This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
>orf19.2163 orf19.2163 CGDID:CAL0005388 COORDS:Ca21chr6_C_albicans_SC5314:1028818-1031331W Exon(s) only sequence (2514 nucleotides) Uncharacterized ORF; Ortholog(s) have cytosol localization | |
MLEEEVHDTSSEASEVFTNQPNAFVRGVRSIFGYRKTSLTLFVILTIVVTAGLSFYDNSL | |
ELTIELPTSQLEKEILESSWLDLQNIARYPHTYGSRANDQVHDYLEEIIQDMEYDNDGEK | |
IMFELGKGVVSYYESNNLLVRVNGSDGTLPALLLSAHYDSVPSSFGVTDDGMGVASLLGV | |
LRFVAHNQPRRTIIFNFNNNEEFGLFGAHAFVKHPWFKQVGYFLNLEGTGAGGKAVLFRG | |
TDYGIVKNFGGVRYPYATSIFQQGFNNHVIHSETDYKVYKEAGLRGLDLAFYKPRDKYHT | |
GEDNIRNVSPKSLWHMMSNAIDFVQMGVVDDSEEPAVYTTFLGYFFATPISALARVNLVL | |
LVLFPVVSTPLLFVIVKYKKWKLRVTNFLGVPLAMGLAVAVGQVGNPMLVSSHPMMVVAT | |
TTSIVVLVYYVVLNGVDWVNTSSDQKLVTMIEVSFVYWVVLVYVTWSGGDHTGEFGVTVL | |
FFVQASTSLLGLIGWTFTRVRGGDEPLLSGEEERYGTEDERDTEKPLVEHNYDWSLQYLL |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/env python | |
""" | |
Given a file containing a table of genes and their coordinates (see "Inputs"), get their genotypes from 1000genomes. | |
This in reality is a wrapper to tabix. You need to have tabix installed in the .bin folder, and you also need to have a ./data/tabix_indexes folder on your file system. | |
Usage | |
========= | |
$: python get_genotypes.py -l data/n-glycan.coords |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
cd ~/webapps/app_name/ | |
./apache2/bin/stop | |
rm -rf lib/python2.7/{D,d}jango* myproject* | |
PYTHONPATH=$PWD/lib/python2.7 easy_install-2.7 -s $PWD/bin -d $PWD/lib/python2.7 zc.buildout | |
wget http://pypi.python.org/packages/source/d/django-lfs/django-lfs-installer-0.6.0b5.tar.gz | |
tar zxf django-lfs-installer-0.6.0b5.tar.gz | |
cd lfs-installer/ | |
python2.7 bootstrap.py | |
./bin/buildout -v # this will take a while to run and produce a lot of output, so be patient | |
sed -i "s/'ENGINE': 'django.db.backends.'/'ENGINE': 'django.db.backends.postgresql_psycopg2'/g" lfs_project/settings.py |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
cd ~/webapps/app_name/ | |
./apache2/bin/stop | |
rm -rf lib/python2.7/{D,d}jango* myproject* | |
PYTHONPATH=$PWD/lib/python2.7 easy_install-2.7 -s $PWD/bin -d $PWD/lib/python2.7 zc.buildout | |
wget https://pypi.python.org/packages/source/d/django-lfs/django-lfs-installer-0.7.7.tar.gz#md5=1e1c20a51e5bea9a26c2177a07c5de19 --no-check-certificate | |
tar zxf django-lfs-installer-0.7.7.tar.gz | |
cd lfs-installer/ | |
python2.7 bootstrap.py | |
./bin/buildout -v # this will take a while to run and produce a lot of output, so be patient | |
#configure database now |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
sub foo :Local :Args(1) { | |
my ( $self, $c, $item_id) = @_; | |
my $exception; | |
try { | |
$c->model('NetworkDB')->txn_do(sub { | |
foreach my $media_id (@media_array){ | |
my $exam_question_media_up = $c->model('NetworkDB::ExamQuestionMedia')->search({exam_question_media_id => $media_id})->first(); | |
$exam_question_media_up->update({ | |
sequence=>$sequence_count; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
##fileformat=VCFv4.1 | |
##ApplyRecalibration="analysis_type=ApplyRecalibration input_file=[] sample_metadata=[] read_buffer_size=null phone_home=STANDARD read_filter=[] intervals=null excludeIntervals=null reference_sequence=/hpf/ngs_analysesb/genomes/index/bfast+bwa/hg19-cs50-2d/hg19.fa rodBind=[/hpf/ngs_analyses/work/llau/brazil/samples//Exome_3_EDS-20120504102632-gatk1.1.28f-hg19/gatk-raw-variants/Exome_3_EDS.raw.snps.vcf] rodToIntervalTrackName=null BTI_merge_rule=UNION nonDeterministicRandomSeed=false DBSNP=null downsampling_type=null downsample_to_fraction=null downsample_to_coverage=null baq=OFF baqGapOpenPenalty=40.0 performanceLog=null useOriginalQualities=false defaultBaseQualities=-1 validation_strictness=SILENT unsafe=null num_threads=1 interval_merging=ALL read_group_black_list=null processingTracker=null restartProcessingTracker=false processingTrackerStatusFile=null processingTrackerID=-1 allow_intervals_with_unindexed_bam=false disable_experimental_low_memory_sharding=false logging_level=INFO log |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
""" | |
Disable registration/signup | |
""" | |
#models.py | |
from allauth.account.adapter import DefaultAccountAdapter | |
class MyAccountAdapter(DefaultAccountAdapter): | |
def is_open_for_signup(self, request): | |
return False | |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
blastoutput = "../input/R_2013_11_30_15_23_49_user_CTL-148-Metagenoma_Mauro_Eduardo2.CTLT_PGM.IonXpress_001_Q20_TrimRL_AT_80pb_cdhit97.all.blast_output" | |
from subprocess import call | |
#http://biopython.org/DIST/docs/api/Bio.SearchIO.BlastIO-module.html | |
from Bio import SearchIO | |
blast_results = SearchIO.parse(blastoutput, 'blast-text') |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
from Bio import SeqIO | |
merged_rec = '' | |
infile = "multi-rec.gbk" | |
for rec in SeqIO.parse(open(infile,"r"), "genbank") : | |
merged_rec += rec | |
# you could insert a spacer if needed | |
# merged_rec += rec + ("N" * 50) |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#arquivo media.py | |
class Movie(): | |
def __init__(self, movie_title, movie_storyline, poster_image, trailer_youtube): | |
self.title = movie_title | |
self.storyline = movie_storyline | |
self.poster_image_url = poster_image | |
self.trailer_youtube_url = trailer_youtube | |
#arquivo entertainment_center.py | |
import media |
OlderNewer