This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
-- Function to split the input query and generate all contiguous combinations | |
CREATE FUNCTION split_to_table(@input_query VARCHAR(MAX)) | |
RETURNS @result TABLE (combination VARCHAR(MAX)) | |
AS | |
BEGIN | |
DECLARE @words TABLE (id INT IDENTITY(1,1), word VARCHAR(255)) | |
DECLARE @total_words INT, @i INT, @j INT, @current_combination VARCHAR(MAX) | |
-- Step 1: Splitting the input string into words | |
INSERT INTO @words (word) |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
import re | |
from struct import iter_unpack | |
from quopri import decodestring | |
import magic | |
import matplotlib.pyplot as plt | |
import numpy as np | |
# Constants | |
UNITS = { |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
o = 0 # Number of files | |
n = 0 # Number of lines of code | |
m = 0 # Number of lines of comments | |
files = Dir.glob('/path/to/dir/**/*.rb') | |
files.each do |f| | |
next if FileTest.directory?(f) | |
o += 1 | |
i = 0 | |
lines = [] |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Hey dahani9091 (ChatGPT project) |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
novo_test = pd.read_csv("test.csv") | |
novo_test | |
df_cavity = pd.read_csv('/content/gdrive/MyDrive/Kaggle/cavity_pred_CUSTOM_A.csv', low_memory=False) | |
df_cavity = df_cavity.rename(columns={'variant': 'mutation_key'}) | |
df_cavity | |
novo_test2 = novo_test.copy().rename({'protein_sequence': 'mutant_seq', 'seq_id': 'source_df_id'}, axis = 1) | |
novo_test2['sequence'] = 'VPVNPEPDATSVENVALKTGSGDSQSDPIKADLEVKGQSALPFDVDCWAILCKGAPNVLQRVNEKTKNSNRDRSGANKGPFKDPQKWGIKALPPKNPSWSAQDFKSPEEYAFASSLQGGTNAILAPVNLASQNSQGGVLNGFYSANKVAQFDPSKPQQTKGTWFQITKFTGAAGPYCKALGSNDKSVCDKNKNIAGDWGFDPAKWAYQYDEKNNKFNYVGK' | |
novo_test2 = novo_test2.apply(find_mut,axis=1) |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
<!-- CONTACT.HTML --> | |
<form method='post' action='mailform.php'> | |
Email: <input name='email' type='text' /><br /> | |
Subject: <input name='subject' type='text' /><br /> | |
Message:<br /> | |
<textarea name='message' rows='15' cols='40'> | |
</textarea><br /> | |
<input type='submit' /> | |
</form> |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#version 130 | |
#pragma optionNV(unroll all) | |
uint ROTLEFT(in uint a, in int b) { return (a << b) | (a >> (32-b)); } | |
uint ROTRIGHT(in uint a, in int b) { return (a >> b) | (a << (32-b)); } | |
uint CH(in uint x,in uint y,in uint z) { return (x & y) ^ (~x & z); } | |
uint MAJ(in uint x,in uint y,in uint z) { return (x & y) ^ (x & z) ^ (y & z); } | |
uint EP0(in uint x) { return ROTRIGHT(x,2) ^ ROTRIGHT(x,13) ^ ROTRIGHT(x,22); } | |
uint EP1(in uint x) { return ROTRIGHT(x,6) ^ ROTRIGHT(x,11) ^ ROTRIGHT(x,25); } |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
require 'graph-rank' | |
require 'treat' | |
# Implements the PageRank algorithm for | |
# unsupervised extractive summarization. | |
# | |
# Reference: R. Mihalcea and P. Tarau, “TextRank: | |
# Bringing Order into Texts,” in Proceedings of | |
# EMNLP 2004. Association for Computational | |
# Linguistics, 2004, pp. 404–411. |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
import random as r | |
import math as m | |
# Number of darts that land inside. | |
inside = 0 | |
# Total number of darts to throw. | |
total = 1000 | |
# Iterate for the number of darts. | |
for i in range(0, total): |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
domain = "www.test.com" | |
email = "test@gmail.com" | |
password = "test" | |
require 'whois' | |
require 'gmail' | |
client = Whois::Client.new | |
while true |
NewerOlder