This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
buildscript { | |
repositories { | |
maven { url 'https://maven.fabric.io/public' } | |
maven { url "https://repo.eclipse.org/content/repositories/paho-snapshots/" } | |
} | |
dependencies { | |
classpath 'io.fabric.tools:gradle:1.+' | |
} | |
} |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
./gradlew app:dependencies | |
houdini:ohmd-android brett$ ./gradlew app:dependencies | |
> Configure project :animation-circular-progress-button | |
Configuration 'compile' in project ':animation-circular-progress-button' is deprecated. Use 'implementation' instead. | |
> Configure project :app | |
Could not find google-services.json while looking in [src/nullnull/debug, src/debug/nullnull, src/nullnull, src/debug, src/nullnullDebug] | |
registerResGeneratingTask is deprecated, use registerGeneratedFolders(FileCollection) | |
Could not find google-services.json while looking in [src/nullnull/release, src/release/nullnull, src/nullnull, src/release, src/nullnullRelease] |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
CLUSTAL W (1.83) multiple sequence alignment | |
HLA_HLA06639 MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLW | |
HLA_HLA06640 MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLW | |
HLA_HLA00959 MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLW | |
HLA_HLA00961 -LLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSW | |
HLA_HLA06641 MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLW | |
HLA_HLA06636 MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLW | |
HLA_HLA06635 MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLW | |
* * *.* : **: . . : :... . * * * * |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
select timestamp, symbol, price, ratio_05, ratio_10, ratio_15, ratio_25, ratio_50, | |
((price - t.previous_price_5min) / price) as change5min , | |
((price - t.previous_price_10min) / price) as change10min , | |
((price - t.previous_price_1hr) / price) as change1hr, | |
((t.forward_price_5min - price) / price) as future5min, | |
((t.forward_price_10min - price) / price) as future10min, | |
((t.forward_price_30min - price) / price) as future30min, | |
((t.forward_price_60min - price) / price) as future60min, | |
((t.forward_price_120min - price) / price) as future120min, | |
((t.forward_price_180min - price) / price) as future180min, |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
{ | |
"_id" : ObjectId("55073784431f1740ad81d707"), | |
"postTime" : null, | |
"raceTypeId" : "7", | |
"resultrunners" : [ | |
{ | |
"binumber" : "1", | |
"horse" : "Jailhouse King", | |
"show" : "4.20", | |
"win" : "0.00", |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
public void ConfigureOAuth(IAppBuilder app) | |
{ | |
var issuer = "<the_same_issuer_as_AuthenticationServer.Api>"; | |
// Api controllers with an [Authorize] attribute will be validated with JWT | |
var audiences = DatabaseAccessLayer.GetAllowedAudiences(); // Gets a list of audience Ids, secrets, and names (although names are unused) | |
// List the | |
List<string> audienceId = new List<string>(); | |
List<IIssuerSecurityTokenProvider> providers = new List<IIssuerSecurityTokenProvider>(); |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
typedef enum { | |
NIOpenAuthenticationStateFetchingToken, | |
NIOpenAuthenticationStateAuthorized, | |
} NIOpenAuthenticationState; | |
// Step 1: Create an auth object that will capture the token. | |
self.auth = [[[NISoundCloudOpenAuthenticator alloc] | |
initWithClientIdentifier:@"xxxxxx" | |
clientSecret:@"xxxxxx"] autorelease]; |