View esearch
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
esearch -db bioproject -query "ENTREZ QUERY HERE" | efetch -format docsum | xtract -pattern DocumentSummary -element Project_Acc Project_Title Project_Target_Material Project_MethodType Project_Description Sequencing_Status |
View pretty_boxplot
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
# get the data as per https://www.cedricscherer.com/2019/05/17/the-evolution-of-a-ggplot-ep.-1/#code | |
library(tidyverse) | |
devtools::source_gist("https://gist.github.com/Z3tt/301bb0c7e3565111770121af2bd60c11") | |
# convert to data.frame, attach and sort region | |
df <- as.data.frame(df_ratios) | |
attach(df) | |
# get rid of NAs | |
df <- df[ ! is.na(student_ratio),] |
View ssl error run 3
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Output: | |
``` | |
run at 2021-05-13 20:37:49.539609 | |
run at 2021-05-13 20:37:51.455154 | |
run at 2021-05-13 20:37:53.464305 | |
run at 2021-05-13 20:37:55.362489 | |
run at 2021-05-13 20:37:57.314623 | |
wait at 2021-05-13 20:37:57.565849 | |
wait at 2021-05-13 20:37:58.586121 |
View gist:56e489eb18d677f6bd0f7c17864d25ec
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Output: | |
``` | |
run at 2021-05-13 17:32:33.076136 | |
run at 2021-05-13 17:32:35.094340 | |
run at 2021-05-13 17:32:36.977748 | |
run at 2021-05-13 17:32:38.854865 | |
run at 2021-05-13 17:32:40.755098 | |
wait at 2021-05-13 17:32:41.120666 | |
wait at 2021-05-13 17:32:42.447928 |
View gist:4223bf6bc30391a0300cb0e160f644ff
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Output: | |
``` | |
run at 2021-05-13 17:27:28.334900 | |
run at 2021-05-13 17:27:30.287149 | |
run at 2021-05-13 17:27:32.254218 | |
run at 2021-05-13 17:27:34.109459 | |
run at 2021-05-13 17:27:36.062005 | |
wait at 2021-05-13 17:27:36.433094 | |
wait at 2021-05-13 17:27:37.513581 |
View bad fit
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
d <- data.frame(frac=seq(0.1,1.0,by=0.1), total=c(116,175,215,246,271,291,308,323,336,348)) | |
plot(d$frac, d$total, pch=16, xlim=c(0,3), ylim=c(0,400)) | |
fit <- lm(formula = total ~ I(1/frac), data=d) | |
nd <- data.frame(frac=seq(0.1,3.0,by=0.1)) | |
nd$pred <- predict(fit, newdata=nd) |
View health_wealth
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
x <- 0:100 | |
y <- 100/x | |
plot(x,y, xlim=c(0,100), ylim=c(0,100), type="l", xlab="health", ylab="wealth", xaxt="n", yaxt="n", bty="n") | |
#axis(side=1, labels=FALSE, tick=NA, lty=1, lwd=1) | |
u <- par("usr") | |
# Use arrows() to draw the axis lines, adding the arrowheads | |
# Use the par("usr") values to specify the end points of the lines |
View diamond_blastp
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
query: | |
>contig_1648_86 # 93536 # 94054 # 1 # ID=21_86;partial=00;start_type=ATG;rbs_motif=AGGAG/GGAGG;rbs_spacer=11-12bp;gc_cont=0.696 | |
MMTLLHLISAVALLVWGTHIVRTGVLRVYGARLRRWLGGRLNRPLAFAAGTGVTALVQSS | |
NATALLASGFVADRLMPLATATREVLRMGDIVEGMLAAILEALRNERAGSARDLGDQDDE | |
LDELYTGIKLYLELIGDMKRLNSLFCAVAFSTVEEEDGDGPGLSTLSRRSRP* | |
subject: | |
>tr|A0A2E9RF79|A0A2E9RF79_9GAMM PhoU domain-containing protein OS=Alcanivorax sp. OX=1872427 GN=CL543_00625 PE=4 SV=1 | |
MMTLLHLXSAVALLVWGTHIVRTGVLRVYGARLRRWLGGRLNRPLAFAAGTGVTALVQSS | |
NATALLASGFVADRLMPLATALAILLGADLGTALMARVLTLDLSWLWPLLVIAGVPLFLS |
View magpy_thoughts
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Download Miniconda | |
Main env (python 3.5): | |
- snakemake | |
- Ete3? | |
- CheckM | |
- HMMER | |
- pplacer | |
- FastTree | |
- Prodigal |
View cowplot_mimic
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
## functions | |
plot.histograms <- function(cname="", flip=FALSE, xlim) { | |
dse <- density(setosa[, cname]) | |
dve <- density(versicolor[, cname]) | |
dvi <- density(virginica[, cname]) | |
ymax <- max(c(dse$y, dve$y, dvi$y)) |
NewerOlder