/.*)?$
vendor/github.com/golang/snappy/cmd(/.*)?$
vendor/github.com/golang/snappy/cmd/snappytool(/.*)?$
vendor/github.com/golang/snappy/testdata(/.*)?$
vendor/github.com/google(/.*)?$
vendor/github.com/google/gofuzz(/.*)?$
vendor/github.com/googleapis(/.*)?$
vendor/github.com/googleapis/gnostic(/.*)?$
vendor/github.com/googleapis/gnostic/OpenAPIv2(/.*)?$
vendor/github.com/googleapis/gnostic/OpenAPIv3(/.*)?$
vendor/github.com/googleapis/gnostic/OpenAPIv3/schema-generator(/.*)?$
vendor/github.com/googleapis/gnostic/apps(/.*)?$
vendor/github.com/googleapis/gnostic/apps/petstore-builder(/.*)?$
vendor/github.com/googleapis/gnostic/apps/report(/.*)?$
vendor/github.com/googleapis/gnostic/compiler(/.*)?$
vendor/github.com/googleapis/gnostic/examples(/.*)?$
vendor/github.com/googleapis/gnostic/examples/errors(/.*)?$
vendor/github.com/googleapis/gnostic/examples/v2.0(/.*)?$
vendor/github.com/googleapis/gnostic/examples/v2.0/json(/.*)?$
vendor/github.com/googleapis/gnostic/examples/v2.0/json/petstore-separate(/.*)?$
vendor/github.com/googleapis/gnostic/examples/v2.0/json/petstore-separate/common(/.*)?$
vendor/github.com/googleapis/gnostic/examples/v2.0/json/petstore-separate/spec(/.*)?$
vendor/github.com/googleapis/gnostic/examples/v2.0/yaml(/.*)?$
vendor/github.com/googleapis/gnostic/examples/v2.0/yaml/petstore-separate(/.*)?$
vendor/github.com/googleapis/gnostic/examples/v2.0/yaml/petstore-separate/common(/.*)?$
vendor/github.com/googleapis/gnostic/examples/v2.0/yaml/petstore-separate/spec(/.*)?$
vendor/github.com/googleapis/gnostic/examples/v3.0(/.*)?$
vendor/github.com/googleapis/gnostic/examples/v3.0/json(/.*)?$
vendor/github.com/googleapis/gnostic/examples/v3.0/yaml(/.*)?$
vendor/github.com/googleapis/gnostic/extensions(/.*)?$
vendor/github.com/googleapis/gnostic/extensions/sample(/.*)?$
vendor/github.com/googleapis/gnostic/generate-gnostic(/.*)?$
vendor/github.com/googleapis/gnostic/generate-gnostic/test(/.*)?$
vendor/github.com/googleapis/gnostic/generate-gnostic/test/errors(/.*)?$
vendor/github.com/googleapis/gnostic/jsonschema(/.*)?$
vendor/github.com/googleapis/gnostic/jsonwriter(/.*)?$
vendor/github.com/googleapis/gnostic/plugins(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-analyze(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-analyze/statistics(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-analyze/summarize(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-go-generator(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-go-generator/encode-templates(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-go-generator/examples(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-go-generator/examples/v2.0(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-go-generator/examples/v2.0/apis_guru(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-go-generator/examples/v2.0/bookstore(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-go-generator/examples/v2.0/bookstore/service(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-go-generator/examples/v2.0/xkcd(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-go-generator/templates(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-go-sample(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-generator(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-generator/Sources(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-generator/Sources/TemplateEncoder(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-generator/Sources/gnostic-swift-generator(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-generator/Templates(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-generator/examples(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-generator/examples/bookstore(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-generator/examples/bookstore/Sources(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-generator/examples/bookstore/Sources/Server(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-generator/examples/bookstore/Tests(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-generator/examples/bookstore/Tests/BookstoreTests(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-sample(/.*)?$
vendor/github.com/googleapis/gnostic/plugins/gnostic-swift-sample/Sources(/.*)?$
vendor/github.com/googleapis/gnostic/printer(/.*)?$
vendor/github.com/googleapis/gnostic/test(/.*)?$
vendor/github.com/googleapis/gnostic/test/errors(/.*)?$
vendor/github.com/googleapis/gnostic/test/v2.0(/.*)?$
vendor/github.com/googleapis/gnostic/test/v2.0/yaml(/.*)?$
vendor/github.com/googleapis/gnostic/test/v2.0/yaml/petstore-separate(/.*)?$
vendor/github.com/googleapis/gnostic/test/v2.0/yaml/petstore-separate/spec(/.*)?$
vendor/github.com/googleapis/gnostic/test/v3.0(/.*)?$
vendor/github.com/googleapis/gnostic/tools(/.*)?$
vendor/github.com/googleapis/gnostic/tools/format-schema(/.*)?$
vendor/github.com/googleapis/gnostic/tools/j2y2j(/.*)?$
vendor/github.com/gophercloud(/.*)?$
vendor/github.com/gophercloud/gophercloud(/.*)?$
vendor/github.com/gophercloud/gophercloud/.github(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/clients(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/blockstorage(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/blockstorage/extensions(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/blockstorage/noauth(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/blockstorage/v1(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/blockstorage/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/compute(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/compute/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/db(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/db/v1(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/dns(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/dns/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/identity(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/identity/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/identity/v3(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/imageservice(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/imageservice/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/networking(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/networking/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/networking/v2/extensions(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/networking/v2/extensions/fwaas(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/networking/v2/extensions/layer3(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/networking/v2/extensions/lbaas(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/networking/v2/extensions/lbaas_v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/networking/v2/extensions/portsbinding(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/objectstorage(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/objectstorage/v1(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/orchestration(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/orchestration/v1(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/sharedfilesystems(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/openstack/sharedfilesystems/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/acceptance/tools(/.*)?$
vendor/github.com/gophercloud/gophercloud/internal(/.*)?$
vendor/github.com/gophercloud/gophercloud/internal/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/extensions(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/extensions/schedulerstats(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/extensions/schedulerstats/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/extensions/volumeactions(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/extensions/volumeactions/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/extensions/volumetenants(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/noauth(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/noauth/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v1(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v1/apiversions(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v1/apiversions/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v1/snapshots(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v1/snapshots/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v1/volumes(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v1/volumes/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v1/volumetypes(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v1/volumetypes/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v2/snapshots(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v2/snapshots/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v2/volumes(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/blockstorage/v2/volumes/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/cdn(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/cdn/v1(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/cdn/v1/base(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/cdn/v1/base/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/cdn/v1/flavors(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/cdn/v1/flavors/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/cdn/v1/serviceassets(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/cdn/v1/serviceassets/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/cdn/v1/services(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/cdn/v1/services/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/common(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/common/extensions(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/common/extensions/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/attachinterfaces(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/attachinterfaces/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/availabilityzones(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/bootfromvolume(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/bootfromvolume/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/defsecrules(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/defsecrules/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/diskconfig(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/diskconfig/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/evacuate(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/evacuate/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/floatingips(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/floatingips/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/hypervisors(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/hypervisors/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/keypairs(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/keypairs/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/limits(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/limits/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/lockunlock(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/lockunlock/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/migrate(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/migrate/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/networks(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/networks/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/pauseunpause(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/pauseunpause/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/quotasets(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/quotasets/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/resetstate(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/resetstate/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/schedulerhints(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/schedulerhints/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/secgroups(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/secgroups/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/servergroups(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/servergroups/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/startstop(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/startstop/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/suspendresume(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/suspendresume/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/tenantnetworks(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/tenantnetworks/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/volumeattach(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/extensions/volumeattach/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/flavors(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/flavors/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/images(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/images/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/servers(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/compute/v2/servers/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1/configurations(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1/configurations/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1/databases(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1/databases/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1/datastores(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1/datastores/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1/flavors(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1/flavors/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1/instances(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1/instances/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1/users(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/db/v1/users/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/dns(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/dns/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/dns/v2/recordsets(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/dns/v2/recordsets/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/dns/v2/zones(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/dns/v2/zones/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v2/extensions(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v2/extensions/admin(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v2/extensions/admin/roles(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v2/extensions/admin/roles/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v2/extensions/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v2/tenants(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v2/tenants/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v2/tokens(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v2/tokens/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v2/users(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v2/users/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/domains(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/domains/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/endpoints(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/endpoints/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/extensions(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/extensions/trusts(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/extensions/trusts/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/groups(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/groups/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/projects(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/projects/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/regions(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/regions/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/roles(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/roles/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/services(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/services/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/tokens(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/tokens/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/users(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/identity/v3/users/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/imageservice(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/imageservice/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/imageservice/v2/imagedata(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/imageservice/v2/imagedata/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/imageservice/v2/images(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/imageservice/v2/images/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/imageservice/v2/members(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/imageservice/v2/members/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/apiversions(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/apiversions/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/common(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/external(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/external/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/fwaas(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/fwaas/firewalls(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/fwaas/firewalls/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/fwaas/policies(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/fwaas/policies/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/fwaas/routerinsertion(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/fwaas/routerinsertion/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/fwaas/rules(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/fwaas/rules/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/layer3(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/layer3/floatingips(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/layer3/floatingips/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/layer3/routers(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/layer3/routers/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas/members(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas/members/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas/monitors(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas/monitors/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas/pools(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas/pools/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas/vips(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas/vips/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas_v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas_v2/listeners(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas_v2/listeners/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas_v2/loadbalancers(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas_v2/loadbalancers/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas_v2/monitors(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas_v2/monitors/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas_v2/pools(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/lbaas_v2/pools/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/portsbinding(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/portsbinding/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/provider(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/provider/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/security(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/security/groups(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/security/groups/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/security/rules(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/security/rules/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/extensions/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/networks(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/networks/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/ports(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/ports/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/subnets(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/networking/v2/subnets/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/objectstorage(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/objectstorage/v1(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/objectstorage/v1/accounts(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/objectstorage/v1/accounts/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/objectstorage/v1/containers(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/objectstorage/v1/containers/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/objectstorage/v1/objects(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/objectstorage/v1/objects/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/objectstorage/v1/swauth(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/objectstorage/v1/swauth/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1/apiversions(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1/apiversions/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1/buildinfo(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1/buildinfo/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1/stackevents(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1/stackevents/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1/stackresources(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1/stackresources/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1/stacks(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1/stacks/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1/stacktemplates(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/orchestration/v1/stacktemplates/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/apiversions(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/apiversions/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/v2(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/v2/availabilityzones(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/v2/availabilityzones/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/v2/securityservices(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/v2/securityservices/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/v2/sharenetworks(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/v2/sharenetworks/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/v2/shares(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/v2/shares/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/v2/sharetypes(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/sharedfilesystems/v2/sharetypes/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/utils(/.*)?$
vendor/github.com/gophercloud/gophercloud/openstack/utils/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/pagination(/.*)?$
vendor/github.com/gophercloud/gophercloud/pagination/testing(/.*)?$
vendor/github.com/gophercloud/gophercloud/script(/.*)?$
vendor/github.com/gophercloud/gophercloud/testhelper(/.*)?$
vendor/github.com/gophercloud/gophercloud/testhelper/client(/.*)?$
vendor/github.com/gophercloud/gophercloud/testhelper/fixture(/.*)?$
vendor/github.com/gophercloud/gophercloud/testing(/.*)?$
vendor/github.com/gorilla(/.*)?$
vendor/github.com/gorilla/context(/.*)?$
vendor/github.com/gorilla/mux(/.*)?$
vendor/github.com/hashicorp(/.*)?$
vendor/github.com/hashicorp/errwrap(/.*)?$
vendor/github.com/hashicorp/go-cleanhttp(/.*)?$
vendor/github.com/hashicorp/go-multierror(/.*)?$
vendor/github.com/hashicorp/go-multierror/scripts(/.*)?$
vendor/github.com/hashicorp/go-rootcerts(/.*)?$
vendor/github.com/hashicorp/go-rootcerts/test-fixtures(/.*)?$
vendor/github.com/hashicorp/go-rootcerts/test-fixtures/cafile(/.*)?$
vendor/github.com/hashicorp/go-rootcerts/test-fixtures/capath(/.*)?$
vendor/github.com/hashicorp/go-rootcerts/test-fixtures/capath-with-symlinks(/.*)?$
vendor/github.com/hashicorp/golang-lru(/.*)?$
vendor/github.com/hashicorp/golang-lru/simplelru(/.*)?$
vendor/github.com/hashicorp/hcl(/.*)?$
vendor/github.com/hashicorp/hcl/.github(/.*)?$
vendor/github.com/hashicorp/hcl/hcl(/.*)?$
vendor/github.com/hashicorp/hcl/hcl/ast(/.*)?$
vendor/github.com/hashicorp/hcl/hcl/fmtcmd(/.*)?$
vendor/github.com/hashicorp/hcl/hcl/fmtcmd/test-fixtures(/.*)?$
vendor/github.com/hashicorp/hcl/hcl/parser(/.*)?$
vendor/github.com/hashicorp/hcl/hcl/parser/test-fixtures(/.*)?$
vendor/github.com/hashicorp/hcl/hcl/printer(/.*)?$
vendor/github.com/hashicorp/hcl/hcl/printer/testdata(/.*)?$
vendor/github.com/hashicorp/hcl/hcl/scanner(/.*)?$
vendor/github.com/hashicorp/hcl/hcl/strconv(/.*)?$
vendor/github.com/hashicorp/hcl/hcl/test-fixtures(/.*)?$
vendor/github.com/hashicorp/hcl/hcl/token(/.*)?$
vendor/github.com/hashicorp/hcl/json(/.*)?$
vendor/github.com/hashicorp/hcl/json/parser(/.*)?$
vendor/github.com/hashicorp/hcl/json/parser/test-fixtures(/.*)?$
vendor/github.com/hashicorp/hcl/json/scanner(/.*)?$
vendor/github.com/hashicorp/hcl/json/test-fixtures(/.*)?$
vendor/github.com/hashicorp/hcl/json/token(/.*)?$
vendor/github.com/hashicorp/hcl/test-fixtures(/.*)?$
vendor/github.com/hashicorp/hcl/testhelper(/.*)?$
vendor/github.com/hashicorp/vault(/.*)?$
vendor/github.com/hashicorp/vault/api(/.*)?$
vendor/github.com/hashicorp/vault/helper(/.*)?$
vendor/github.com/hashicorp/vault/helper/certutil(/.*)?$
vendor/github.com/hashicorp/vault/helper/compressutil(/.*)?$
vendor/github.com/hashicorp/vault/helper/errutil(/.*)?$
vendor/github.com/hashicorp/vault/helper/jsonutil(/.*)?$
vendor/github.com/hashicorp/vault/helper/parseutil(/.*)?$
vendor/github.com/hashicorp/vault/helper/strutil(/.*)?$
vendor/github.com/hashicorp/vault/website(/.*)?$
vendor/github.com/hashicorp/vault/website/source(/.*)?$
vendor/github.com/hashicorp/vault/website/source/api(/.*)?$
vendor/github.com/hashicorp/vault/website/source/api/system(/.*)?$
vendor/github.com/howeyc(/.*)?$
vendor/github.com/howeyc/gopass(/.*)?$
vendor/github.com/imdario(/.*)?$
vendor/github.com/imdario/mergo(/.*)?$
vendor/github.com/imdario/mergo/testdata(/.*)?$
vendor/github.com/inconshreveable(/.*)?$
vendor/github.com/inconshreveable/mousetrap(/.*)?$
vendor/github.com/jmespath(/.*)?$
vendor/github.com/jmespath/go-jmespath(/.*)?$
vendor/github.com/jmespath/go-jmespath/cmd(/.*)?$
vendor/github.com/jmespath/go-jmespath/cmd/jpgo(/.*)?$
vendor/github.com/jmespath/go-jmespath/compliance(/.*)?$
vendor/github.com/jmespath/go-jmespath/fuzz(/.*)?$
vendor/github.com/jmespath/go-jmespath/fuzz/corpus(/.*)?$
vendor/github.com/json-iterator(/.*)?$
vendor/github.com/json-iterator/go(/.*)?$
vendor/github.com/json-iterator/go/extra(/.*)?$
vendor/github.com/json-iterator/go/output_tests(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/array(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/array/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/array/byte(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/array/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/array/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/array/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/array/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/array/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/byte(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/map(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/map/int32_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/map/string_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_map(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_map/int32_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_map/string_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_slice(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_slice/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_slice/byte(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_slice/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_slice/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_slice/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_slice/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_slice/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_struct_various(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/ptr_uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/slice(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/slice/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/slice/byte(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/slice/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/slice/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/slice/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/slice/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/slice/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/struct_empty(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/struct_empty_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/struct_ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/struct_various(/.*)?$
vendor/github.com/json-iterator/go/output_tests/array/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/bool_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/byte(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/byte_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/float32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/float32_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/float64_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/int16(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/int16_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/int32_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/int64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/int8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/int8_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/string_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/uint16(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/uint16_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/uint32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/uint32_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/uint8_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/builtins/uintptr(/.*)?$
vendor/github.com/json-iterator/go/output_tests/caseless_unmarshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/json_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/json_marshal/string_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/json_marshal/struct(/.*)?$
vendor/github.com/json-iterator/go/output_tests/json_marshal/struct_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/json_marshal/struct_field(/.*)?$
vendor/github.com/json-iterator/go/output_tests/json_marshal/struct_field_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/int16(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/int16/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/int32/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/int64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/int64/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/int8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/int8/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/array_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/byte(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/map_string_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/ptr_array_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/ptr_bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/ptr_float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/ptr_int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/ptr_map_string_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/ptr_slice_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/ptr_struct_various(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/ptr_uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/slice_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/string_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/struct_empty(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/struct_empty_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/struct_ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/struct_various(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string_alias/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/string_alias/string_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/uint16(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/uint16/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/uint32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/uint32/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map/uint8/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map_key_text_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map_key_text_marshal/string_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/map_key_text_marshal/struct(/.*)?$
vendor/github.com/json-iterator/go/output_tests/partial_unmarshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/array(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/array/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/array/byte(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/array/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/array/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/array/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/array/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/array/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/byte(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/int64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/map(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/map/int32_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/map/string_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_array(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_array/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_array/byte(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_array/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_array/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_array/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_array/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_array/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_map(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_map/int32_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_map/string_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_slice(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_slice/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_slice/byte(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_slice/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_slice/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_slice/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_slice/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_slice/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_struct_various(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/ptr_uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/slice(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/slice/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/slice/byte(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/slice/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/slice/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/slice/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/slice/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/slice/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/struct_empty(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/struct_empty_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/struct_ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/struct_various(/.*)?$
vendor/github.com/json-iterator/go/output_tests/slice/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/json_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/map_string_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/ptr_float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/ptr_int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/ptr_map_string_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/ptr_slice_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/ptr_struct_various(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/slice_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/string_with_tag(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/struct_various(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/no_overlap/text_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/overlap(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/overlap/different_levels(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/overlap/ignore_deeper_level(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/overlap/same_level_1_both_tagged(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/overlap/same_level_1_no_tags(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/overlap/same_level_1_tagged(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/overlap/same_level_2_both_tagged(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/overlap/same_level_2_no_tags(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/anonymous/overlap/same_level_2_tagged(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/array(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/array/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/array/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/array/string_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/array/strings(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/array/struct_strings(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/empty(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/empty_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/everything(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/float64_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/float64s(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/float64s_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/int32_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/int32s(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/int32s_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/int64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/map(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/map/int32_ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/map/int32_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/map/int32_struct_strings(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/map/string_ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/map/string_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/map/string_struct_strings(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptr_float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptr_float64_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptr_int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptr_int32_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptr_ptr_struct_empty(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptr_ptr_struct_strings(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptr_string_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptr_struct_empty(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptr_struct_strings(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptrs_float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptrs_int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/ptrs_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/slice(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/slice/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/slice/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/slice/string_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/slice/strings(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/slice/struct_strings(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/string_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/strings(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/strings_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/struct(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/struct/empties(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/struct/empty(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/struct/empty_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/struct/float32s(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/struct/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/struct/float64_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/struct/int32s(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/struct/strings(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct/struct/strings_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/fieldname(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/fieldname/embedded(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/fieldname/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/fieldname/struct(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/embedded(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/float32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/map_string_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_float32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_map_string_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_slice_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_string/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_string_json_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_string_text_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_struct_json_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_struct_text_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/ptr_uint32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/slice_string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/string_json_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/string_text_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/struct(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/struct_json_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/struct_text_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/omitempty/uint32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/string/bool(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/string/byte(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/string/float32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/string/float64(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/string/int16(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/string/int32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/string/int8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/string/string(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/string/uint16(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/string/uint32(/.*)?$
vendor/github.com/json-iterator/go/output_tests/struct_tags/string/uint8(/.*)?$
vendor/github.com/json-iterator/go/output_tests/text_marshal(/.*)?$
vendor/github.com/json-iterator/go/output_tests/text_marshal/string_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/text_marshal/struct(/.*)?$
vendor/github.com/json-iterator/go/output_tests/text_marshal/struct_alias(/.*)?$
vendor/github.com/json-iterator/go/output_tests/text_marshal/struct_field(/.*)?$
vendor/github.com/json-iterator/go/output_tests/text_marshal/struct_field_alias(/.*)?$
vendor/github.com/json-iterator/go/skip_tests(/.*)?$
vendor/github.com/json-iterator/go/skip_tests/array(/.*)?$
vendor/github.com/json-iterator/go/skip_tests/number(/.*)?$
vendor/github.com/json-iterator/go/skip_tests/object(/.*)?$
vendor/github.com/json-iterator/go/skip_tests/string(/.*)?$
vendor/github.com/matttproud(/.*)?$
vendor/github.com/matttproud/golang_protobuf_extensions(/.*)?$
vendor/github.com/matttproud/golang_protobuf_extensions/ext(/.*)?$
vendor/github.com/matttproud/golang_protobuf_extensions/pbtest(/.*)?$
vendor/github.com/matttproud/golang_protobuf_extensions/pbutil(/.*)?$
vendor/github.com/miekg(/.*)?$
vendor/github.com/miekg/dns(/.*)?$
vendor/github.com/miekg/dns/dnsutil(/.*)?$
vendor/github.com/miekg/dns/idn(/.*)?$
vendor/github.com/mitchellh(/.*)?$
vendor/github.com/mitchellh/go-homedir(/.*)?$
vendor/github.com/mitchellh/mapstructure(/.*)?$
vendor/github.com/onsi(/.*)?$
vendor/github.com/onsi/ginkgo(/.*)?$
vendor/github.com/onsi/ginkgo/config(/.*)?$
vendor/github.com/onsi/ginkgo/extensions(/.*)?$
vendor/github.com/onsi/ginkgo/extensions/table(/.*)?$
vendor/github.com/onsi/ginkgo/ginkgo(/.*)?$
vendor/github.com/onsi/ginkgo/ginkgo/convert(/.*)?$
vendor/github.com/onsi/ginkgo/ginkgo/interrupthandler(/.*)?$
vendor/github.com/onsi/ginkgo/ginkgo/nodot(/.*)?$
vendor/github.com/onsi/ginkgo/ginkgo/testrunner(/.*)?$
vendor/github.com/onsi/ginkgo/ginkgo/testsuite(/.*)?$
vendor/github.com/onsi/ginkgo/ginkgo/watch(/.*)?$
vendor/github.com/onsi/ginkgo/integration(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/convert_fixtures(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/convert_fixtures/nested(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/convert_fixtures/nested_without_gofiles(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/convert_fixtures/nested_without_gofiles/subpackage(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/convert_goldmasters(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/coverage_fixture(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/coverage_fixture/external_coverage_fixture(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/does_not_compile(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/eventually_failing(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/exiting_synchronized_setup_tests(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/fail_fixture(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/failing_after_suite(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/failing_before_suite(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/failing_ginkgo_tests(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/flags_tests(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/focused_fixture(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/hanging_suite(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/more_ginkgo_tests(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/no_test_fn(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/no_tests(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/passing_ginkgo_tests(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/passing_suite_setup(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/progress_fixture(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/skip_fixture(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/suite_command_tests(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/synchronized_setup_tests(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/tags_tests(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/test_description(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/watch_fixtures(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/watch_fixtures/A(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/watch_fixtures/B(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/watch_fixtures/C(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/watch_fixtures/D(/.*)?$
vendor/github.com/onsi/ginkgo/integration/_fixtures/xunit_tests(/.*)?$
vendor/github.com/onsi/ginkgo/internal(/.*)?$
vendor/github.com/onsi/ginkgo/internal/codelocation(/.*)?$
vendor/github.com/onsi/ginkgo/internal/containernode(/.*)?$
vendor/github.com/onsi/ginkgo/internal/failer(/.*)?$
vendor/github.com/onsi/ginkgo/internal/leafnodes(/.*)?$
vendor/github.com/onsi/ginkgo/internal/remote(/.*)?$
vendor/github.com/onsi/ginkgo/internal/spec(/.*)?$
vendor/github.com/onsi/ginkgo/internal/spec_iterator(/.*)?$
vendor/github.com/onsi/ginkgo/internal/specrunner(/.*)?$
vendor/github.com/onsi/ginkgo/internal/suite(/.*)?$
vendor/github.com/onsi/ginkgo/internal/testingtproxy(/.*)?$
vendor/github.com/onsi/ginkgo/internal/writer(/.*)?$
vendor/github.com/onsi/ginkgo/reporters(/.*)?$
vendor/github.com/onsi/ginkgo/reporters/stenographer(/.*)?$
vendor/github.com/onsi/ginkgo/reporters/stenographer/support(/.*)?$
vendor/github.com/onsi/ginkgo/reporters/stenographer/support/go-colorable(/.*)?$
vendor/github.com/onsi/ginkgo/reporters/stenographer/support/go-isatty(/.*)?$
vendor/github.com/onsi/ginkgo/types(/.*)?$
vendor/github.com/onsi/gomega(/.*)?$
vendor/github.com/onsi/gomega/format(/.*)?$
vendor/github.com/onsi/gomega/gbytes(/.*)?$
vendor/github.com/onsi/gomega/gexec(/.*)?$
vendor/github.com/onsi/gomega/gexec/_fixture(/.*)?$
vendor/github.com/onsi/gomega/gexec/_fixture/firefly(/.*)?$
vendor/github.com/onsi/gomega/ghttp(/.*)?$
vendor/github.com/onsi/gomega/ghttp/protobuf(/.*)?$
vendor/github.com/onsi/gomega/gstruct(/.*)?$
vendor/github.com/onsi/gomega/gstruct/errors(/.*)?$
vendor/github.com/onsi/gomega/internal(/.*)?$
vendor/github.com/onsi/gomega/internal/assertion(/.*)?$
vendor/github.com/onsi/gomega/internal/asyncassertion(/.*)?$
vendor/github.com/onsi/gomega/internal/fakematcher(/.*)?$
vendor/github.com/onsi/gomega/internal/oraclematcher(/.*)?$
vendor/github.com/onsi/gomega/internal/testingtsupport(/.*)?$
vendor/github.com/onsi/gomega/matchers(/.*)?$
vendor/github.com/onsi/gomega/matchers/support(/.*)?$
vendor/github.com/onsi/gomega/matchers/support/goraph(/.*)?$
vendor/github.com/onsi/gomega/matchers/support/goraph/bipartitegraph(/.*)?$
vendor/github.com/onsi/gomega/matchers/support/goraph/edge(/.*)?$
vendor/github.com/onsi/gomega/matchers/support/goraph/node(/.*)?$
vendor/github.com/onsi/gomega/matchers/support/goraph/util(/.*)?$
vendor/github.com/onsi/gomega/matchers/test_data(/.*)?$
vendor/github.com/onsi/gomega/matchers/test_data/xml(/.*)?$
vendor/github.com/onsi/gomega/types(/.*)?$
vendor/github.com/pborman(/.*)?$
vendor/github.com/pborman/uuid(/.*)?$
vendor/github.com/pkg(/.*)?$
vendor/github.com/pkg/errors(/.*)?$
vendor/github.com/pmezard(/.*)?$
vendor/github.com/pmezard/go-difflib(/.*)?$
vendor/github.com/pmezard/go-difflib/difflib(/.*)?$
vendor/github.com/prometheus(/.*)?$
vendor/github.com/prometheus/client_golang(/.*)?$
vendor/github.com/prometheus/client_golang/api(/.*)?$
vendor/github.com/prometheus/client_golang/api/prometheus(/.*)?$
vendor/github.com/prometheus/client_golang/examples(/.*)?$
vendor/github.com/prometheus/client_golang/examples/random(/.*)?$
vendor/github.com/prometheus/client_golang/examples/simple(/.*)?$
vendor/github.com/prometheus/client_golang/prometheus(/.*)?$
vendor/github.com/prometheus/client_golang/prometheus/promhttp(/.*)?$
vendor/github.com/prometheus/client_golang/prometheus/push(/.*)?$
vendor/github.com/prometheus/client_model(/.*)?$
vendor/github.com/prometheus/client_model/cpp(/.*)?$
vendor/github.com/prometheus/client_model/go(/.*)?$
vendor/github.com/prometheus/client_model/python(/.*)?$
vendor/github.com/prometheus/client_model/python/prometheus(/.*)?$
vendor/github.com/prometheus/client_model/python/prometheus/client(/.*)?$
vendor/github.com/prometheus/client_model/python/prometheus/client/model(/.*)?$
vendor/github.com/prometheus/client_model/ruby(/.*)?$
vendor/github.com/prometheus/client_model/ruby/lib(/.*)?$
vendor/github.com/prometheus/client_model/ruby/lib/prometheus(/.*)?$
vendor/github.com/prometheus/client_model/ruby/lib/prometheus/client(/.*)?$
vendor/github.com/prometheus/client_model/ruby/lib/prometheus/client/model(/.*)?$
vendor/github.com/prometheus/client_model/src(/.*)?$
vendor/github.com/prometheus/client_model/src/main(/.*)?$
vendor/github.com/prometheus/client_model/src/main/java(/.*)?$
vendor/github.com/prometheus/client_model/src/main/java/io(/.*)?$
vendor/github.com/prometheus/client_model/src/main/java/io/prometheus(/.*)?$
vendor/github.com/prometheus/client_model/src/main/java/io/prometheus/client(/.*)?$
vendor/github.com/prometheus/common(/.*)?$
vendor/github.com/prometheus/common/config(/.*)?$
vendor/github.com/prometheus/common/config/testdata(/.*)?$
vendor/github.com/prometheus/common/expfmt(/.*)?$
vendor/github.com/prometheus/common/expfmt/fuzz(/.*)?$
vendor/github.com/prometheus/common/expfmt/fuzz/corpus(/.*)?$
vendor/github.com/prometheus/common/expfmt/testdata(/.*)?$
vendor/github.com/prometheus/common/internal(/.*)?$
vendor/github.com/prometheus/common/internal/bitbucket.org(/.*)?$
vendor/github.com/prometheus/common/internal/bitbucket.org/ww(/.*)?$
vendor/github.com/prometheus/common/internal/bitbucket.org/ww/goautoneg(/.*)?$
vendor/github.com/prometheus/common/log(/.*)?$
vendor/github.com/prometheus/common/model(/.*)?$
vendor/github.com/prometheus/common/promlog(/.*)?$
vendor/github.com/prometheus/common/promlog/flag(/.*)?$
vendor/github.com/prometheus/common/route(/.*)?$
vendor/github.com/prometheus/common/version(/.*)?$
vendor/github.com/prometheus/procfs(/.*)?$
vendor/github.com/prometheus/procfs/bcache(/.*)?$
vendor/github.com/prometheus/procfs/fixtures(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/26231(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/26231/fd(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/26232(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/26232/fd(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/584(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/buddyinfo(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/buddyinfo/short(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/buddyinfo/sizemismatch(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/buddyinfo/valid(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/fs(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/fs/xfs(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/net(/.*)?$
vendor/github.com/prometheus/procfs/fixtures/symlinktargets(/.*)?$
vendor/github.com/prometheus/procfs/sysfs(/.*)?$
vendor/github.com/prometheus/procfs/xfs(/.*)?$
vendor/github.com/ryanuber(/.*)?$
vendor/github.com/ryanuber/go-glob(/.*)?$
vendor/github.com/sethgrid(/.*)?$
vendor/github.com/sethgrid/pester(/.*)?$
vendor/github.com/sethgrid/pester/benchmarks(/.*)?$
vendor/github.com/sethgrid/pester/sample(/.*)?$
vendor/github.com/spf13(/.*)?$
vendor/github.com/spf13/cobra(/.*)?$
vendor/github.com/spf13/cobra/cobra(/.*)?$
vendor/github.com/spf13/cobra/cobra/cmd(/.*)?$
vendor/github.com/spf13/cobra/cobra/cmd/testdata(/.*)?$
vendor/github.com/spf13/cobra/doc(/.*)?$
vendor/github.com/spf13/pflag(/.*)?$
vendor/github.com/spf13/pflag/verify(/.*)?$
vendor/github.com/stretchr(/.*)?$
vendor/github.com/stretchr/testify(/.*)?$
vendor/github.com/stretchr/testify/Godeps(/.*)?$
vendor/github.com/stretchr/testify/_codegen(/.*)?$
vendor/github.com/stretchr/testify/assert(/.*)?$
vendor/github.com/stretchr/testify/http(/.*)?$
vendor/github.com/stretchr/testify/mock(/.*)?$
vendor/github.com/stretchr/testify/require(/.*)?$
vendor/github.com/stretchr/testify/suite(/.*)?$
vendor/golang.org(/.*)?$
vendor/golang.org/x(/.*)?$
vendor/golang.org/x/crypto(/.*)?$
vendor/golang.org/x/crypto/acme(/.*)?$
vendor/golang.org/x/crypto/acme/autocert(/.*)?$
vendor/golang.org/x/crypto/bcrypt(/.*)?$
vendor/golang.org/x/crypto/blake2b(/.*)?$
vendor/golang.org/x/crypto/blake2s(/.*)?$
vendor/golang.org/x/crypto/blowfish(/.*)?$
vendor/golang.org/x/crypto/bn256(/.*)?$
vendor/golang.org/x/crypto/cast5(/.*)?$
vendor/golang.org/x/crypto/chacha20poly1305(/.*)?$
vendor/golang.org/x/crypto/chacha20poly1305/internal(/.*)?$
vendor/golang.org/x/crypto/chacha20poly1305/internal/chacha20(/.*)?$
vendor/golang.org/x/crypto/cryptobyte(/.*)?$
vendor/golang.org/x/crypto/curve25519(/.*)?$
vendor/golang.org/x/crypto/ed25519(/.*)?$
vendor/golang.org/x/crypto/ed25519/internal(/.*)?$
vendor/golang.org/x/crypto/ed25519/internal/edwards25519(/.*)?$
vendor/golang.org/x/crypto/ed25519/testdata(/.*)?$
vendor/golang.org/x/crypto/hkdf(/.*)?$
vendor/golang.org/x/crypto/md4(/.*)?$
vendor/golang.org/x/crypto/nacl(/.*)?$
vendor/golang.org/x/crypto/nacl/box(/.*)?$
vendor/golang.org/x/crypto/nacl/secretbox(/.*)?$
vendor/golang.org/x/crypto/ocsp(/.*)?$
vendor/golang.org/x/crypto/openpgp(/.*)?$
vendor/golang.org/x/crypto/openpgp/armor(/.*)?$
vendor/golang.org/x/crypto/openpgp/clearsign(/.*)?$
vendor/golang.org/x/crypto/openpgp/elgamal(/.*)?$
vendor/golang.org/x/crypto/openpgp/errors(/.*)?$
vendor/golang.org/x/crypto/openpgp/packet(/.*)?$
vendor/golang.org/x/crypto/openpgp/s2k(/.*)?$
vendor/golang.org/x/crypto/otr(/.*)?$
vendor/golang.org/x/crypto/pbkdf2(/.*)?$
vendor/golang.org/x/crypto/pkcs12(/.*)?$
vendor/golang.org/x/crypto/pkcs12/internal(/.*)?$
vendor/golang.org/x/crypto/pkcs12/internal/rc2(/.*)?$
vendor/golang.org/x/crypto/poly1305(/.*)?$
vendor/golang.org/x/crypto/ripemd160(/.*)?$
vendor/golang.org/x/crypto/salsa20(/.*)?$
vendor/golang.org/x/crypto/salsa20/salsa(/.*)?$
vendor/golang.org/x/crypto/scrypt(/.*)?$
vendor/golang.org/x/crypto/sha3(/.*)?$
vendor/golang.org/x/crypto/sha3/testdata(/.*)?$
vendor/golang.org/x/crypto/ssh(/.*)?$
vendor/golang.org/x/crypto/ssh/agent(/.*)?$
vendor/golang.org/x/crypto/ssh/knownhosts(/.*)?$
vendor/golang.org/x/crypto/ssh/terminal(/.*)?$
vendor/golang.org/x/crypto/ssh/test(/.*)?$
vendor/golang.org/x/crypto/ssh/testdata(/.*)?$
vendor/golang.org/x/crypto/tea(/.*)?$
vendor/golang.org/x/crypto/twofish(/.*)?$
vendor/golang.org/x/crypto/xtea(/.*)?$
vendor/golang.org/x/crypto/xts(/.*)?$
vendor/golang.org/x/net(/.*)?$
vendor/golang.org/x/net/bpf(/.*)?$
vendor/golang.org/x/net/bpf/testdata(/.*)?$
vendor/golang.org/x/net/context(/.*)?$
vendor/golang.org/x/net/context/ctxhttp(/.*)?$
vendor/golang.org/x/net/dict(/.*)?$
vendor/golang.org/x/net/dns(/.*)?$
vendor/golang.org/x/net/dns/dnsmessage(/.*)?$
vendor/golang.org/x/net/html(/.*)?$
vendor/golang.org/x/net/html/atom(/.*)?$
vendor/golang.org/x/net/html/charset(/.*)?$
vendor/golang.org/x/net/html/charset/testdata(/.*)?$
vendor/golang.org/x/net/html/testdata(/.*)?$
vendor/golang.org/x/net/html/testdata/webkit(/.*)?$
vendor/golang.org/x/net/html/testdata/webkit/scripted(/.*)?$
vendor/golang.org/x/net/http2(/.*)?$
vendor/golang.org/x/net/http2/h2demo(/.*)?$
vendor/golang.org/x/net/http2/h2i(/.*)?$
vendor/golang.org/x/net/http2/hpack(/.*)?$
vendor/golang.org/x/net/http2/testdata(/.*)?$
vendor/golang.org/x/net/icmp(/.*)?$
vendor/golang.org/x/net/idna(/.*)?$
vendor/golang.org/x/net/internal(/.*)?$
vendor/golang.org/x/net/internal/iana(/.*)?$
vendor/golang.org/x/net/internal/nettest(/.*)?$
vendor/golang.org/x/net/internal/socket(/.*)?$
vendor/golang.org/x/net/internal/timeseries(/.*)?$
vendor/golang.org/x/net/ipv4(/.*)?$
vendor/golang.org/x/net/ipv6(/.*)?$
vendor/golang.org/x/net/lex(/.*)?$
vendor/golang.org/x/net/lex/httplex(/.*)?$
vendor/golang.org/x/net/lif(/.*)?$
vendor/golang.org/x/net/nettest(/.*)?$
vendor/golang.org/x/net/netutil(/.*)?$
vendor/golang.org/x/net/proxy(/.*)?$
vendor/golang.org/x/net/publicsuffix(/.*)?$
vendor/golang.org/x/net/route(/.*)?$
vendor/golang.org/x/net/trace(/.*)?$
vendor/golang.org/x/net/webdav(/.*)?$
vendor/golang.org/x/net/webdav/internal(/.*)?$
vendor/golang.org/x/net/webdav/internal/xml(/.*)?$
vendor/golang.org/x/net/websocket(/.*)?$
vendor/golang.org/x/net/xsrftoken(/.*)?$
vendor/golang.org/x/oauth2(/.*)?$
vendor/golang.org/x/oauth2/amazon(/.*)?$
vendor/golang.org/x/oauth2/bitbucket(/.*)?$
vendor/golang.org/x/oauth2/clientcredentials(/.*)?$
vendor/golang.org/x/oauth2/facebook(/.*)?$
vendor/golang.org/x/oauth2/fitbit(/.*)?$
vendor/golang.org/x/oauth2/foursquare(/.*)?$
vendor/golang.org/x/oauth2/github(/.*)?$
vendor/golang.org/x/oauth2/google(/.*)?$
vendor/golang.org/x/oauth2/google/testdata(/.*)?$
vendor/golang.org/x/oauth2/google/testdata/gcloud(/.*)?$
vendor/golang.org/x/oauth2/heroku(/.*)?$
vendor/golang.org/x/oauth2/hipchat(/.*)?$
vendor/golang.org/x/oauth2/internal(/.*)?$
vendor/golang.org/x/oauth2/jws(/.*)?$
vendor/golang.org/x/oauth2/jwt(/.*)?$
vendor/golang.org/x/oauth2/linkedin(/.*)?$
vendor/golang.org/x/oauth2/mediamath(/.*)?$
vendor/golang.org/x/oauth2/microsoft(/.*)?$
vendor/golang.org/x/oauth2/odnoklassniki(/.*)?$
vendor/golang.org/x/oauth2/paypal(/.*)?$
vendor/golang.org/x/oauth2/slack(/.*)?$
vendor/golang.org/x/oauth2/uber(/.*)?$
vendor/golang.org/x/oauth2/vk(/.*)?$
vendor/golang.org/x/oauth2/yandex(/.*)?$
vendor/golang.org/x/sys(/.*)?$
vendor/golang.org/x/sys/plan9(/.*)?$
vendor/golang.org/x/sys/unix(/.*)?$
vendor/golang.org/x/sys/unix/linux(/.*)?$
vendor/golang.org/x/sys/windows(/.*)?$
vendor/golang.org/x/sys/windows/registry(/.*)?$
vendor/golang.org/x/sys/windows/svc(/.*)?$
vendor/golang.org/x/sys/windows/svc/debug(/.*)?$
vendor/golang.org/x/sys/windows/svc/eventlog(/.*)?$
vendor/golang.org/x/sys/windows/svc/example(/.*)?$
vendor/golang.org/x/sys/windows/svc/mgr(/.*)?$
vendor/golang.org/x/text(/.*)?$
vendor/golang.org/x/text/cases(/.*)?$
vendor/golang.org/x/text/cmd(/.*)?$
vendor/golang.org/x/text/cmd/gotext(/.*)?$
vendor/golang.org/x/text/collate(/.*)?$
vendor/golang.org/x/text/collate/build(/.*)?$
vendor/golang.org/x/text/collate/tools(/.*)?$
vendor/golang.org/x/text/collate/tools/colcmp(/.*)?$
vendor/golang.org/x/text/currency(/.*)?$
vendor/golang.org/x/text/encoding(/.*)?$
vendor/golang.org/x/text/encoding/charmap(/.*)?$
vendor/golang.org/x/text/encoding/htmlindex(/.*)?$
vendor/golang.org/x/text/encoding/ianaindex(/.*)?$
vendor/golang.org/x/text/encoding/internal(/.*)?$
vendor/golang.org/x/text/encoding/internal/enctest(/.*)?$
vendor/golang.org/x/text/encoding/internal/identifier(/.*)?$
vendor/golang.org/x/text/encoding/japanese(/.*)?$
vendor/golang.org/x/text/encoding/korean(/.*)?$
vendor/golang.org/x/text/encoding/simplifiedchinese(/.*)?$
vendor/golang.org/x/text/encoding/testdata(/.*)?$
vendor/golang.org/x/text/encoding/traditionalchinese(/.*)?$
vendor/golang.org/x/text/encoding/unicode(/.*)?$
vendor/golang.org/x/text/encoding/unicode/utf32(/.*)?$
vendor/golang.org/x/text/feature(/.*)?$
vendor/golang.org/x/text/feature/plural(/.*)?$
vendor/golang.org/x/text/internal(/.*)?$
vendor/golang.org/x/text/internal/catmsg(/.*)?$
vendor/golang.org/x/text/internal/colltab(/.*)?$
vendor/golang.org/x/text/internal/export(/.*)?$
vendor/golang.org/x/text/internal/export/idna(/.*)?$
vendor/golang.org/x/text/internal/format(/.*)?$
vendor/golang.org/x/text/internal/gen(/.*)?$
vendor/golang.org/x/text/internal/number(/.*)?$
vendor/golang.org/x/text/internal/stringset(/.*)?$
vendor/golang.org/x/text/internal/tag(/.*)?$
vendor/golang.org/x/text/internal/testtext(/.*)?$
vendor/golang.org/x/text/internal/triegen(/.*)?$
vendor/golang.org/x/text/internal/ucd(/.*)?$
vendor/golang.org/x/text/internal/utf8internal(/.*)?$
vendor/golang.org/x/text/language(/.*)?$
vendor/golang.org/x/text/language/display(/.*)?$
vendor/golang.org/x/text/message(/.*)?$
vendor/golang.org/x/text/message/catalog(/.*)?$
vendor/golang.org/x/text/runes(/.*)?$
vendor/golang.org/x/text/search(/.*)?$
vendor/golang.org/x/text/secure(/.*)?$
vendor/golang.org/x/text/secure/bidirule(/.*)?$
vendor/golang.org/x/text/secure/precis(/.*)?$
vendor/golang.org/x/text/transform(/.*)?$
vendor/golang.org/x/text/unicode(/.*)?$
vendor/golang.org/x/text/unicode/bidi(/.*)?$
vendor/golang.org/x/text/unicode/cldr(/.*)?$
vendor/golang.org/x/text/unicode/norm(/.*)?$
vendor/golang.org/x/text/unicode/rangetable(/.*)?$
vendor/golang.org/x/text/unicode/runenames(/.*)?$
vendor/golang.org/x/text/width(/.*)?$
vendor/golang.org/x/time(/.*)?$
vendor/golang.org/x/time/rate(/.*)?$
vendor/golang.org/x/tools(/.*)?$
vendor/golang.org/x/tools/benchmark(/.*)?$
vendor/golang.org/x/tools/benchmark/parse(/.*)?$
vendor/golang.org/x/tools/blog(/.*)?$
vendor/golang.org/x/tools/blog/atom(/.*)?$
vendor/golang.org/x/tools/cmd(/.*)?$
vendor/golang.org/x/tools/cmd/benchcmp(/.*)?$
vendor/golang.org/x/tools/cmd/bundle(/.*)?$
vendor/golang.org/x/tools/cmd/bundle/testdata(/.*)?$
vendor/golang.org/x/tools/cmd/bundle/testdata/src(/.*)?$
vendor/golang.org/x/tools/cmd/bundle/testdata/src/domain.name(/.*)?$
vendor/golang.org/x/tools/cmd/bundle/testdata/src/domain.name/importdecl(/.*)?$
vendor/golang.org/x/tools/cmd/bundle/testdata/src/initial(/.*)?$
vendor/golang.org/x/tools/cmd/callgraph(/.*)?$
vendor/golang.org/x/tools/cmd/callgraph/testdata(/.*)?$
vendor/golang.org/x/tools/cmd/callgraph/testdata/src(/.*)?$
vendor/golang.org/x/tools/cmd/callgraph/testdata/src/pkg(/.*)?$
vendor/golang.org/x/tools/cmd/compilebench(/.*)?$
vendor/golang.org/x/tools/cmd/cover(/.*)?$
vendor/golang.org/x/tools/cmd/cover/testdata(/.*)?$
vendor/golang.org/x/tools/cmd/digraph(/.*)?$
vendor/golang.org/x/tools/cmd/eg(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src/fruit.io(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src/fruit.io/banana(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src/fruit.io/orange(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src/fruit.io/pear(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src/new.com(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src/new.com/one(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src/old.com(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src/old.com/bad(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src/old.com/one(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src/titanic.biz(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src/titanic.biz/bar(/.*)?$
vendor/golang.org/x/tools/cmd/fiximports/testdata/src/titanic.biz/foo(/.*)?$
vendor/golang.org/x/tools/cmd/getgo(/.*)?$
vendor/golang.org/x/tools/cmd/getgo/server(/.*)?$
vendor/golang.org/x/tools/cmd/go-contrib-init(/.*)?$
vendor/golang.org/x/tools/cmd/godex(/.*)?$
vendor/golang.org/x/tools/cmd/godoc(/.*)?$
vendor/golang.org/x/tools/cmd/goimports(/.*)?$
vendor/golang.org/x/tools/cmd/gomvpkg(/.*)?$
vendor/golang.org/x/tools/cmd/gorename(/.*)?$
vendor/golang.org/x/tools/cmd/gotype(/.*)?$
vendor/golang.org/x/tools/cmd/goyacc(/.*)?$
vendor/golang.org/x/tools/cmd/goyacc/testdata(/.*)?$
vendor/golang.org/x/tools/cmd/goyacc/testdata/expr(/.*)?$
vendor/golang.org/x/tools/cmd/guru(/.*)?$
vendor/golang.org/x/tools/cmd/guru/serial(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/alias(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/calls(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/calls-json(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/definition-json(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/describe(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/describe-json(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/freevars(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/implements(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/implements-json(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/implements-methods(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/implements-methods-json(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/imports(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/lib(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/lib/sublib(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/main(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/peers(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/peers-json(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/pointsto(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/pointsto-json(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/referrers(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/referrers-json(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/reflection(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/softerrs(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/what(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/what-json(/.*)?$
vendor/golang.org/x/tools/cmd/guru/testdata/src/whicherrs(/.*)?$
vendor/golang.org/x/tools/cmd/heapview(/.*)?$
vendor/golang.org/x/tools/cmd/heapview/client(/.*)?$
vendor/golang.org/x/tools/cmd/heapview/client/testing(/.*)?$
vendor/golang.org/x/tools/cmd/heapview/internal(/.*)?$
vendor/golang.org/x/tools/cmd/heapview/internal/core(/.*)?$
vendor/golang.org/x/tools/cmd/html2article(/.*)?$
vendor/golang.org/x/tools/cmd/present(/.*)?$
vendor/golang.org/x/tools/cmd/present/static(/.*)?$
vendor/golang.org/x/tools/cmd/present/templates(/.*)?$
vendor/golang.org/x/tools/cmd/ssadump(/.*)?$
vendor/golang.org/x/tools/cmd/stress(/.*)?$
vendor/golang.org/x/tools/cmd/stringer(/.*)?$
vendor/golang.org/x/tools/cmd/stringer/testdata(/.*)?$
vendor/golang.org/x/tools/cmd/tip(/.*)?$
vendor/golang.org/x/tools/cmd/toolstash(/.*)?$
vendor/golang.org/x/tools/container(/.*)?$
vendor/golang.org/x/tools/container/intsets(/.*)?$
vendor/golang.org/x/tools/cover(/.*)?$
vendor/golang.org/x/tools/go(/.*)?$
vendor/golang.org/x/tools/go/ast(/.*)?$
vendor/golang.org/x/tools/go/ast/astutil(/.*)?$
vendor/golang.org/x/tools/go/buildutil(/.*)?$
vendor/golang.org/x/tools/go/callgraph(/.*)?$
vendor/golang.org/x/tools/go/callgraph/cha(/.*)?$
vendor/golang.org/x/tools/go/callgraph/cha/testdata(/.*)?$
vendor/golang.org/x/tools/go/callgraph/rta(/.*)?$
vendor/golang.org/x/tools/go/callgraph/rta/testdata(/.*)?$
vendor/golang.org/x/tools/go/callgraph/static(/.*)?$
vendor/golang.org/x/tools/go/gccgoexportdata(/.*)?$
vendor/golang.org/x/tools/go/gccgoexportdata/testdata(/.*)?$
vendor/golang.org/x/tools/go/gcexportdata(/.*)?$
vendor/golang.org/x/tools/go/gcexportdata/testdata(/.*)?$
vendor/golang.org/x/tools/go/gcimporter15(/.*)?$
vendor/golang.org/x/tools/go/gcimporter15/testdata(/.*)?$
vendor/golang.org/x/tools/go/gcimporter15/testdata/versions(/.*)?$
vendor/golang.org/x/tools/go/internal(/.*)?$
vendor/golang.org/x/tools/go/internal/gccgoimporter(/.*)?$
vendor/golang.org/x/tools/go/internal/gccgoimporter/testdata(/.*)?$
vendor/golang.org/x/tools/go/loader(/.*)?$
vendor/golang.org/x/tools/go/loader/testdata(/.*)?$
vendor/golang.org/x/tools/go/pointer(/.*)?$
vendor/golang.org/x/tools/go/pointer/testdata(/.*)?$
vendor/golang.org/x/tools/go/ssa(/.*)?$
vendor/golang.org/x/tools/go/ssa/interp(/.*)?$
vendor/golang.org/x/tools/go/ssa/interp/testdata(/.*)?$
vendor/golang.org/x/tools/go/ssa/ssautil(/.*)?$
vendor/golang.org/x/tools/go/ssa/ssautil/testdata(/.*)?$
vendor/golang.org/x/tools/go/ssa/testdata(/.*)?$
vendor/golang.org/x/tools/go/types(/.*)?$
vendor/golang.org/x/tools/go/types/typeutil(/.*)?$
vendor/golang.org/x/tools/go/vcs(/.*)?$
vendor/golang.org/x/tools/godoc(/.*)?$
vendor/golang.org/x/tools/godoc/analysis(/.*)?$
vendor/golang.org/x/tools/godoc/dl(/.*)?$
vendor/golang.org/x/tools/godoc/proxy(/.*)?$
vendor/golang.org/x/tools/godoc/redirect(/.*)?$
vendor/golang.org/x/tools/godoc/short(/.*)?$
vendor/golang.org/x/tools/godoc/static(/.*)?$
vendor/golang.org/x/tools/godoc/static/analysis(/.*)?$
vendor/golang.org/x/tools/godoc/static/images(/.*)?$
vendor/golang.org/x/tools/godoc/util(/.*)?$
vendor/golang.org/x/tools/godoc/vfs(/.*)?$
vendor/golang.org/x/tools/godoc/vfs/gatefs(/.*)?$
vendor/golang.org/x/tools/godoc/vfs/httpfs(/.*)?$
vendor/golang.org/x/tools/godoc/vfs/mapfs(/.*)?$
vendor/golang.org/x/tools/godoc/vfs/zipfs(/.*)?$
vendor/golang.org/x/tools/imports(/.*)?$
vendor/golang.org/x/tools/playground(/.*)?$
vendor/golang.org/x/tools/playground/socket(/.*)?$
vendor/golang.org/x/tools/present(/.*)?$
vendor/golang.org/x/tools/refactor(/.*)?$
vendor/golang.org/x/tools/refactor/eg(/.*)?$
vendor/golang.org/x/tools/refactor/eg/testdata(/.*)?$
vendor/golang.org/x/tools/refactor/importgraph(/.*)?$
vendor/golang.org/x/tools/refactor/rename(/.*)?$
vendor/golang.org/x/tools/refactor/satisfy(/.*)?$
vendor/golang.org/x/tools/third_party(/.*)?$
vendor/golang.org/x/tools/third_party/moduleloader(/.*)?$
vendor/golang.org/x/tools/third_party/typescript(/.*)?$
vendor/golang.org/x/tools/third_party/webcomponents(/.*)?$
vendor/google.golang.org(/.*)?$
vendor/google.golang.org/api(/.*)?$
vendor/google.golang.org/api/acceleratedmobilepageurl(/.*)?$
vendor/google.golang.org/api/acceleratedmobilepageurl/v1(/.*)?$
vendor/google.golang.org/api/adexchangebuyer(/.*)?$
vendor/google.golang.org/api/adexchangebuyer/v1.2(/.*)?$
vendor/google.golang.org/api/adexchangebuyer/v1.3(/.*)?$
vendor/google.golang.org/api/adexchangebuyer/v1.4(/.*)?$
vendor/google.golang.org/api/adexchangebuyer2(/.*)?$
vendor/google.golang.org/api/adexchangebuyer2/v2beta1(/.*)?$
vendor/google.golang.org/api/adexchangeseller(/.*)?$
vendor/google.golang.org/api/adexchangeseller/v1(/.*)?$
vendor/google.golang.org/api/adexchangeseller/v1.1(/.*)?$
vendor/google.golang.org/api/adexchangeseller/v2.0(/.*)?$
vendor/google.golang.org/api/adexperiencereport(/.*)?$
vendor/google.golang.org/api/adexperiencereport/v1(/.*)?$
vendor/google.golang.org/api/admin(/.*)?$
vendor/google.golang.org/api/admin/datatransfer(/.*)?$
vendor/google.golang.org/api/admin/datatransfer/v1(/.*)?$
vendor/google.golang.org/api/admin/directory(/.*)?$
vendor/google.golang.org/api/admin/directory/v1(/.*)?$
vendor/google.golang.org/api/admin/reports(/.*)?$
vendor/google.golang.org/api/admin/reports/v1(/.*)?$
vendor/google.golang.org/api/adsense(/.*)?$
vendor/google.golang.org/api/adsense/v1.3(/.*)?$
vendor/google.golang.org/api/adsense/v1.4(/.*)?$
vendor/google.golang.org/api/adsensehost(/.*)?$
vendor/google.golang.org/api/adsensehost/v4.1(/.*)?$
vendor/google.golang.org/api/analytics(/.*)?$
vendor/google.golang.org/api/analytics/v2.4(/.*)?$
vendor/google.golang.org/api/analytics/v3(/.*)?$
vendor/google.golang.org/api/analyticsreporting(/.*)?$
vendor/google.golang.org/api/analyticsreporting/v4(/.*)?$
vendor/google.golang.org/api/androidenterprise(/.*)?$
vendor/google.golang.org/api/androidenterprise/v1(/.*)?$
vendor/google.golang.org/api/androidpublisher(/.*)?$
vendor/google.golang.org/api/androidpublisher/v1(/.*)?$
vendor/google.golang.org/api/androidpublisher/v1.1(/.*)?$
vendor/google.golang.org/api/androidpublisher/v2(/.*)?$
vendor/google.golang.org/api/appengine(/.*)?$
vendor/google.golang.org/api/appengine/v1(/.*)?$
vendor/google.golang.org/api/appengine/v1alpha(/.*)?$
vendor/google.golang.org/api/appengine/v1beta(/.*)?$
vendor/google.golang.org/api/appengine/v1beta4(/.*)?$
vendor/google.golang.org/api/appengine/v1beta5(/.*)?$
vendor/google.golang.org/api/appsactivity(/.*)?$
vendor/google.golang.org/api/appsactivity/v1(/.*)?$
vendor/google.golang.org/api/appstate(/.*)?$
vendor/google.golang.org/api/appstate/v1(/.*)?$
vendor/google.golang.org/api/bigquery(/.*)?$
vendor/google.golang.org/api/bigquery/v2(/.*)?$
vendor/google.golang.org/api/bigquerydatatransfer(/.*)?$
vendor/google.golang.org/api/bigquerydatatransfer/v1(/.*)?$
vendor/google.golang.org/api/blogger(/.*)?$
vendor/google.golang.org/api/blogger/v2(/.*)?$
vendor/google.golang.org/api/blogger/v3(/.*)?$
vendor/google.golang.org/api/books(/.*)?$
vendor/google.golang.org/api/books/v1(/.*)?$
vendor/google.golang.org/api/calendar(/.*)?$
vendor/google.golang.org/api/calendar/v3(/.*)?$
vendor/google.golang.org/api/civicinfo(/.*)?$
vendor/google.golang.org/api/civicinfo/v2(/.*)?$
vendor/google.golang.org/api/classroom(/.*)?$
vendor/google.golang.org/api/classroom/v1(/.*)?$
vendor/google.golang.org/api/cloudbilling(/.*)?$
vendor/google.golang.org/api/cloudbilling/v1(/.*)?$
vendor/google.golang.org/api/cloudbuild(/.*)?$
vendor/google.golang.org/api/cloudbuild/v1(/.*)?$
vendor/google.golang.org/api/clouddebugger(/.*)?$
vendor/google.golang.org/api/clouddebugger/v2(/.*)?$
vendor/google.golang.org/api/clouderrorreporting(/.*)?$
vendor/google.golang.org/api/clouderrorreporting/v1beta1(/.*)?$
vendor/google.golang.org/api/cloudfunctions(/.*)?$
vendor/google.golang.org/api/cloudfunctions/v1(/.*)?$
vendor/google.golang.org/api/cloudfunctions/v1beta2(/.*)?$
vendor/google.golang.org/api/cloudkms(/.*)?$
vendor/google.golang.org/api/cloudkms/v1(/.*)?$
vendor/google.golang.org/api/cloudmonitoring(/.*)?$
vendor/google.golang.org/api/cloudmonitoring/v2beta2(/.*)?$
vendor/google.golang.org/api/cloudresourcemanager(/.*)?$
vendor/google.golang.org/api/cloudresourcemanager/v1(/.*)?$
vendor/google.golang.org/api/cloudresourcemanager/v1beta1(/.*)?$
vendor/google.golang.org/api/cloudresourcemanager/v2beta1(/.*)?$
vendor/google.golang.org/api/cloudtrace(/.*)?$
vendor/google.golang.org/api/cloudtrace/v1(/.*)?$
vendor/google.golang.org/api/cloudtrace/v2(/.*)?$
vendor/google.golang.org/api/clouduseraccounts(/.*)?$
vendor/google.golang.org/api/clouduseraccounts/v0.alpha(/.*)?$
vendor/google.golang.org/api/clouduseraccounts/v0.beta(/.*)?$
vendor/google.golang.org/api/clouduseraccounts/vm_alpha(/.*)?$
vendor/google.golang.org/api/clouduseraccounts/vm_beta(/.*)?$
vendor/google.golang.org/api/compute(/.*)?$
vendor/google.golang.org/api/compute/v0.alpha(/.*)?$
vendor/google.golang.org/api/compute/v0.beta(/.*)?$
vendor/google.golang.org/api/compute/v1(/.*)?$
vendor/google.golang.org/api/consumersurveys(/.*)?$
vendor/google.golang.org/api/consumersurveys/v2(/.*)?$
vendor/google.golang.org/api/container(/.*)?$
vendor/google.golang.org/api/container/v1(/.*)?$
vendor/google.golang.org/api/content(/.*)?$
vendor/google.golang.org/api/content/v2(/.*)?$
vendor/google.golang.org/api/content/v2sandbox(/.*)?$
vendor/google.golang.org/api/customsearch(/.*)?$
vendor/google.golang.org/api/customsearch/v1(/.*)?$
vendor/google.golang.org/api/dataflow(/.*)?$
vendor/google.golang.org/api/dataflow/v1b3(/.*)?$
vendor/google.golang.org/api/dataproc(/.*)?$
vendor/google.golang.org/api/dataproc/v1(/.*)?$
vendor/google.golang.org/api/dataproc/v1alpha1(/.*)?$
vendor/google.golang.org/api/dataproc/v1beta1(/.*)?$
vendor/google.golang.org/api/datastore(/.*)?$
vendor/google.golang.org/api/datastore/v1(/.*)?$
vendor/google.golang.org/api/datastore/v1beta3(/.*)?$
vendor/google.golang.org/api/deploymentmanager(/.*)?$
vendor/google.golang.org/api/deploymentmanager/v0.alpha(/.*)?$
vendor/google.golang.org/api/deploymentmanager/v2(/.*)?$
vendor/google.golang.org/api/deploymentmanager/v2beta(/.*)?$
vendor/google.golang.org/api/dfareporting(/.*)?$
vendor/google.golang.org/api/dfareporting/v2.7(/.*)?$
vendor/google.golang.org/api/dfareporting/v2.8(/.*)?$
vendor/google.golang.org/api/discovery(/.*)?$
vendor/google.golang.org/api/discovery/v1(/.*)?$
vendor/google.golang.org/api/dlp(/.*)?$
vendor/google.golang.org/api/dlp/v2beta1(/.*)?$
vendor/google.golang.org/api/dns(/.*)?$
vendor/google.golang.org/api/dns/v1(/.*)?$
vendor/google.golang.org/api/dns/v2beta1(/.*)?$
vendor/google.golang.org/api/doubleclickbidmanager(/.*)?$
vendor/google.golang.org/api/doubleclickbidmanager/v1(/.*)?$
vendor/google.golang.org/api/doubleclicksearch(/.*)?$
vendor/google.golang.org/api/doubleclicksearch/v2(/.*)?$
vendor/google.golang.org/api/drive(/.*)?$
vendor/google.golang.org/api/drive/v2(/.*)?$
vendor/google.golang.org/api/drive/v3(/.*)?$
vendor/google.golang.org/api/examples(/.*)?$
vendor/google.golang.org/api/firebasedynamiclinks(/.*)?$
vendor/google.golang.org/api/firebasedynamiclinks/v1(/.*)?$
vendor/google.golang.org/api/firebaserules(/.*)?$
vendor/google.golang.org/api/firebaserules/v1(/.*)?$
vendor/google.golang.org/api/fitness(/.*)?$
vendor/google.golang.org/api/fitness/v1(/.*)?$
vendor/google.golang.org/api/fusiontables(/.*)?$
vendor/google.golang.org/api/fusiontables/v1(/.*)?$
vendor/google.golang.org/api/fusiontables/v2(/.*)?$
vendor/google.golang.org/api/games(/.*)?$
vendor/google.golang.org/api/games/v1(/.*)?$
vendor/google.golang.org/api/gamesconfiguration(/.*)?$
vendor/google.golang.org/api/gamesconfiguration/v1configuration(/.*)?$
vendor/google.golang.org/api/gamesmanagement(/.*)?$
vendor/google.golang.org/api/gamesmanagement/v1management(/.*)?$
vendor/google.golang.org/api/genomics(/.*)?$
vendor/google.golang.org/api/genomics/v1(/.*)?$
vendor/google.golang.org/api/genomics/v1alpha2(/.*)?$
vendor/google.golang.org/api/gensupport(/.*)?$
vendor/google.golang.org/api/gmail(/.*)?$
vendor/google.golang.org/api/gmail/v1(/.*)?$
vendor/google.golang.org/api/google-api-go-generator(/.*)?$
vendor/google.golang.org/api/google-api-go-generator/internal(/.*)?$
vendor/google.golang.org/api/google-api-go-generator/internal/disco(/.*)?$
vendor/google.golang.org/api/google-api-go-generator/internal/disco/testdata(/.*)?$
vendor/google.golang.org/api/google-api-go-generator/testdata(/.*)?$
vendor/google.golang.org/api/googleapi(/.*)?$
vendor/google.golang.org/api/googleapi/internal(/.*)?$
vendor/google.golang.org/api/googleapi/internal/uritemplates(/.*)?$
vendor/google.golang.org/api/googleapi/transport(/.*)?$
vendor/google.golang.org/api/groupsmigration(/.*)?$