Skip to content

Instantly share code, notes, and snippets.

@flaviut
flaviut / Setting up Emporia Vue 2 with ESPHome.md
Last active June 6, 2024 06:00
Setting up Emporia Vue 2 with ESPHome
@nitheeshkl
nitheeshkl / gige_gst_v4l.md
Last active May 2, 2024 08:02
Gstreamer pipelines to use GigE cams as webcam for Zoom/Teams/Skype

Using GigE cam as webcam for Zoom/Skype/Teams

TL;DR: Creates a Gstreamer pipeline to read camera frames from a GigE camera, using Aravis library, and publish them as V4l2 camera source, using V4l2loopback, that can be read by video conferencing programs like Zoom/Skype/Teams.

gst-launch-1.0 aravissrc blocksize=5013504 h-binning=1 v-binning=1 ! video/x-bayer,format=rggb,framerate=100/5,width=2448,height=2048 ! bayer2rgb ! video/x-raw,format=RGBx ! videoconvert ! video/x-raw,format=YUY2 !  aspectratiocrop aspect-ratio=16/9 ! videoscale ! video/x-raw,width=1280,height=720 ! queue ! v4l2sink device=/dev/video0

The Basics

@tomkinsc
tomkinsc / msa_fasta_to_popart_nexus.py
Last active March 18, 2021 01:05
Python script to create nexus input for PopART ( http://popart.otago.ac.nz/ ) from a multiple alignment fasta file and metadata file with boolean columns. Requires biopython, and the input fasta should be cleaned of as much noise as possible.
#!/usr/bin/env python
import sys,os,hashlib,csv
from collections import defaultdict, OrderedDict
import argparse
#import shelve
from Bio import SeqIO
from Bio.SeqIO import FastaIO
# requirements: biopython
@lcarsos
lcarsos / restore_functionality.sh
Last active May 7, 2024 11:53
Repeatedly kill sentinelone so you can actually use the processor and ram on your mac
#!/usr/bin/env bash
# Usage: sudo ./restore_functionality.sh
#ps aux | grep sentinel | awk -F " +" '{print $2}' | xargs kill
while true; do
launchctl kill SIGKILL system/com.crowdstrike.falcond
launchctl kill SIGKILL system/com.crowdstrike.userdaemon
launchctl kill SIGKILL system/com.sentinelone.sentineld
launchctl kill SIGKILL system/com.sentinelone.sentineld-helper
@elowy01
elowy01 / BCFtools cheat sheet
Last active May 21, 2024 10:59
BCFtools cheat sheet
*bcftools filter
*Filter variants per region (in this example, print out only variants mapped to chr1 and chr2)
qbcftools filter -r1,2 ALL.chip.omni_broad_sanger_combined.20140818.snps.genotypes.hg38.vcf.gz
*printing out info for only 2 samples:
bcftools view -s NA20818,NA20819 filename.vcf.gz
*printing stats only for variants passing the filter:
bcftools view -f PASS filename.vcf.gz
@jhcepas
jhcepas / plot_mutations.py
Last active August 30, 2019 12:05
given a tree and its associated alignment, plot column changes for each internal branch
from collections import defaultdict
from ete3 import PhyloTree, TreeStyle, SeqMotifFace, TextFace, RectFace
alg = """
>Dme_001
MAEIPDETIQQFMALT---HNIAVQYLSEFGDLNEAL--YYASQTDDIKDRREEAH
>Dme_002
MAEIPDATIQQFMALTNVSHNIAVQY--EFGDLNEALNSYYAYQTDDQKDRREEAH
>Cfa_001
MAEIPDATIQ---ALTNVSHNIAVQYLSEFGDLNEALNSYYASQTDDQPDRREEAH
@crmackay
crmackay / illumina-bcl-description.md
Last active May 7, 2021 16:27
description of illumina's bcl file format
@tomkinsc
tomkinsc / ssh_tunnel_cheatsheet.md
Last active January 17, 2017 16:59
SSH tunnel cheatsheat

SSH tunnel cheatsheet

SSH Reverse tunnel

                                            ┌─┐                      
                                            │ │                      
                                            │ │                      
┌─────────────┐        ┌─────────────┐      │ │       ┌─────────────┐
│ local │ │ relay │ │ │ │ remote │
@himenlinamarbric
himenlinamarbric / spotifyHijack.scpt
Last active September 20, 2022 18:58
Audio Hijack Pro & Spotify -- No Polling
-- Usage
-- 1. Edit the settings (see below). This step is NECESSARY the first time you use it!
-- 2. Run this script (this should open Audio Hijack Pro and Spotify)
--
-- NOTE: the script assumes that each track is played entirely. You CANNOT skip tracks in Spotify.
-- If you do so the script will get out of sync and the resulting files contain partial or multiple songs.
-- You can abort a recordig session by stopping this script and ending (manually) the recording
-- in Audio Hijack Pro.
--
-- You need to have "atomicparsley" installed on your system. You can install the application with
@veselosky
veselosky / s3gzip.py
Last active May 8, 2023 21:42
How to store and retrieve gzip-compressed objects in AWS S3
# vim: set fileencoding=utf-8 :
#
# How to store and retrieve gzip-compressed objects in AWS S3
###########################################################################
#
# Copyright 2015 Vince Veselosky and contributors
#
# Licensed under the Apache License, Version 2.0 (the "License");
# you may not use this file except in compliance with the License.
# You may obtain a copy of the License at