Call hivpred with plugin installed

hivpred_plugin.js

/*******************************************************************************
 * Script to predict the susceptibility of an HIV protease sequence for seven
 * drugs based on the proteochemometric model described in:
 * Lapins M, Eklund M, Spjuth O, Prusis P, Wikberg JE.
 * Proteochemometric modeling of HIV protease susceptibility,
 * BMC Bioinformatics. 2008 Apr 10;9:181. .
 *
 * Script accepts a 99 aa sequence as input and delivers susceptbiliy values
 * for the drugs Amprenavir, Atazanavir, Indinavir, Lopinavir, Nelfinavir,
 * Ritonavir, and Saquinavir.
 * 
 * Requires the feature 'se.uu.farmbio.hivpred_feature' to be installed
 *
 * Script author: Ola Spjuth <ola.spjuth@farmbio.uu.se>
 *
 ******************************************************************************/
var seq="PQITLWQRPIVTIKIGGQLREALLDTGADNTVLEEMNLPGRWKPKMIVGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF";
hivpred.predict(seq)