This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
[cjfields@cjfields-imac comp-fail]$ cat Bar.pm6 | |
role Bar { | |
has Str $.my-str handles <lines words> | |
}; | |
[cjfields@cjfields-imac comp-fail]$ cat Foo.pm6 | |
use lib '.'; | |
use Bar; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
[cjfields@cjfields-imac panda (master)]$ perl6 -v | |
This is perl6 version 2014.11-65-gdfcf9fc built on MoarVM version 2014.11-64-g650333f | |
[cjfields@cjfields-imac panda (master)]$ panda install NativeCall | |
==> Fetching NativeCall | |
==> Building NativeCall | |
Compiling lib/NativeCall.pm6 to mbc | |
==> Testing NativeCall | |
t/01-argless.t ......... ok | |
t/02-simple-args.t ..... ok | |
t/03-simple-returns.t .. ok |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
[cjfields@Chriss-MacBook-Pro bioperl6]$ cat test.fasta | |
>roa1_drome Rea guano receptor type III >> 0.1 | |
MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHEKWGNIVDVV | |
VMKDPRTKRSRGFGFITYSHSSMIDEAQKSRPHKIDGRVEPKRAVPRQDIDSPNAGATVK | |
KLFVGALKDDHDEQSIRDYFQHFGNIVDNIVIDKETGKKRGFAFVEFDDYDPVDKVVLQK | |
QHQLNGKMVDVKKALPKNDQQGGGGGRGGPGGRAGGNRGNMGGGNYGNQNGGGNWNNGGN | |
NWGNNRGNDNWGNNSFGGGGGGGGGYGGGNNSWGNNNPWDNGNGGGNFGGGGNNWNGGND | |
FGGYQQNYGGGPQRGGGNFNNNRMQPYQGGGGFKAGGGNQGNYGNNQGFNNGGNNRRY | |
>roa2_drome Rea guano ligand | |
MVNSNQNQNGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHEKWGNIVDVV |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
[cjfields@Chriss-MacBook-Pro bioperl6 (master)]$ prove6 -l -v t/Role/Aliased.t | |
t/Role/Aliased.t .. | |
ok 1 - | |
not ok 2 - adds alias | |
# Failed test 'adds alias' | |
# at t/Role/Aliased.t line 23 | |
ok 3 - | |
1..3 | |
# Looks like you failed 1 tests of 3 |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
use v6; | |
use Test; | |
use Bio::Tools::CodonTable; | |
use Bio::PrimarySeq; | |
done(); |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
-system-specific-4.1$ samtools view -h Control_Input_2_GAGTGG_L008_R1_001.trimmed.sorted.bam | head -n 100 | |
@HD VN:1.0 SO:coordinate | |
@PG ID:novoalign PN:novoalign VN:V3.02.00 CL:novoalign -c 7 -d /home/mirrors/igenome/Homo_sapiens/UCSC/hg19/Sequence/NovoalignIndex/WholeGenomeFasta.nvi -f /home/groups/hpcbio/projects/longley/2014-08-04/results/2014-08-06-alignment/Control_Input_2_GAGTGG_L008_R1_001.trimmed.fastq.gz -l 15 -r RANDOM -o SAM | |
@SQ SN:chrM LN:16571 AS:WholeGenomeFasta.nvi | |
@SQ SN:chr1 LN:249250621 AS:WholeGenomeFasta.nvi | |
@SQ SN:chr2 LN:243199373 AS:WholeGenomeFasta.nvi | |
@SQ SN:chr3 LN:198022430 AS:WholeGenomeFasta.nvi | |
@SQ SN:chr4 LN:191154276 AS:WholeGenomeFasta.nvi | |
@SQ SN:chr5 LN:180915260 AS:WholeGenomeFasta.nvi | |
@SQ SN:chr6 LN:171115067 AS:WholeGenomeFasta.nvi |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
From bce13df624f703ac7501aaa83f87fe644f187c1a Mon Sep 17 00:00:00 2001 | |
From: Chris Fields <cjfields@illinois.edu> | |
Date: Tue, 7 Jan 2014 14:31:47 -0600 | |
Subject: [PATCH] API change in kent utils; not sure how to check for the | |
version yet, so this branch will need a little more work | |
--- | |
Bio-BigFile/lib/Bio/DB/BigFile.xs | 6 ++++-- | |
1 file changed, 4 insertions(+), 2 deletions(-) |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
==25851== Memcheck, a memory error detector | |
==25851== Copyright (C) 2002-2010, and GNU GPL'd, by Julian Seward et al. | |
==25851== Using Valgrind-3.6.1-Debian and LibVEX; rerun with -h for copyright info | |
==25851== Command: lumpy -mw 4 -tt 1e-3 -sr bam_file:JHU_926_5_sr.sorted.bam,back_distance:20,weight:1,min_mapping_threshold:1,id:1 | |
==25851== | |
--25851-- Valgrind options: | |
--25851-- --suppressions=/usr/lib/valgrind/debian-libc6-dbg.supp | |
--25851-- -v | |
--25851-- --leak-check=yes | |
--25851-- Contents of /proc/version: |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/env perl | |
use Modern::Perl; | |
use Bio::DB::EUtilities; | |
# set optional history queue | |
my $factory = Bio::DB::EUtilities->new(-eutil => 'esearch', | |
-email => 'cjfields@bioperl.org', | |
-db => 'nuccore', | |
-term => 'Nasonia vitripennis[organism] NOT 13660[BioProject] NOT WGS[Keyword]', | |
-usehistory => 'y'); | |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/perl | |
use strict; | |
use warnings; | |
use Bio::DB::EUtilities; | |
use Bio::SeqIO; | |
# this needs to be a list of EntrezGene unique IDs | |
my @gene_ids = @ARGV; | |
my $eutil = Bio::DB::EUtilities->new(-eutil => 'esummary', |