Created
November 7, 2017 19:20
-
-
Save pcantalupo/31c7394171f43c15815006fd6607b863 to your computer and use it in GitHub Desktop.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| Input files: | |
| $ cat tantigen.fa | |
| >tantigen | |
| MDKVLNREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYK | |
| KMEDGVKYAHQPDFGGFWDATEIPTYG | |
| $ cat tantigen.nucl.fa | |
| >tantigen.nucl | |
| ATGGATAAAGTTTTAAACAGAGAGGAATCTTTGCAGCTAATGGACCTTCTAGGTCTTGAA | |
| AGGAGTGCCTGGGGGAATATTCCTCTGATGAGAAAGGCATATTTAAAAAAATGCAAGGAG | |
| TTTCATCCTGATAAAGGAGGAGATGAAGAAAAAATGAAGAAAATGAATACTCTGTACAAG | |
| AAAATGGAAGATGGAGTAAAATATGCTCATCAACCTGACTTTGGAGGCTTCTGGGATGCA | |
| ACTGAGGTATTTGCTTCTTCCTTAAATCCTGGTGTTGATGCAATGTACTGCAAACAATGG | |
| CCTGAGTGTGCAAAGAAAATGTCTGCTAACTGCATATGCTT | |
| Running Rapsearch2 v2.24 on Linux Supercomputer (expected evalue is 3.1e-50) -> This works as expected | |
| $ prerapsearch -d tantigen.fa -n tantigen.rapsearch | |
| now building hash file | |
| hash file saved to file tantigen.rapsearch | |
| >>>Main END | |
| $ rapsearch -e 1e-5 -d tantigen.rapsearch -s f -q tantigen.nucl.fa -u 1 | |
| QueryFileName tantigen.nucl.fa | |
| Queries are nucleotide sequences in fasta format | |
| start 1 threads | |
| # RAPSearch | |
| # Job submitted: Tue Nov 7 14:16:31 2017 | |
| # Query : tantigen.nucl.fa | |
| # Subject : tantigen.rapsearch | |
| # Fields: Query Subject identity aln-len mismatch gap-openings q.start q.end s.start s.end e-value bit-score | |
| tantigen.nucl tantigen 98.8 83 1 0 1 249 1 83 3.1e-50 177.6 | |
| >>>Main END | |
| Time used: 0 min (0.0 hours) | |
| Running Rapsearch2 v2.24 on Ubuntu 16.04 (expected evalue is 3.1e-50) -> This does not work as expected (the evalue contains letters) | |
| $ prerapsearch -d tantigen.fa -n tantigen.rapsearch | |
| now building hash file | |
| hash file saved to file tantigen.rapsearch | |
| >>>Main END | |
| $ rapsearch -e 1e-5 -d tantigen.rapsearch -s f -q tantigen.nucl.fa -u 1 | |
| QueryFileName tantigen.nucl.fa | |
| Queries are nucleotide sequences in fasta format | |
| start 1 threads | |
| # RAPSearch | |
| # Job submitted: Tue Nov 7 19:14:00 2017 | |
| # Query : tantigen.nucl.fa | |
| # Subject : tantigen.rapsearch | |
| # Fields: Query Subject identity aln-len mismatch gap-openings q.start q.end s.start s.end e-value bit-score | |
| tantigen.nucl tantigen 98.8 83 1 0 1 249 1 83 0x1.74d962c6af1b9p-165 177.6 | |
| >>>Main END | |
| Time used: 0 min (0.0 hours) | |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment